NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083805

Metagenome / Metatranscriptome Family F083805

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083805
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 41 residues
Representative Sequence PEQRRQYAVALAEELLQFERPMPVMDNYDLLLANTKGAIQ
Number of Associated Samples 96
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.90 %
% of genes near scaffold ends (potentially truncated) 96.43 %
% of genes from short scaffolds (< 2000 bps) 98.21 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.643 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(31.250 % of family members)
Environment Ontology (ENVO) Unclassified
(37.500 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.429 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.76%    β-sheet: 0.00%    Coil/Unstructured: 63.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF01695IstB_IS21 94.64
PF04011LemA 0.89
PF09363XFP_C 0.89
PF02899Phage_int_SAM_1 0.89
PF02518HATPase_c 0.89
PF08808RES 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 94.64
COG1704Magnetosome formation protein MamQ, lipoprotein antigen LemA familyCell wall/membrane/envelope biogenesis [M] 0.89
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.89
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.89
COG5654Predicted toxin component of a toxin-antitoxin system, contains RES domainDefense mechanisms [V] 0.89

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.64 %
UnclassifiedrootN/A5.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10266937All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300001867|JGI12627J18819_10383795All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005541|Ga0070733_11085835All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005617|Ga0068859_100522417All Organisms → cellular organisms → Bacteria1282Open in IMG/M
3300005618|Ga0068864_101047996All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300006894|Ga0079215_10452970All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae781Open in IMG/M
3300009137|Ga0066709_103809423All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300009520|Ga0116214_1447453All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300009548|Ga0116107_1202244All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300009628|Ga0116125_1177688All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300009638|Ga0116113_1188944All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300009644|Ga0116121_1108855All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300010049|Ga0123356_12485670All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300010361|Ga0126378_11470465All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300010362|Ga0126377_13024956All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300010379|Ga0136449_101041577All Organisms → cellular organisms → Bacteria1311Open in IMG/M
3300010429|Ga0116241_11275727All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300012202|Ga0137363_10535930All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300012228|Ga0137459_1234289All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300014491|Ga0182014_10188639All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300014499|Ga0182012_10531130All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui762Open in IMG/M
3300014501|Ga0182024_12054570All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300014501|Ga0182024_12626213All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300014657|Ga0181522_10399621All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300014657|Ga0181522_10536326All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300014658|Ga0181519_10455775All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300014839|Ga0182027_10678979All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300017988|Ga0181520_10900084All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300017996|Ga0187891_1161335All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300018009|Ga0187884_10274086All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300018034|Ga0187863_10099962All Organisms → cellular organisms → Bacteria1626Open in IMG/M
3300018034|Ga0187863_10295054All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300018034|Ga0187863_10824398All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300018037|Ga0187883_10597340All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300018043|Ga0187887_10345247All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300018465|Ga0190269_11722497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides530Open in IMG/M
3300020021|Ga0193726_1248287Not Available722Open in IMG/M
3300021329|Ga0210362_1291560All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300021420|Ga0210394_10445124All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300021477|Ga0210398_10421551All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300022518|Ga0224548_1032153All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300022872|Ga0224526_1066176All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300023091|Ga0224559_1074523All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300023254|Ga0224524_1016670All Organisms → cellular organisms → Bacteria1551Open in IMG/M
3300024240|Ga0224522_1074299All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300025434|Ga0208690_1011206All Organisms → cellular organisms → Bacteria1790Open in IMG/M
3300025914|Ga0207671_11143061All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300025918|Ga0207662_10214507All Organisms → cellular organisms → Bacteria1251Open in IMG/M
3300025945|Ga0207679_11092226Not Available732Open in IMG/M
3300025990|Ga0208527_1026772All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300026095|Ga0207676_10279311All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1516Open in IMG/M
3300028268|Ga0255348_1035260All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300028379|Ga0268266_11235845All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300028560|Ga0302144_10308163All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300028574|Ga0302153_10066065All Organisms → cellular organisms → Bacteria1217Open in IMG/M
3300028648|Ga0268299_1098891All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae824Open in IMG/M
3300028745|Ga0302267_10339059All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300028765|Ga0302198_10241012All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300028774|Ga0302208_10085675All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300028775|Ga0302231_10234448Not Available767Open in IMG/M
3300028788|Ga0302189_10227570Not Available770Open in IMG/M
3300028795|Ga0302227_10125415All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300028798|Ga0302222_10148914All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300028854|Ga0302268_1116486All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300028866|Ga0302278_10220342All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300028873|Ga0302197_10182410All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300028873|Ga0302197_10269037All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300028873|Ga0302197_10453819All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300028874|Ga0302155_10275887All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300028874|Ga0302155_10415122All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300028909|Ga0302200_10137216All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300028909|Ga0302200_10157024All Organisms → cellular organisms → Bacteria1174Open in IMG/M
3300029883|Ga0311327_10873700All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300029907|Ga0311329_10517912All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300029915|Ga0311358_10135294All Organisms → cellular organisms → Bacteria2401Open in IMG/M
3300029919|Ga0302141_1050321All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300029922|Ga0311363_10677359All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300029943|Ga0311340_10707567All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300029953|Ga0311343_10473855All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300029956|Ga0302150_10093001All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300029956|Ga0302150_10106961All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300029986|Ga0302188_10157353All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300029986|Ga0302188_10245156All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300029986|Ga0302188_10387171All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300029998|Ga0302271_10178415All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300030051|Ga0302195_10411678All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300030058|Ga0302179_10549950All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300030399|Ga0311353_10432912All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300030503|Ga0311370_10406796All Organisms → cellular organisms → Bacteria → Acidobacteria1708Open in IMG/M
3300030507|Ga0302192_10156174All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300030507|Ga0302192_10201459All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300030508|Ga0302185_10172325All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300030688|Ga0311345_10526899All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300030688|Ga0311345_10546548All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300030737|Ga0302310_10381355All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300030838|Ga0311335_11317521All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300030943|Ga0311366_10453204All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300030943|Ga0311366_10469223All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300031057|Ga0170834_102164960All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300031234|Ga0302325_12360080All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300031236|Ga0302324_101711555All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300031259|Ga0302187_10508864All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300031261|Ga0302140_11196357All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300031524|Ga0302320_11013363All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300031708|Ga0310686_100709815All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300031708|Ga0310686_116583978All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300031880|Ga0318544_10076028All Organisms → cellular organisms → Bacteria1244Open in IMG/M
3300032272|Ga0316189_11080327All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300032783|Ga0335079_12213133Not Available524Open in IMG/M
3300032805|Ga0335078_10766985All Organisms → cellular organisms → Bacteria1182Open in IMG/M
3300034130|Ga0370494_043540All Organisms → cellular organisms → Bacteria1141Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog31.25%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.93%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland6.25%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil5.36%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.46%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen4.46%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.57%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.79%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.79%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.79%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.89%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.89%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.89%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.89%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.89%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.89%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.89%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.89%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010429AD_USRAcaEngineeredOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300021329Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022518Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24EnvironmentalOpen in IMG/M
3300022872Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300023254Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T75EnvironmentalOpen in IMG/M
3300024240Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T25EnvironmentalOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025990Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028268Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028648Activated sludge microbial communities from bioreactor in Nijmegen, Gelderland, Netherland - NOB reactorEngineeredOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028765Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2EnvironmentalOpen in IMG/M
3300028774Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028854Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_1EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300028874Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1EnvironmentalOpen in IMG/M
3300028909Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029919Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300029998Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1EnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030508Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_2EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300034130Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1026693723300001356Peatlands SoilEQRRRYAVALAEELQQYERPMPVMDDYDLLLANTTGGVQ*
JGI12627J18819_1038379513300001867Forest SoilQHAVALAEELLQFERPMPVMDNYDLLLANTTGAIH*
Ga0070733_1108583523300005541Surface SoilRRRSAIALAEELTEFERPMPVMDEYDLLLNDTAGGIQ*
Ga0068859_10052241713300005617Switchgrass RhizosphereDGEQRRQYAIALAEELSAFERPMPEMHEYDLLLSNPVGGVQ*
Ga0068864_10104799623300005618Switchgrass RhizosphereRQYAIALAEELSAFERPMPEMHEYDLLLSNPVGGVQ*
Ga0079215_1045297013300006894Agricultural SoilPEQRRQYAIALAEELAEFERPMPVMDDYDLLLTDPTGGIQ*
Ga0066709_10380942323300009137Grasslands SoilRQYAITRAEELQQFERPMPTLAEYDLLLANGKGGIQ*
Ga0116214_144745323300009520Peatlands SoilPEQRRRYAVALAEELQQYERPMPVMDDYDLLLANTTGGVQ*
Ga0116107_120224423300009548PeatlandLHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLTSATGAIQ*
Ga0116125_117768823300009628PeatlandAVLHLLRMPDPEQRHQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ*
Ga0116113_118894423300009638PeatlandMHLLRMPDPEQRRQHAVALAEELLQFELPMPVMDNYDLLLANTTGAIH*
Ga0116121_110885513300009644PeatlandQHALALAEELLQFERPMPVMDNYDLLLANATGGIH*
Ga0123356_1248567023300010049Termite GutLHLLRMPDAEQRRQLAVALAEELLQFERPMPVMDNYDLLLANPKGAIQ*
Ga0126378_1147046523300010361Tropical Forest SoilPEERRRHAIALTEELAEFERPMPVMDEYDLLLNDTPGGIQ*
Ga0126377_1302495613300010362Tropical Forest SoilRRRYAVALAAELVQFERPMPAMDEYDQLLSQAPGGIQ*
Ga0136449_10104157723300010379Peatlands SoilRRYALDLADELVQFERPMPVMDDYDLLLADATGGIQ*
Ga0116241_1127572713300010429Anaerobic Digestor SludgeVQRQQYALALAEELAQFERPAPGVDEYDLLLADAAGGLQ*
Ga0137363_1053593023300012202Vadose Zone SoilMPDQEERRCYAIALAKELAEFERPMPAMDEYDLLLKDTPGGIQ*
Ga0137459_123428923300012228SoilLHMPDAEQRRQYAIALAEELQEYERPMPTLTEYDLLLADGEGGIRS*
Ga0182014_1018863913300014491BogAVALAEELQQYERPMPVMDNYDLLLADNTTGAIQ*
Ga0182012_1053113013300014499BogHAVALAEELLQFERPMPVMDNYDLLLANTTGAIQ*
Ga0182024_1205457013300014501PermafrostMHLLRMPDPEQRRQYAVALAEELLQFERPMPVMDNYDLLLANTTRAIQ*
Ga0182024_1262621313300014501PermafrostLHLLRMPDPEQRHQYAVALAEELLPFERPMPVMDEYDLLLANTTGGIQ*
Ga0181522_1039962113300014657BogMPDPEERRCYAIALAEELAEFERPMPVMDEYDLLLKDTPGGIQ*
Ga0181522_1053632623300014657BogLHILHMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLTSTTGAIQ*
Ga0181519_1045577523300014658BogQYAVALAEELQQYERPMPVMDNYDLLLAANATGAIQ*
Ga0182027_1067897933300014839FenLRMPDPEQRRQYAVSLAEELQQYERPMPVMDNYDLLLAANTTGAIQ*
Ga0181520_1090008423300017988BogQQRQQYALALAEELAQFERPMPVMDDYDLLLAGTRGGIQ
Ga0187891_116133523300017996PeatlandRRRYALALAEDLIQFERPMPVMDEYDLLLQDTPGGIQ
Ga0187884_1027408613300018009PeatlandDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLTSTTGAIQ
Ga0187863_1009996213300018034PeatlandMPDPEQRRQYAVSLAEELQQYERPMPVMDNYDLLLAANTTGAIQ
Ga0187863_1029505413300018034PeatlandQYAVALAEELQQYERPMPVMDNYDLLLTSTTGAIQ
Ga0187863_1082439823300018034PeatlandPEQRRQYAVALADELLQFERPMPVMDNYDLLLANTTGAIH
Ga0187883_1059734013300018037PeatlandEQRRQYALTLAEELAQFERPMPVMDDYDLLLTGTRGGIQ
Ga0187887_1034524713300018043PeatlandRQYAVSLAEELQQYERPMPVMDNYDLLLAANTTGAIQ
Ga0190269_1172249713300018465SoilRQSAIALAEELCEFERPMPTMQEYDLLLSGAGGVQ
Ga0193726_124828713300020021SoilPEERRRYAIALAEELAEFERPMPVMDEYDLLLNNTPGGIQ
Ga0210362_129156013300021329EstuarineMPDPEERRRHAVALADELAEYERPMPVMDDYDLLLADTPGGIQ
Ga0210394_1044512423300021420SoilHILYMPDPEQRRQYALDLADELAQFERPMPVMDDYDLLLTDTMGGIQ
Ga0210398_1042155133300021477SoilRQYDVALAEPLLQYERPMPVMDHYNLLLTTTGAIQ
Ga0224548_103215313300022518SoilDPEQRRRYALDLADELAQFERPMPVMDDYDLLLADATGGIQ
Ga0224526_106617623300022872SoilLHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ
Ga0224559_107452313300023091SoilPEQRRQYAVALAEELQQYERPMPVMDNYDLLLVASTTEAIQ
Ga0224524_101667023300023254SoilPEQRRQYAVTLAEELQQYERPMPVMDNYDLLLANTTGAIQ
Ga0224522_107429913300024240SoilVLHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLAANTTGAIQ
Ga0208690_101120633300025434PeatlandAAVLHLLRMPDPEQRRQYAVSLAEELQQYERPMPVMDNYDLLLAANTTGAIQ
Ga0207671_1114306113300025914Corn RhizosphereERGRYAIALAEELAGFERPMPVMDEYDLLLNERPGGIQ
Ga0207662_1021450743300025918Switchgrass RhizosphereAMNPFDAIALEEELAQFERPMPEMDEYDLLLGGIQ
Ga0207679_1109222613300025945Corn RhizosphereGRYAIALAEELAGFERPMPVMDEYDLLLNERLGGIQ
Ga0208527_102677223300025990Rice Paddy SoilPEQRRQHAVALAEELLQFERPMPAMDNYDLLLANTTGAIH
Ga0207676_1027931113300026095Switchgrass RhizosphereMSRQYAIALAEELSAFERPMPEMHEYDLLLSNPVGGVQ
Ga0255348_103526033300028268SoilHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ
Ga0268266_1123584523300028379Switchgrass RhizosphereTEGDPEQRRQYAVALAEELAEFERPMPVMDEYDLLLGDTPGGIQ
Ga0302144_1030816313300028560BogDPEQRRQHAVALAEELLQFERPMPVMDNYDLLLDNTTGAIH
Ga0302153_1006606513300028574BogRQYAVALAEELQQYERPMPVMDNYDLLLVNPTGVIQ
Ga0268299_109889113300028648Activated SludgeILHMPHAEQRQGHAIALAEELREFERPMPVMNDYDLLLGGATGGLR
Ga0302267_1033905923300028745BogPDPEQRRQHAVALAEELRQFERPMPVMDNYDLLLANTTGAIH
Ga0302198_1024101213300028765BogRQHAVALAEELRQFERPMPVMDNYDLLLANTTGAIH
Ga0302208_1008567523300028774FenRQHAVALAEELLQFERPMPVMDNYDLLLANTTGAIH
Ga0302231_1023444823300028775PalsaMHLLRMPDPEQRRQCAVALAEELQQYERPMPVMDNYDLLLTNTTGAIQ
Ga0302189_1022757013300028788BogSAAVLHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ
Ga0302227_1012541523300028795PalsaRRQHAVALAEELMQFERPMPVMDNYDLLLANTTEAIH
Ga0302222_1014891423300028798PalsaEERRRYAIALAEELAEFERPMPVMDEYDLLLKDTPGGIQ
Ga0302268_111648613300028854BogHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLTSTTGAIQ
Ga0302278_1022034213300028866BogRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ
Ga0302197_1017303323300028873BogDAAAVMHLLRMPDPEQRHQYAVALADELQQYERPMPVMDNYDLLLANTTGAIQ
Ga0302197_1018241023300028873BogQRRRYAIALAEELREFERPMPTMAEYDLLLADGNGGIQ
Ga0302197_1026903723300028873BogPDAEQRRQYAVALAEELQQYERPMPVMDNYDLLLANTAGAIQ
Ga0302197_1045381913300028873BogMHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLTSTTGAIQ
Ga0302155_1027588723300028874BogQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ
Ga0302155_1041512213300028874BogLHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLVASTTEAIQ
Ga0302200_1013721613300028909BogPEQRRQYAVALAEELLQFERPMPVMDNYDLLLANTKGAIQ
Ga0302200_1015702413300028909BogEQRRQHAVALAEELLQFERPMPVMDNYDLLLANTTGAIH
Ga0311327_1087370023300029883BogDPEQRRQHAVALAEELLQFERPMPVMDNYDLLLANTTGAIH
Ga0311329_1051791223300029907BogPDPEQRRQYAVALAEELLQFERPMPVMDNYDLLLANTKGAIQ
Ga0311358_1013529413300029915BogRRQYAVALAEELQQYERPMPVMDNYDLLLTSTTGAIQ
Ga0302141_105032133300029919BogPEQRRQYAVALAEELLQFERPMPVMDNYDLLLTSTTGAIQ
Ga0311363_1067735923300029922FenDPEQRRQYAVALAEELLQFERPMPVMDNYDLLLTSTTGAIQ
Ga0311340_1070756713300029943PalsaPEQRRQCAVALAEELQQYERPMPVMDNYDLLLTNTTGAIQ
Ga0311343_1047385523300029953BogRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLATNTTGAIQ
Ga0302150_1009300133300029956BogRMPDPEQRRQYAVALAEELLQFERPMPVMDNYDLLLANTTRAIQ
Ga0302150_1010696113300029956BogPEQRRQHAVALAEELQQFERPMPAMDNYDLLLDNITGVIQ
Ga0302188_1015735313300029986BogYAVSLAEELQQYERPMPVMDNYDLLLAASTTEAIQ
Ga0302188_1024515623300029986BogEQRHQYAVALAEELRQFERPMPVMDDYDLLLTNTTGAIQ
Ga0302188_1038717123300029986BogRQHAVALAEELQQFERPMPVMDNYDLLLANTTGAIQ
Ga0302271_1017841523300029998BogPEQRRQHEVALAEELLQFERPMPVMDNYDLLLANTTGAIH
Ga0302195_1041167823300030051BogQYAVALAEELLQFERPMPVMDNYDLLLANTKGAIQ
Ga0302179_1054995023300030058PalsaQYAVALAEELLQFERPMPVMDNYDLLLANTTRAIQ
Ga0311353_1043291213300030399PalsaRMPDPEQRRQHAVALAEELQQYERPMPVMDNYDLLLTNTTGAIQ
Ga0311370_1040679633300030503PalsaDPEQRRQHAVALAKELMEFERPMPVMDEYDLLLTAPTGGIQ
Ga0302192_1015617433300030507BogQYAVALAEELQQYERPMPVMDNYDLLLVASTTEAIQ
Ga0302192_1020145913300030507BogAVMHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLTSTTGAIQ
Ga0302185_1017232523300030508BogRRQYAVSLAEELQQYERPMPVMDNYDLLLAASTTEAIQ
Ga0311345_1052689923300030688BogAAVLHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ
Ga0311345_1054654813300030688BogHLLRMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLANTAGAIQ
Ga0302310_1038135523300030737PalsaVLHILHMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLTSTTGAIQ
Ga0311335_1131752113300030838FenEKRRQYALDLADELAQFERPMPVMDDYDLLLTEPMGGIQ
Ga0311366_1045320433300030943FenPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLAANATGAIQ
Ga0311366_1046922313300030943FenRQRYAIALAEELAQFERPMPVMDDYDLLLSDGAGGIQ
Ga0170834_10216496033300031057Forest SoilSYAIALAEELAAFERPMPVMDEYDLLLKGTPGGVQ
Ga0302325_1236008013300031234PalsaKPVHLLRTPDPEQRRQHAVALAEELLQFERPMPVMNNYDLFLANTTGAIH
Ga0302324_10171155533300031236PalsaRRHALKLAEELKAFERPMPVMDEYDQLLSDGGAIK
Ga0302187_1050886413300031259BogHLLRTPDPEQRRQRAVALAEELQQFERPMPVMDNYDLLLVNTTGAIQ
Ga0302140_1119635723300031261BogHQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ
Ga0302320_1101336323300031524BogQRRQYAVALAEELQQYERPMPVMDNYDLLLVNTTGAIQ
Ga0310686_10070981513300031708SoilQRRQYALALAEELVQFERPMPVMDEYDLLLSDTRRDIQ
Ga0310686_11658397813300031708SoilRQYAMSLAEELAQFERPMPVMDDYDLLLTGPAGGIQ
Ga0318544_1007602813300031880SoilPEQRRQYAVALAEELLQFERPMPVMDNYDLLLANPKGAIQ
Ga0316189_1108032723300032272Worm BurrowILRMPDAEQRRQYAIALAEELKQFERPLPVMDDYDLLLADPAGGVQ
Ga0335079_1221313323300032783SoilQQRRQQAMALAQELVQFERPMPVMDEYDLLLSDTQGDIQ
Ga0335078_1076698533300032805SoilHMPDADERRRYAIALEAELAQFERPMPAMEEYDLLLSETPGGIQ
Ga0370494_043540_13_1443300034130Untreated Peat SoilMPDPEQRRQYAVALAEELQQYERPMPVMDNYDLLLANTTGAIQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.