NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083821

Metagenome / Metatranscriptome Family F083821

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083821
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 48 residues
Representative Sequence MKRHGFDTRNPDFIWNKNRLVLEKEAIKRQMLNVIKKKPANK
Number of Associated Samples 89
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 85.71 %
% of genes near scaffold ends (potentially truncated) 16.07 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.107 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(29.464 % of family members)
Environment Ontology (ENVO) Unclassified
(49.107 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(75.893 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.29%    β-sheet: 0.00%    Coil/Unstructured: 65.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF00069Pkinase 46.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 185.71

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.11 %
UnclassifiedrootN/A0.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002835|B570J40625_100454463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1221Open in IMG/M
3300005516|Ga0066831_10034681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1370Open in IMG/M
3300005516|Ga0066831_10038565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1297Open in IMG/M
3300005516|Ga0066831_10040217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1270Open in IMG/M
3300005516|Ga0066831_10055235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1074Open in IMG/M
3300005838|Ga0008649_10175750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae843Open in IMG/M
3300005942|Ga0070742_10240906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae505Open in IMG/M
3300005987|Ga0075158_10211652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1113Open in IMG/M
3300005989|Ga0075154_10174694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1240Open in IMG/M
3300006029|Ga0075466_1051748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1208Open in IMG/M
3300006875|Ga0075473_10342343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae605Open in IMG/M
3300007513|Ga0105019_1130212All Organisms → cellular organisms → Eukaryota1330Open in IMG/M
3300007513|Ga0105019_1141144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1261Open in IMG/M
3300007513|Ga0105019_1144582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1242Open in IMG/M
3300007513|Ga0105019_1144992All Organisms → cellular organisms → Eukaryota1239Open in IMG/M
3300007513|Ga0105019_1151898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1202Open in IMG/M
3300007513|Ga0105019_1249912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae811Open in IMG/M
3300007513|Ga0105019_1274422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea724Open in IMG/M
3300007552|Ga0102818_1021125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1287Open in IMG/M
3300007554|Ga0102820_1069840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae845Open in IMG/M
3300007718|Ga0102852_1129911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae511Open in IMG/M
3300007760|Ga0105018_1108611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae988Open in IMG/M
3300007957|Ga0105742_1065456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae535Open in IMG/M
3300008107|Ga0114340_1231808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae581Open in IMG/M
3300008119|Ga0114354_1088816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia1245Open in IMG/M
3300009002|Ga0102810_1121430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae809Open in IMG/M
3300009003|Ga0102813_1179033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae658Open in IMG/M
3300009071|Ga0115566_10832362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae507Open in IMG/M
3300009079|Ga0102814_10220703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1033Open in IMG/M
3300009079|Ga0102814_10297685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae878Open in IMG/M
3300009172|Ga0114995_10177000All Organisms → cellular organisms → Eukaryota1187Open in IMG/M
3300009172|Ga0114995_10405987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae747Open in IMG/M
3300009263|Ga0103872_1010697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea943Open in IMG/M
3300009265|Ga0103873_1013523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1212Open in IMG/M
3300009436|Ga0115008_11419639Not Available535Open in IMG/M
3300009436|Ga0115008_11589028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae507Open in IMG/M
3300009441|Ga0115007_10177372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1372Open in IMG/M
3300009441|Ga0115007_10556194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae761Open in IMG/M
3300009447|Ga0115560_1283546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae632Open in IMG/M
3300009495|Ga0115571_1097893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1275Open in IMG/M
3300009496|Ga0115570_10428339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae560Open in IMG/M
3300009512|Ga0115003_10871376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae523Open in IMG/M
3300009593|Ga0115011_10936660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae728Open in IMG/M
3300009599|Ga0115103_1033613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1021Open in IMG/M
3300009599|Ga0115103_1092243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1043Open in IMG/M
3300009606|Ga0115102_10842912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae548Open in IMG/M
3300009785|Ga0115001_10626617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae656Open in IMG/M
3300010354|Ga0129333_10439338All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1150Open in IMG/M
3300010368|Ga0129324_10113252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1159Open in IMG/M
3300010883|Ga0133547_11594973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1219Open in IMG/M
3300010883|Ga0133547_11697847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1173Open in IMG/M
3300010885|Ga0133913_12967563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1133Open in IMG/M
3300012522|Ga0129326_1152603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1004Open in IMG/M
3300012770|Ga0138291_1007392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae665Open in IMG/M
3300012953|Ga0163179_10975818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae737Open in IMG/M
3300012953|Ga0163179_11536280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae600Open in IMG/M
3300013004|Ga0164293_10316761All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1075Open in IMG/M
3300016726|Ga0182045_1353422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae934Open in IMG/M
3300016748|Ga0182043_1299393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1005Open in IMG/M
3300017788|Ga0169931_10717234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae655Open in IMG/M
3300017967|Ga0181590_11036547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea533Open in IMG/M
3300018596|Ga0193060_1020127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea535Open in IMG/M
3300018692|Ga0192944_1011359All Organisms → cellular organisms → Eukaryota1156Open in IMG/M
3300018846|Ga0193253_1043829All Organisms → cellular organisms → Eukaryota1104Open in IMG/M
3300018871|Ga0192978_1028001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1048Open in IMG/M
3300018980|Ga0192961_10050582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1193Open in IMG/M
3300018989|Ga0193030_10311248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae508Open in IMG/M
3300019036|Ga0192945_10065067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1088Open in IMG/M
3300019036|Ga0192945_10285635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae517Open in IMG/M
3300019050|Ga0192966_10233149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea656Open in IMG/M
3300019051|Ga0192826_10122716All Organisms → cellular organisms → Eukaryota945Open in IMG/M
3300019126|Ga0193144_1013703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1038Open in IMG/M
3300019149|Ga0188870_10118150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae625Open in IMG/M
3300019150|Ga0194244_10093388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae560Open in IMG/M
3300020175|Ga0206124_10405380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae506Open in IMG/M
3300020183|Ga0194115_10164161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1139Open in IMG/M
3300020205|Ga0211731_10798184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1229Open in IMG/M
3300021336|Ga0210307_1328338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1147Open in IMG/M
3300021365|Ga0206123_10106131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1334Open in IMG/M
3300021957|Ga0222717_10328595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae865Open in IMG/M
3300021962|Ga0222713_10227881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1227Open in IMG/M
(restricted) 3300024261|Ga0233439_10327945All Organisms → cellular organisms → Eukaryota648Open in IMG/M
3300024343|Ga0244777_10484615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae761Open in IMG/M
3300024346|Ga0244775_10661967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae844Open in IMG/M
3300025626|Ga0209716_1161953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea569Open in IMG/M
3300026182|Ga0208275_1021968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1351Open in IMG/M
3300026182|Ga0208275_1023140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1311Open in IMG/M
3300026182|Ga0208275_1023206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1309Open in IMG/M
3300026182|Ga0208275_1115931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae503Open in IMG/M
3300027687|Ga0209710_1077311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1387Open in IMG/M
3300027780|Ga0209502_10292318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae705Open in IMG/M
3300027786|Ga0209812_10306973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae700Open in IMG/M
3300027810|Ga0209302_10110946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1372Open in IMG/M
3300027810|Ga0209302_10110989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1371Open in IMG/M
3300027810|Ga0209302_10328070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae703Open in IMG/M
3300027849|Ga0209712_10147560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1346Open in IMG/M
3300028134|Ga0256411_1277989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea510Open in IMG/M
3300028279|Ga0228613_1148436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae546Open in IMG/M
3300028392|Ga0304729_1264012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae514Open in IMG/M
3300031522|Ga0307388_10213802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1175Open in IMG/M
3300031522|Ga0307388_10222564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1155Open in IMG/M
3300031523|Ga0307492_10085079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1077Open in IMG/M
3300031570|Ga0308144_1037262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae602Open in IMG/M
3300031725|Ga0307381_10089793All Organisms → cellular organisms → Eukaryota997Open in IMG/M
3300031729|Ga0307391_10699762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae577Open in IMG/M
3300031734|Ga0307397_10553795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae540Open in IMG/M
3300031737|Ga0307387_10209018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1119Open in IMG/M
3300032616|Ga0314671_10212860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1032Open in IMG/M
3300032666|Ga0314678_10210644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae853Open in IMG/M
3300032723|Ga0314703_10187645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae856Open in IMG/M
3300032750|Ga0314708_10307196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae779Open in IMG/M
3300033572|Ga0307390_10499590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae752Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine29.46%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine13.39%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine8.04%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine7.14%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.46%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.57%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.68%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.68%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.68%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent2.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.79%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.79%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.79%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.79%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.79%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.79%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.79%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.79%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.89%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.89%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.89%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.89%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.89%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.89%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300005989Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNAEngineeredOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007760Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300007957Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_3.0umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012770Freshwater microbial communities from Lake Simoncouche, Canada - S_140625_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300016726Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016748Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018596Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002183 (ERX1782364-ERR1711927)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019126Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000695 (ERX1782402-ERR1712043)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300024261 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MGEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027786Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028279Seawater microbial communities from Monterey Bay, California, United States - 14DEnvironmentalOpen in IMG/M
3300028392Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031570Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J40625_10045446313300002835FreshwaterMKRHGFDTRNPDFIWNKNRLVLEKEAIKRQMLNVIKKKPANKTD*
Ga0066831_1003468113300005516MarineMKRHSFDTKNPDFVWNKNRLAIEKEAIKRQMLNVIHKKNRKIEKADSSKA*
Ga0066831_1003856543300005516MarineMKRHGFDTKVPDFIWNKNRLVLEKEAIKKQMLNVINKKPAKKPTAGETTAG*
Ga0066831_1004021713300005516MarineMKKNGFDPKTPDFIWNKNRLALEKEAIKKQMLNVINKKTVKKAPGGETTDG*
Ga0066831_1005523513300005516MarineMKRHGYDTKNPDFIWNKNRLALEKEAIKKQMLGVINKKPAKKQTVAGETTAGQ*
Ga0008649_1017575013300005838MarineMKRNSIDTKVPDFIWNKNRLMLEKDAIKKQMMNVLKKKPGKTEGE*
Ga0070742_1024090613300005942EstuarineMFEGCMKKNGIDPKVPDFIWNKNRLVLEKEAIKKQMMNVIKKKPAKKETD*
Ga0075158_1021165243300005987Wastewater EffluentMKKNGWDPKVPDFIWNKNRLELEKQALKANLMKVINKPAKQND*
Ga0075154_1017469423300005989Wastewater EffluentMKKNGWDPKVPDFIWNKNRLVLEKEALKQNLMKVINKPAKRYN
Ga0075466_105174813300006029AqueousMKRHGFNLKTPDFIWNKNRLVLEKEQIKQQMMKVIEKKPAKKKDETA*
Ga0075473_1034234323300006875AqueousMKRHGFNTKTPDFIWNKNRLVLEKEQIKQQMLKVIEKKPKKKEDGTTD*
Ga0105019_113021213300007513MarineMKRHGFDTKVPDFIWYKNRLLLEKEAMKRQMLDVLNKKPKKDTEKV*
Ga0105019_114114453300007513MarineMKRHGIDTKTPDFIWNKNRLAMEKEAIKRQMLNVINKKPQKKD*
Ga0105019_114458223300007513MarineMEKNGFDKKNPDFIWNKNRLAMEKEAIKRQMLNVINKKPQKKETEQ*
Ga0105019_114499213300007513MarineMSLFEGCMKRNGIDTKTPDFIWNKNRLAMEKEAIKRQMLNVINKKPAKKEKD*
Ga0105019_115189813300007513MarineMKRHGFNLKTPDFIWNKNRLVLEKEQIKQQMMKVIEKKPAKKKDTE*
Ga0105019_124991213300007513MarineMKRHGIDTKTPDFVWNKNRLALEKEAIKRQMLNVINKKPQKKEGETN*
Ga0105019_127442223300007513MarineMKRHDFDPKIPDFIWNKNRFMLEKEAIKRQIQKVINKKPAKKSVKDESTTK*
Ga0102818_102112533300007552EstuarineMKRHSFNLKTPDFIWNKNRLVLEKEQIKQQMMKVIEKKPAKKKETNE*
Ga0102820_106984033300007554EstuarineMKKHEIDTKTPDFIWNKNRLVLEKEAIKRQMMNVINKKQGALKKE*
Ga0102852_112991123300007718EstuarineMKRHNIDTKTPDFIWNKNRLVMEKEAIKRQMMNVINKKQATPKPEGGV*
Ga0105018_110861133300007760MarineMKRHGIDTKTPDFVWNKNRLALEKEAIKRQMLNVINKKPQKKEGETN
Ga0105742_106545613300007957Estuary WaterYIIGLFEGCMKKNGFDTKNPDFIWNKNRLVLEKEAIKRQMMSVINKKAAKKDKGETDK*
Ga0114340_123180833300008107Freshwater, PlanktonMKRHGFDTRNPDFIWNKNRLVLEKEAIKRQMLNVIKKKPANK
Ga0114354_108881633300008119Freshwater, PlanktonMKRHGFDTRNPDFIWNKNRLVLEKEAIKRQMLNVIKKKLANKTD*
Ga0102810_112143013300009002EstuarineMKRHNIDTKTPDFIWNKNRVVMEKEAIKRQMMNVINKKQATPKPEGGV*
Ga0102813_117903313300009003EstuarineMKKNKIDTKIPDFIWNKNRLVLEKEAIKRQMMNAIKKKPAGKGETDK*
Ga0115566_1083236213300009071Pelagic MarineYGYIISLFEGCMKRHSFDTRTPDFIWNKNRLVLEKEAIKRQMMDVIKKKPHKKDDGADKDGTTGM*
Ga0102814_1022070313300009079EstuarineMKKNKIDTKIPDFIWNKNRLVLEKEAIKRQMMNAIKKKPTGKGETDK*
Ga0102814_1029768513300009079EstuarineMKKNGIDPKVPDFIWNKNRLVLEKEAIKKQMMNVIKKKPAKKETD*
Ga0114995_1017700033300009172MarineMKRNGIDTKTPDFIWNKNRLVLEKEAIKRQMMSVIKKPTATKKKD*
Ga0114995_1040598713300009172MarineMKRNGFDTKTPDFLWNKNRLALEKEAIKRQMMNVIKKKPAGAKDTTQA*
Ga0103872_101069723300009263Surface Ocean WaterMKKNNVDPKVSDFIWNKNRLVLEKEAIKKQMMNVIKKKPAKKETD*
Ga0103873_101352323300009265Surface Ocean WaterMKKNGFDTKTPDFIWNKNRLVLEKEAIKRQMLNVIQKKPAKKDKGATDK*
Ga0115008_1141963913300009436MarineMKRNGFDTKNADFVWNKNRLALEKEAIKKQMLNVINKKAPKKDELASN*
Ga0115008_1158902823300009436MarineMKKNGIDHKVSDFIWNKNRLVLEKEAIKKQMMNVIKKKPAKKETD*
Ga0115007_1017737213300009441MarineMKKNSFNTETPDFIWNKNRLAMEKEAIKKQMLNVINKKPARKAVDTTAK*
Ga0115007_1055619413300009441MarineMKKHQFDTKTPDFIWNKNRLALEKEAIKRQMMNVIKKKPAKGTETAGATA*
Ga0115560_128354613300009447Pelagic MarineMKKNNIDPKVSDFIWNKNRLVLEKEAIKKQMMNVIKKKPAKKETD*
Ga0115571_109789333300009495Pelagic MarineMKRNNIDTKTPDFVWNQNRLMLEKERIKKEMMGVIKKKTGKPTAQ*
Ga0115570_1042833913300009496Pelagic MarineMKRNGFDTKTPDFLWNKNRLALEKEAIKRQMMNVIKKKPAGGKDTTNA*
Ga0115003_1087137613300009512MarineMKRNGIDTKTPDFIWNKNRLVLEKEAIKRQMMSVIKKPTATKKKE*
Ga0115011_1093666023300009593MarineMTRHGFDPKTPDFIWNKNRLAMEKEAIKRQMLNVINKKPPAKKATD*
Ga0115103_103361333300009599MarineMKRHGFNLKTPDFIWNKNRLVLEKEQIKQQMMKVIEKKPAKKKDTDQ*
Ga0115103_109224333300009599MarineMKRHGFNLKTPDFIWNKNRLVLEKEQIKQQMMKVIEKKPAKKKDEGDRRDD*
Ga0115102_1084291233300009606MarineMKRHGFNLKTPDFIWNKNRLVLEKEQIKQQMMKVIEKKPAKKKEEGDR
Ga0115001_1062661713300009785MarineMKRNGIDTRTPDFIWNKNRLVLEKEAIKRQMMSVIKKPTATKKKD*
Ga0129333_1043933813300010354Freshwater To Marine Saline GradientMKKNGVDPKNPDFLWNKNRLAIEKEAIKRQMLNVLNKKTTPGAVAGKKME*
Ga0129324_1011325213300010368Freshwater To Marine Saline GradientMKRHEIDTKTPDFIWNKNRLVLEKEAIKRQMMNVINKKQGALKKD*
Ga0133547_1159497313300010883MarineMKRNSFDTKIPDFIWNKNRLALEKEAIKRQMLNVIKKKPGNK*
Ga0133547_1169784733300010883MarineMKRHGFNLKTPDFIWNKNRLVLEKEQIKQQMMKVIEKKPAKKKETDQ*
Ga0133913_1296756313300010885Freshwater LakeMKRHGFDTRNPDFIWNKNRLVLEKEAIKRQMLNVINKKPAKKTDKDETGQ*
Ga0129326_115260313300012522AqueousMKRHEIDTKTPDFIWNKNRLVLEKEAIKRQMMNVINKKQGALKK
Ga0138291_100739213300012770Freshwater LakeMKRHGFDTRNPDFIWNKNRLVLEKEAIKRQMLNVIKKK
Ga0163179_1097581813300012953SeawaterMKTNNIDPNTPDFIWNKNRLAMEKEAIKRQMLNVINKKPVKKPDNASN*
Ga0163179_1153628013300012953SeawaterMKTNGFDPNTPDFIWNKNRLAMEKEAIKRQMLNVINKKPAKKPDNASN*
Ga0164293_1031676123300013004FreshwaterMKRYGFDTRNPDFIWNKNRLVLEKEAIKRQMLNVIKKKPA
Ga0182045_135342233300016726Salt MarshMNRHGIEPKAPEFIWNQNRLALEKEAIKSQMMRVISKKPAKKDQTPAGN
Ga0182043_129939323300016748Salt MarshMKRHGFNLKTPDFIWNKNRLVLEKEQIKQQMMKVIEKKPAKKKDET
Ga0169931_1071723423300017788FreshwaterMKRHGFDTRNPDFIWNKNRLVLEKEAIKRQMLNVINKKPAKKTDKDEQS
Ga0181590_1103654713300017967Salt MarshMKRHGFNLKTPDFIWNKNRLVLEKEQIKQQMLKVIEKRPAKKKDETA
Ga0193060_102012713300018596MarineMKKNGFDTKNPDFIWNKNRLVLEKEAIKRQMMNVINKKPAKKDKHETDK
Ga0192944_101135933300018692MarineMKRNGIDTRTPDFIWNKNRLVLEKEAIKRQMMSVIKKPTATKKKD
Ga0193253_104382933300018846MarineMKKNGFDTKNPDFIWNKNRLVLEKEAIKRQMMSVINKKAAKKDKGETDK
Ga0192978_102800133300018871MarineMKKNNIDPKVSDFIWNKNRLVLEKEAIKKQMMNVIKKKPAKKETD
Ga0192961_1005058223300018980MarineMKKNGFDTKNPDFIWNKNRLVLEKEAIKRQMMSVINKKPVKKNRDETDK
Ga0193030_1031124813300018989MarineMKRQNIESKTPDFIWNKNRLVLEKEAIKKQMMNVINKKPAKKEKRED
Ga0192945_1006506713300019036MarineMKKNGIDPKVPDFIWNKNRLQLEKEAIKKQMMNVLNKQTGTKKKAETSK
Ga0192945_1028563523300019036MarineMKKNNIDTKISDFIWNKNRLVLEKEAIKKQMMNVIKKRPAKKETD
Ga0192966_1023314923300019050MarineMKKNGFDTKNPDFIWNKNRLVLEKEAIKRQMMSVINKKPVKKNREETDK
Ga0192826_1012271613300019051MarineMKKNGFDTKNPDFIWNKNRLVLEKEAIKRQMMNVINKKPA
Ga0193144_101370323300019126MarineMKKNGFDTKNPDFIWNKNRLVLEKEAIKRQMMNVINKKPAKKDKH
Ga0188870_1011815013300019149Freshwater LakeMKRHGFDTKDPDFIWNKNRLVLEKEAIKRQMQQVINKKPVKKTEKDATDM
Ga0194244_1009338813300019150MarineMKRHSYDTKNPDFIWNKNRLVLEKEAIKRQMMNVIKKKPAKKEDGKDGTAGGTTDAV
Ga0206124_1040538013300020175SeawaterGLFEGCMKKNGFDTKNPDFIWNKNRLVLEKEAIKRQMMSVINKKAAKKDKGETDK
Ga0194115_1016416113300020183Freshwater LakeMKRHGFDTRNPDFIWNKNRLILEKEAIKRQMLNVINKKPAKKTDKDEQS
Ga0211731_1079818443300020205FreshwaterMKRHGFDTRNPDFIWNKNRLVLEKEAIKRQMLNVIKKKPANKTD
Ga0210307_132833833300021336EstuarineMKKHEIDTKTPDFIWNKNRLVLEKEAIKRQMMNVINKKQGALKKE
Ga0206123_1010613133300021365SeawaterMKKNSIDPKVSDFIWNKNRLVLEKEAIKKQMMNVIKKKPAKKETD
Ga0222717_1032859523300021957Estuarine WaterMKRHGFDTKTADFVWNKNRLALEKEAIKRQMLNVINKKAPPKKEGETNM
Ga0222713_1022788113300021962Estuarine WaterMKRHGFNLKTPDFIWNKNRLVLEKEQIKQQMMKVIEKKPAKKKDETA
(restricted) Ga0233439_1032794513300024261SeawaterMKRNSIDTKVPDFIWNKNRLMLEKDAIKKQMMNVLKKKPGKTEGE
Ga0244777_1048461533300024343EstuarineMKRHSFNLKTPDFIWNKNRLVLEKEQIKQQMMKVIEKKPAKKKETNE
Ga0244775_1066196713300024346EstuarineMFEGCMKKNGIDPKVPDFIWNKNRLVLEKEAIKKQMMNVIKKKPAKKETD
Ga0209716_116195323300025626Pelagic MarineMKRNNIDTKTPDFVWNQNRLMLEKERIKKEMMGVIKKKTGKPTAQ
Ga0208275_102196813300026182MarineMKKNGFDPKTPDFIWNKNRLALEKEAIKKQMLNVINKKTVKKAPGGETTDG
Ga0208275_102314043300026182MarineMKRHGYDTKNPDFIWNKNRLALEKEAIKKQMLGVINKKPAKKQTVAGETTAGQ
Ga0208275_102320613300026182MarineMKRHGFDTKVPDFIWNKNRLVLEKEAIKKQMLNVINKKPAKKPTAGETTAG
Ga0208275_111593113300026182MarineMKRHSFDTKNPDFVWNKNRLAIEKEAIKRQMLNVIHKKNRKIEKADSSKA
Ga0209710_107731113300027687MarineMKRNGFDTKTPDFLWNKNRLALEKEAIKRQMMNVIKKKPAGAKDTTQA
Ga0209502_1029231813300027780MarineMKRNGIDTRTPDFIWNKNRLVLEKEAIKRQMMSVIKKPTATKKKE
Ga0209812_1030697323300027786Wastewater EffluentMKKNGWDPKVPDFIWNKNRLELEKQALKANLMKVINKPA
Ga0209302_1011094613300027810MarineMKKNSFNTETPDFIWNKNRLAMEKEAIKKQMLNVINKKPARKAVDTTAK
Ga0209302_1011098913300027810MarineMKKNGFDTKDPDFIWNKSRLAMEKEAIKKQMLSVINKKQARKPDAIAK
Ga0209302_1032807013300027810MarineMKRHGFDTKNPDFIWNKNRLAMEKEAIKRQMLNVINKKPPAAKAKDTEN
Ga0209712_1014756023300027849MarineMKKNNIDPKVSDFIWNKNRLVLEKEAIKKQMMNVIKKKPAKKETDQ
Ga0256411_127798913300028134SeawaterMKKNGFDTKNPDFIWNKNRLVLEKEAIKRQMLNVIQKKTNKKERGETDK
Ga0228613_114843623300028279SeawaterLKRHGYDKEPDFIWNKNRLAMEKEEMKRQMLKVINKKQVNK
Ga0304729_126401213300028392Freshwater LakeGCMKKNGWDPKVPDFIWNKNRLVLEKEALKQNLMKVISKPIKKLETEGGEAAGAADD
Ga0307388_1021380213300031522MarineMKSNGFDPNTPDFIWNKNRLAMEKEAIKRQMLNVINKKTVKKASNASNXEAEKQNDDLNV
Ga0307388_1022256413300031522MarineMKRHGFDTKTADFVWNKNRLALEKEAIKRQMLNVINKKAPPKKDGDTN
Ga0307492_1008507933300031523Sea-Ice BrineMKCNGIDTKVPDFVWNQNRLMLEKERIKKEMMGVIKKKPGEKRL
Ga0308144_103726223300031570MarineMKRNGIDTKTPDFIWNKNRLVLEKEAIKRQMMSVIKKPTATKKKD
Ga0307381_1008979333300031725MarineMKRNGIDTRTPDFIWNKNRLVLEKEAIKRQMMSVIKKPTATK
Ga0307391_1069976213300031729MarineMKRNGIDTRTPDFIWNKNRLVLEKEAIKRQMMSVIKKPTATKKKELFIETLNQITF
Ga0307397_1055379523300031734MarineMKRNGIDTKTSDFIWNKNRLALEKEAIKKQMMNVIKKKPVKKDA
Ga0307387_1020901823300031737MarineMKSNGFDPNTPDFIWNKNRLAMEKEAIKRQMLNVINKKTVKKASNASN
Ga0314671_1021286033300032616SeawaterMKRNGFDTKTPDFLWNKNRLALEKEAIKRQMMNVIKKKPAGGKDTTQA
Ga0314678_1021064423300032666SeawaterMKRHSFDTRTPDFIWNKNRLVLEKEAIKRQMMDVIKKKPHKKDDGADKDGTTGM
Ga0314703_1018764523300032723SeawaterMKRHSFDTRTPDFIWNKNRLVLEKEAIKRQMMDVIKKKPHKKEDGADKDGTTGM
Ga0314708_1030719613300032750SeawaterMKRHSFDTRTPDFIWNKNRLVLEKEAIKRQMMDVIKKKPQKKDDGGKDGTTGM
Ga0307390_1049959013300033572MarineMKRNGFDTKTPDFLWNKNRLALEKEAIKRQMMNVIKKKPANAANTNA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.