Metagenome Family F084065

Basic Information
Family ID	F084065
Family Type	Metagenome
Number of Sequences	112
Average Sequence Length	40 residues
Representative Sequence	MSSILIKNGTLVTMDPANTIVRGDLLIRDERIAEIGS
Number of Associated Samples	96
Number of Associated Scaffolds	112

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	20.00 %
% of genes near scaffold ends (potentially truncated)	98.21 %
% of genes from short scaffolds (< 2000 bps)	93.75 %
Associated GOLD sequencing projects	93
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.39

Most Common Taxonomy
Group	Bacteria (52.679 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.286 % of family members)
Environment Ontology (ENVO)	Unclassified (48.214 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (63.393 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 32.31% Coil/Unstructured: 67.69%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 112 Family Scaffolds
PF00154	RecA	57.14
PF09720	Unstab_antitox	4.46
PF01797	Y1_Tnp	2.68
PF14022	DUF4238	1.79
PF00290	Trp_syntA	1.79
PF00117	GATase	0.89
PF05016	ParE_toxin	0.89
PF01979	Amidohydro_1	0.89
PF07510	DUF1524	0.89

COG ID	Name	Functional Category	% Frequency in 112 Family Scaffolds
COG0468	RecA/RadA recombinase	Replication, recombination and repair [L]	57.14
COG1943	REP element-mobilizing transposase RayT	Mobilome: prophages, transposons [X]	2.68
COG0159	Tryptophan synthase alpha chain	Amino acid transport and metabolism [E]	1.79

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	54.46 %
Unclassified	root	N/A	45.54 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	54.46 %
Unclassified	root	N/A	45.54 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	52.68 %
Unclassified	root	N/A	45.54 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.54 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	16.07 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	1.79 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.79 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.54 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	13.39 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	1.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.79 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.89 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.54 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	9.82 %
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	3.57 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	1.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.79 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	0.89 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.54 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	9.82 %
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	3.57 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	1.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.79 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.89 %
Bacteroidia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.54 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	9.82 %
Pyrinomonas	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas	3.57 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	1.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.79 %
Bacteroidales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	0.89 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.54 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	9.82 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3.57 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	1.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.79 %
Rikenellaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae	0.89 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.54 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	9.82 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3.57 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	1.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.79 %
unclassified Rikenellaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → unclassified Rikenellaceae	0.89 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.54 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	9.82 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3.57 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	1.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.79 %
Rikenellaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → unclassified Rikenellaceae → Rikenellaceae bacterium	0.89 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.54 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	9.82 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3.57 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	1.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.79 %
Rikenellaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → unclassified Rikenellaceae → Rikenellaceae bacterium	0.89 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.54 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	9.82 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3.57 %
Rhabditina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina	1.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.79 %
Rikenellaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → unclassified Rikenellaceae → Rikenellaceae bacterium	0.89 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.54 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	9.82 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3.57 %
Rhabditomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha	1.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.79 %
Rikenellaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → unclassified Rikenellaceae → Rikenellaceae bacterium	0.89 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.54 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	9.82 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3.57 %
Rhabditoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea	1.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.79 %
Rikenellaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → unclassified Rikenellaceae → Rikenellaceae bacterium	0.89 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.54 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	9.82 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3.57 %
Rhabditidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae	1.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.79 %
Rikenellaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → unclassified Rikenellaceae → Rikenellaceae bacterium	0.89 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.54 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	9.82 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3.57 %
Rhabditidae incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis	1.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.79 %
Rikenellaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → unclassified Rikenellaceae → Rikenellaceae bacterium	0.89 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.54 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	9.82 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3.57 %
Diploscapter	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter	1.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.79 %
Rikenellaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → unclassified Rikenellaceae → Rikenellaceae bacterium	0.89 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.54 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	9.82 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3.57 %
Diploscapter pachys	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys	1.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.79 %
Rikenellaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → unclassified Rikenellaceae → Rikenellaceae bacterium	0.89 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.89 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090014\|GPIPI_16936729	Not Available	2281	Open in IMG/M
3300002244\|JGI24742J22300_10029849	All Organisms → cellular organisms → Bacteria	950	Open in IMG/M
3300004643\|Ga0062591_102253362	All Organisms → cellular organisms → Bacteria	568	Open in IMG/M
3300005289\|Ga0065704_10196096	All Organisms → cellular organisms → Bacteria	1167	Open in IMG/M
3300005332\|Ga0066388_103804800	All Organisms → cellular organisms → Bacteria	770	Open in IMG/M
3300005334\|Ga0068869_101884570	All Organisms → cellular organisms → Bacteria	536	Open in IMG/M
3300005338\|Ga0068868_100568778	All Organisms → cellular organisms → Bacteria	1001	Open in IMG/M
3300005440\|Ga0070705_100250751	All Organisms → cellular organisms → Bacteria	1242	Open in IMG/M
3300005444\|Ga0070694_101166794	Not Available	644	Open in IMG/M
3300005459\|Ga0068867_100408609	All Organisms → cellular organisms → Bacteria	1147	Open in IMG/M
3300005518\|Ga0070699_101853505	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300005530\|Ga0070679_101492401	All Organisms → cellular organisms → Bacteria	623	Open in IMG/M
3300005545\|Ga0070695_101108934	All Organisms → cellular organisms → Bacteria	648	Open in IMG/M
3300005549\|Ga0070704_101193235	All Organisms → cellular organisms → Bacteria	694	Open in IMG/M
3300005554\|Ga0066661_10720378	All Organisms → cellular organisms → Bacteria → Proteobacteria	585	Open in IMG/M
3300005555\|Ga0066692_10871895	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300005556\|Ga0066707_10605892	All Organisms → cellular organisms → Bacteria	699	Open in IMG/M
3300005564\|Ga0070664_100386272	All Organisms → cellular organisms → Bacteria	1279	Open in IMG/M
3300005568\|Ga0066703_10473394	All Organisms → cellular organisms → Bacteria	748	Open in IMG/M
3300005576\|Ga0066708_10107502	All Organisms → cellular organisms → Bacteria	1666	Open in IMG/M
3300005587\|Ga0066654_10772169	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300005615\|Ga0070702_100080501	All Organisms → cellular organisms → Bacteria	1949	Open in IMG/M
3300005615\|Ga0070702_101006739	All Organisms → cellular organisms → Bacteria	660	Open in IMG/M
3300005718\|Ga0068866_10387192	All Organisms → cellular organisms → Bacteria	898	Open in IMG/M
3300005719\|Ga0068861_101313101	All Organisms → cellular organisms → Bacteria	704	Open in IMG/M
3300005840\|Ga0068870_10321178	All Organisms → cellular organisms → Bacteria	984	Open in IMG/M
3300005842\|Ga0068858_100891551	All Organisms → cellular organisms → Bacteria	869	Open in IMG/M
3300005886\|Ga0075286_1028854	All Organisms → cellular organisms → Bacteria	726	Open in IMG/M
3300006046\|Ga0066652_100284633	All Organisms → cellular organisms → Bacteria	1462	Open in IMG/M
3300006755\|Ga0079222_11246721	All Organisms → cellular organisms → Bacteria	671	Open in IMG/M
3300006880\|Ga0075429_101064093	All Organisms → cellular organisms → Bacteria	707	Open in IMG/M
3300006918\|Ga0079216_11008886	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
3300006954\|Ga0079219_10023645	All Organisms → cellular organisms → Bacteria	2319	Open in IMG/M
3300009011\|Ga0105251_10165321	All Organisms → cellular organisms → Bacteria	997	Open in IMG/M
3300009089\|Ga0099828_11284934	Not Available	648	Open in IMG/M
3300009101\|Ga0105247_11380094	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	569	Open in IMG/M
3300009101\|Ga0105247_11794997	Not Available	510	Open in IMG/M
3300009137\|Ga0066709_102663593	All Organisms → cellular organisms → Bacteria	668	Open in IMG/M
3300009143\|Ga0099792_10321911	All Organisms → cellular organisms → Bacteria	924	Open in IMG/M
3300009148\|Ga0105243_10907013	Not Available	877	Open in IMG/M
3300009148\|Ga0105243_12322296	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	574	Open in IMG/M
3300009156\|Ga0111538_13511337	Not Available	544	Open in IMG/M
3300009162\|Ga0075423_10884314	Not Available	947	Open in IMG/M
3300009174\|Ga0105241_10177368	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1765	Open in IMG/M
3300009174\|Ga0105241_10643459	Not Available	962	Open in IMG/M
3300009174\|Ga0105241_12494360	Not Available	518	Open in IMG/M
3300009551\|Ga0105238_10505011	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys	1210	Open in IMG/M
3300009551\|Ga0105238_12616357	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	541	Open in IMG/M
3300009553\|Ga0105249_11973161	Not Available	656	Open in IMG/M
3300010038\|Ga0126315_10268328	Not Available	1045	Open in IMG/M
3300010166\|Ga0126306_11208514	Not Available	621	Open in IMG/M
3300010358\|Ga0126370_11698638	All Organisms → cellular organisms → Bacteria → Acidobacteria	608	Open in IMG/M
3300010359\|Ga0126376_13281535	Not Available	500	Open in IMG/M
3300010397\|Ga0134124_11908299	Not Available	630	Open in IMG/M
3300010397\|Ga0134124_12137687	Not Available	599	Open in IMG/M
3300010399\|Ga0134127_10536549	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys	1188	Open in IMG/M
3300011269\|Ga0137392_10980687	All Organisms → cellular organisms → Bacteria	695	Open in IMG/M
3300012205\|Ga0137362_10858159	All Organisms → cellular organisms → Bacteria	776	Open in IMG/M
3300012206\|Ga0137380_11502733	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	558	Open in IMG/M
3300012208\|Ga0137376_11547525	Not Available	554	Open in IMG/M
3300012209\|Ga0137379_11399728	All Organisms → cellular organisms → Bacteria → PVC group	603	Open in IMG/M
3300012354\|Ga0137366_10023711	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	4774	Open in IMG/M
3300012354\|Ga0137366_10795312	Not Available	671	Open in IMG/M
3300012357\|Ga0137384_10820843	Not Available	751	Open in IMG/M
3300012362\|Ga0137361_10676215	Not Available	944	Open in IMG/M
3300012362\|Ga0137361_11700526	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	550	Open in IMG/M
3300012530\|Ga0136635_10059615	All Organisms → cellular organisms → Bacteria	1164	Open in IMG/M
3300012685\|Ga0137397_11363174	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	500	Open in IMG/M
3300012923\|Ga0137359_10670858	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → unclassified Rikenellaceae → Rikenellaceae bacterium	905	Open in IMG/M
3300012948\|Ga0126375_11810298	Not Available	533	Open in IMG/M
3300012971\|Ga0126369_12813771	All Organisms → cellular organisms → Bacteria → Acidobacteria	569	Open in IMG/M
3300013102\|Ga0157371_11532702	Not Available	520	Open in IMG/M
3300013306\|Ga0163162_11022996	All Organisms → cellular organisms → Bacteria → Acidobacteria	934	Open in IMG/M
3300013760\|Ga0120188_1040649	Not Available	569	Open in IMG/M
3300014166\|Ga0134079_10271914	Not Available	741	Open in IMG/M
3300014326\|Ga0157380_10918153	Not Available	903	Open in IMG/M
3300014968\|Ga0157379_12539277	Not Available	513	Open in IMG/M
3300015262\|Ga0182007_10294411	Not Available	594	Open in IMG/M
3300015371\|Ga0132258_10402692	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3400	Open in IMG/M
3300015373\|Ga0132257_102777444	Not Available	638	Open in IMG/M
3300018429\|Ga0190272_11370822	Not Available	709	Open in IMG/M
3300018429\|Ga0190272_13050271	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	520	Open in IMG/M
3300018466\|Ga0190268_11557892	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	579	Open in IMG/M
3300020215\|Ga0196963_10035016	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	2114	Open in IMG/M
3300021968\|Ga0193698_1033762	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	674	Open in IMG/M
3300025906\|Ga0207699_10693526	Not Available	745	Open in IMG/M
3300025918\|Ga0207662_10719353	Not Available	700	Open in IMG/M
3300025921\|Ga0207652_11275408	Not Available	637	Open in IMG/M
3300025927\|Ga0207687_11045278	Not Available	701	Open in IMG/M
3300025927\|Ga0207687_11079081	Not Available	689	Open in IMG/M
3300025933\|Ga0207706_11307509	Not Available	599	Open in IMG/M
3300025945\|Ga0207679_11127070	Not Available	720	Open in IMG/M
3300025949\|Ga0207667_11658108	Not Available	607	Open in IMG/M
3300025949\|Ga0207667_11942157	Not Available	550	Open in IMG/M
3300025960\|Ga0207651_11282178	Not Available	658	Open in IMG/M
3300025981\|Ga0207640_11437162	Not Available	618	Open in IMG/M
3300026075\|Ga0207708_11329974	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	630	Open in IMG/M
3300026285\|Ga0209438_1120720	Not Available	735	Open in IMG/M
3300026497\|Ga0257164_1022397	Not Available	906	Open in IMG/M
3300026536\|Ga0209058_1083508	Not Available	1667	Open in IMG/M
3300027875\|Ga0209283_10286523	Not Available	1089	Open in IMG/M
3300027915\|Ga0209069_10780283	All Organisms → cellular organisms → Bacteria → Proteobacteria	569	Open in IMG/M
3300028380\|Ga0268265_11049519	Not Available	807	Open in IMG/M
3300031548\|Ga0307408_100911093	Not Available	805	Open in IMG/M
3300031548\|Ga0307408_101086321	Not Available	741	Open in IMG/M
3300031720\|Ga0307469_11281988	Not Available	695	Open in IMG/M
3300031740\|Ga0307468_100113387	Not Available	1648	Open in IMG/M
3300031740\|Ga0307468_102373580	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	517	Open in IMG/M
3300032211\|Ga0310896_10822680	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	533	Open in IMG/M
3300034820\|Ga0373959_0170554	Not Available	560	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	61.61%
Host-Associated	Host-Associated	38.39%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	59.82%
Plants	Host-Associated → Plants	38.39%
Aquatic	Environmental → Aquatic	1.79%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	59.82%
Rhizosphere	Host-Associated → Plants → Rhizosphere	24.11%
Rhizoplane	Host-Associated → Plants → Rhizoplane	14.29%
Freshwater	Environmental → Aquatic → Freshwater	0.89%
Sediment	Environmental → Aquatic → Sediment	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	46.43%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	19.64%
Loam	Environmental → Terrestrial → Soil → Loam	11.61%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	11.61%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.46%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.68%
Ice	Environmental → Aquatic → Freshwater → Ice	0.89%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.89%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.89%
Sand	Environmental → Terrestrial → Soil → Sand	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	27.68%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	19.64%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	11.61%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	10.71%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	10.71%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.46%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.57%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.57%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.68%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.89%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.89%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.89%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.89%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.89%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.89%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	14.29%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	8.04%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	8.04%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	4.46%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	4.46%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.57%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.57%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.57%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.57%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.68%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.68%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.68%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.68%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.68%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.68%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.68%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.68%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.79%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.79%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.79%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.79%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.79%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.89%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.89%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.89%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.89%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.89%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.89%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.89%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.89%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.89%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.89%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090014	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Host-Associated	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005886	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Host-Associated	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012530	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013760	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2	Environmental	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300020215	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5	Environmental	Open in IMG/M
3300021968	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1	Environmental	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026285	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)	Environmental	Open in IMG/M
3300026497	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B	Environmental	Open in IMG/M
3300026536	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300032211	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1	Environmental	Open in IMG/M
3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.39
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.39
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F084065

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPIPI_02939370	2088090014	Soil	MTQSILIKNGTIVTMDDSNSMGRGDVLIRDGRIADFSETI
JGI24742J22300_100298492	3300002244	Corn, Switchgrass And Miscanthus Rhizosphere	MTNSILIKNGTIVTMDAKDSIVRGDLLIRDGRITSVGEQDT
Ga0062591_1022533621	3300004643	Soil	MKSILIKGGTLLTMDRVNTIVRGDLLIDGNRITTIGETGQVADVVV
Ga0065704_101960962	3300005289	Switchgrass Rhizosphere	MSSILIRNGTLVTMDSSNTIVRGDLLIRDQRIVEIGGTGQAADT
Ga0066388_1038048002	3300005332	Tropical Forest Soil	MIKSILIKGGTIVAMDEKNSIVRGDVLIRDGRIAEVGEKVVGQADE
Ga0068869_1018845701	3300005334	Miscanthus Rhizosphere	MSSILIKNGTLVTMDSANNIVRGDLLVSDGRIADIGGSGQTADT
Ga0068868_1005687782	3300005338	Miscanthus Rhizosphere	MSILIKNGTLVTMDSANTIKRADLLIEGERIAAISSGDQTAD
Ga0070705_1002507511	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MTNSILFKNGTIVTMDADNSIVRGDLLIRDGRIASIGENDAS
Ga0070694_1011667941	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	MSSSILFKNGTIVTMDADNSIVRGDLLIRDRRIAALGEQNESGTDEVID
Ga0068867_1004086091	3300005459	Miscanthus Rhizosphere	MKSILIKGGTLLTMDEQNSVLNGDLFISDGRLESIGSTVAAADVVID
Ga0070699_1018535051	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MSSILIKNGTLVTMDNANTIVRGDLLINGEHIAAIGGSGQ
Ga0070679_1014924012	3300005530	Corn Rhizosphere	MASILIKNGTLVTMDPANTIVRADLLIRDERIAEIGSAGVTV
Ga0070695_1011089341	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	MTESILIKNGTIVTMDAKDSIVRGDLLIRDGRITSVGEQD
Ga0070704_1011932352	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MSSILIKNGTLVTMDSANNIVRGDLLVSDGRIADIGGSGQTAD
Ga0066661_107203781	3300005554	Soil	MSKSLLIKDGTIVTMDISDSIRRGDLLIRDGRITEIAEGIKA
Ga0066692_108718952	3300005555	Soil	MSKSILIKNGTIVTMDAKNSLVRGDLLIRDGRIAEVSK
Ga0066707_106058923	3300005556	Soil	MSESILIKNGTIVTMDDNNSIVRGDLLIRDGRIAGIGE
Ga0070664_1003862721	3300005564	Corn Rhizosphere	MSSILIKNGTLVTMDKANTIVPGDLLINGAHIAAIGET
Ga0066703_104733941	3300005568	Soil	MTKAILVKDGTIVTMDESNSIARGDVLIRDGRIAEI
Ga0066708_101075023	3300005576	Soil	MSKSLLIKDGTIVTMDTSDSIVRGDLLIRDGRITEIAEGIKA
Ga0066654_107721691	3300005587	Soil	MNSILIKGGTLLTMDEQDAIVRGDLLIQDGVISGVGTSHQTAD
Ga0070702_1000805013	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	MSSVLIKNGTLVTMDGGDSIVRGDLLVRDQRIVEIGGIGQTADTVIDAA
Ga0070702_1010067391	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	MNSILIKNGTLLTMDANNSIVRGDLLIRDGRIESMGAATA
Ga0068866_103871922	3300005718	Miscanthus Rhizosphere	MSSSILFKNGTIVTMDADNSIVRGDLLIRDRRIAALGEQNES
Ga0068861_1013131012	3300005719	Switchgrass Rhizosphere	MSSILIKNGTLVTMDSANNIVRGDLLVSDGRIADIGGSGQTANTVI
Ga0068870_103211782	3300005840	Miscanthus Rhizosphere	MSSILIKNGTLVTMDSANAIVRGDVLINGERIAAVGGSHTADTVIDAE
Ga0068858_1008915514	3300005842	Switchgrass Rhizosphere	MTKSILIKGGTIVTMDENDSIVRGDVLIREGCIAEIG
Ga0075286_10288542	3300005886	Rice Paddy Soil	MSSILIKNGTLVTIDPANTIVRGDLLINGERIVAIG
Ga0066652_1002846333	3300006046	Soil	MANSILIKNGTIVTMGESASIGRGDVWIRDGRIAEVGESISSSADETI
Ga0079222_112467211	3300006755	Agricultural Soil	MSSILIKNGTLVTMDSANTIVRDDLLINGERIVTIGGSQTAETVIDAEGC
Ga0075429_1010640932	3300006880	Populus Rhizosphere	MTQSILIKNGTIVTMDQNNSIVRGDVLIRDGRVAEVAT
Ga0079216_110088861	3300006918	Agricultural Soil	MSSILIKNGTVVTMDTRDSIVRGDVLVNDGRITDIGGAGHAA
Ga0079219_100236451	3300006954	Agricultural Soil	MTQSILIKNGTIVTIDGENSIVRSDLLIRDGRILSIGGPN
Ga0105251_101653211	3300009011	Switchgrass Rhizosphere	MSSVLIKNGTLVTMDNRNSIVRGDLLIRDERIAEI
Ga0099828_112849342	3300009089	Vadose Zone Soil	MSESILIKGGRIVTMDDNNSIVRVDLLIRDGRIAGLGGD
Ga0105247_113800942	3300009101	Switchgrass Rhizosphere	MKSILIKGGTLLTMDDGNAIVAGDLLIRDGLIASVGES
Ga0105247_117949972	3300009101	Switchgrass Rhizosphere	MSSILIKNGTLVTMDPANTVVRGDVLINGERIAAIGGDQ
Ga0066709_1015890462	3300009137	Grasslands Soil	MNQSILIKGGTIVTMDQNNSIVSGDLFIREGRIAETGKGIGSDADETI
Ga0066709_1026635931	3300009137	Grasslands Soil	MSETILIKGGTIVTMDEKNSIVRGDVLIRNGRIEDVGDH
Ga0099792_103219114	3300009143	Vadose Zone Soil	MTQSILIKNGTIVTMDEKNSIVRADVLIREGRVAEVGNHIDANA
Ga0105243_109070132	3300009148	Miscanthus Rhizosphere	MSSILIKNGTLVTMDARDSMVQGDILLVDGRIAEIGGTG
Ga0105243_123222961	3300009148	Miscanthus Rhizosphere	MKSILIKGGTLLTMDEGNAIVSGDLLIRDGRIASIGES
Ga0111538_135113371	3300009156	Populus Rhizosphere	MTESILIKSGTLLTMDKNDSIVRGDLLIRDCKIASLGGTGATADVVI
Ga0075423_108843141	3300009162	Populus Rhizosphere	MSASILIKNGTIVTMDAENSIVRGDLLIRDGRIAAG
Ga0105241_101773681	3300009174	Corn Rhizosphere	MASILIKDGTLVTMDAANRIVRGDILVVDGRIASIDSAR
Ga0105241_106434592	3300009174	Corn Rhizosphere	MSSILIKQGTLVTMDAADSVVRRDLLVENDRITSIGATGQVADIV
Ga0105241_124943601	3300009174	Corn Rhizosphere	MSSILIKNGTLVTMDKANTIVSGDLLINGAHIATIGETS
Ga0105238_105050112	3300009551	Corn Rhizosphere	MSSIFIKNGTLVTMDSANTVVRDDLLINGERIAAIDGGGQTADTVID
Ga0105238_126163572	3300009551	Corn Rhizosphere	MKSILIKNGTLLPMDEGNAIVSGDLLIRDGRIASIGESGQT
Ga0105249_119731611	3300009553	Switchgrass Rhizosphere	MKSILIKGGTLLTMDDGNAIVAGDLLIRDGLIASVGESGQTADV
Ga0126315_102683282	3300010038	Serpentine Soil	MSSILIKNGTLVTMDSANTIVRGDILVSGGRITDIGGAGQ
Ga0126306_112085141	3300010166	Serpentine Soil	MSSILIQNGTLVTMDSANTIVRGDLLVSDGRIVDIGGT
Ga0126370_116986382	3300010358	Tropical Forest Soil	MTRSILIRNGTIVTMDQQGTIVTGDVLIRDGRIAEIGAEINE
Ga0126376_132815352	3300010359	Tropical Forest Soil	MSSIVIKHGTLVTMDQKDSIVRGDLLIVDGRITSLATS
Ga0134124_119082992	3300010397	Terrestrial Soil	MSSVLIKNGTVVTMDTANTIVRGDLLIRDQRIAEIGGTGQTADTVIDAGSCAV
Ga0134124_121376871	3300010397	Terrestrial Soil	MKSILIKGGTLLTMDEHNAVVAGDLLIRDGRIASIGEPGRAADLV
Ga0134127_105365491	3300010399	Terrestrial Soil	MSSILIKNGTLVTMDARDSMVQGDILVADGRIAEIGGTGHTADTI
Ga0137392_109806871	3300011269	Vadose Zone Soil	MSESILIKGGRVVTMDEDDSIVSGDVLIRDGRIASIAEAIDDTV
Ga0137362_108581592	3300012205	Vadose Zone Soil	MTKAILVKDGTIVTMDESNSIARGDMLIRDGRIAEIAAEIDDTVNEVI
Ga0137380_115027331	3300012206	Vadose Zone Soil	MSESILIKNGTVVTMDGNDSVVRGDLLINDGRIVEIGEGIKADAD
Ga0137376_115475251	3300012208	Vadose Zone Soil	MSETILIKGGTVVTMDDRNSIVRGDVLIRNGRIEDVDDKVNLDVD
Ga0137379_112255741	3300012209	Vadose Zone Soil	MSQSILIKGGTIVTMDQNNTIVSGDLFIRERRIAEIGNG
Ga0137379_113997282	3300012209	Vadose Zone Soil	MAKSILMKHGTIVTMDQDGSVIRGDLLIRDGRIASIGEDLKETTDEI
Ga0137366_100237115	3300012354	Vadose Zone Soil	MSESILIKGGIIVTMDQQGSIVRGDVLIRDGCIAEIGEEI
Ga0137366_107953122	3300012354	Vadose Zone Soil	MKNSILIKNGALITMDRNRRIVTGDLLVADGRIESIGESIR
Ga0137384_108208432	3300012357	Vadose Zone Soil	MNESILIRNGTIVTMDTKGSIAQGDLLIRGGRIAG
Ga0137361_106762153	3300012362	Vadose Zone Soil	MSKTVLITNGTVVTMDKSDSIVRGDLLIRDGRIAGLGG
Ga0137361_117005261	3300012362	Vadose Zone Soil	MKASIVVKGGTLITMNAENSIVRGDLLIEDGRIVSL
Ga0136635_100596153	3300012530	Polar Desert Sand	MNESILIKGGTVVTMDDHDSIVNGDLFISGGQIQAIDGG
Ga0137397_113631742	3300012685	Vadose Zone Soil	MEQSILIKGGALVTMDSLDSIVTGDLLIRDGRIASIGE
Ga0137359_106708581	3300012923	Vadose Zone Soil	MSKSILIKGGTVVTMDERNSIVRGDLLIRDGHIAGV
Ga0126375_118102982	3300012948	Tropical Forest Soil	MQMTESILIKNGTIVTMDEENSIVRGDVLIRDGRIADIAAEIHEAD
Ga0126369_128137711	3300012971	Tropical Forest Soil	MTRSILIRNGTIVMMDPQETVVSGDIFIRDGRIAAVGPKI
Ga0157371_115327021	3300013102	Corn Rhizosphere	MSSILIENGTVVTMDERDSIVRGDLLVTDGRIASIG
Ga0163162_110229962	3300013306	Switchgrass Rhizosphere	MDSILIKNTAIVTMDENNSIVRGDVLIRDGRIAELGDS
Ga0120188_10406492	3300013760	Terrestrial	MSSILIKNGTVVTMDARDSIVRGDVLVNDGRIVEIGGAG
Ga0134079_102719141	3300014166	Grasslands Soil	MNSILIKGGTLLTMDEQDGIVRGDLLIQDGVISGV
Ga0157380_109181531	3300014326	Switchgrass Rhizosphere	MSSVLIKNGTVVTMDNRNSIVRSDVLIRDQRIAEI
Ga0157379_125392772	3300014968	Switchgrass Rhizosphere	MSSILIKNATLVMMDSANTIVRGDLLINGERIAAI
Ga0182007_102944111	3300015262	Rhizosphere	MSSILIKNGTLVTMDPAHRIIRGDLLISASRITEL
Ga0132258_104026925	3300015371	Arabidopsis Rhizosphere	MSSILIKQGTIVTMDEGDSIVRGDLLIEGDRIASIGSNGQTG
Ga0132257_1027774441	3300015373	Arabidopsis Rhizosphere	MSESILIKNGTIVTMNAENGIVRGDLLIRNGRIASVGNET
Ga0190272_113708222	3300018429	Soil	MSESILIKNGTIVTMDSENSIVRGDLLIRDGRIATVGE
Ga0190272_130502711	3300018429	Soil	MKSILIKGGTVITVDTRNSIVRGDLLIRDGRIVAIGDTDETADE
Ga0190268_115578921	3300018466	Soil	MMSILIKGGTLVTMDEQDSILRGDLLIRDGRIARV
Ga0196963_100350161	3300020215	Soil	MKKSILIKDGTLVTMDRKDSIVVGDLLIRDGRIASLGQASNSADLL
Ga0193698_10337621	3300021968	Soil	MSESILIKGGTIVTMDERSSIVRGDLLIRDGRIVEIA
Ga0207699_106935261	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MSSILIKNGTLVTVDPSNRIVPGDLLIAHGRIVALGD
Ga0207662_107193532	3300025918	Switchgrass Rhizosphere	MSTILIKNGTLVTMDSANTIVRGDLLIEEGRITSINETGKTADTV
Ga0207652_112754082	3300025921	Corn Rhizosphere	MASILIKNGTLVTMDPANTIVRADLLIRDERIAEIGSAGVT
Ga0207687_110452782	3300025927	Miscanthus Rhizosphere	MSSILIKNGTLVTMDTANTIVRGDLLINGAHIAAIGDSQTAD
Ga0207687_110790811	3300025927	Miscanthus Rhizosphere	MSSILIKNGTLVTMDSANTIVRDDLLINGERIVTIGGSQ
Ga0207706_113075092	3300025933	Corn Rhizosphere	MKSILIKGGTLLTMDEQDSVLNGDLLISDGRIESIGSTVAAADVV
Ga0207679_111270701	3300025945	Corn Rhizosphere	MSSILIKNGTLVTMDPANPIVRGDLLIRDERIAEIGGTG
Ga0207667_116581081	3300025949	Corn Rhizosphere	MSSILIKNGTLVTMDQSNTIVRGDLLVRDERIAEIGS
Ga0207667_119421571	3300025949	Corn Rhizosphere	MSSILIKNGTLVTMDSANTIVRDDLLINGERIVTIG
Ga0207651_112821781	3300025960	Switchgrass Rhizosphere	MSSILIKNGTLVTMDSANTIVRGDLLINGEHIAVVGGS
Ga0207640_114371622	3300025981	Corn Rhizosphere	MSSILIKNGTLVTMDQANTIVRGDLLIRDERITELGST
Ga0207708_113299743	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MTQSILIKSGTIVTMDQNNSIVRGDVLIRDGRVAEVATEVNDPGSDII
Ga0209438_11207201	3300026285	Grasslands Soil	MKSILIKGGTLLTMDDGNAIVSGNLLIRDGRIASVGESGQ
Ga0257164_10223972	3300026497	Soil	MKSILIKGGTLLTMDGQDAIVRGDLLIRDGRITSLGEPGQAA
Ga0209058_10835083	3300026536	Soil	MSQSILIKGGTIVTMDANDSVVRGDLLIRDGRIAE
Ga0209283_102865232	3300027875	Vadose Zone Soil	MGESILIKGGTVVTMDENDSIVRGDLLIRDGRIAEI
Ga0209069_107802831	3300027915	Watersheds	MSESILIKGGTVVTMDENDSIVRGDLLIRDGRIANVGGENAKSADEV
Ga0268265_110495192	3300028380	Switchgrass Rhizosphere	MSSILIKNGTLVTMDSANNIVRGDLLVSDGRIADIGGS
Ga0307408_1009110931	3300031548	Rhizosphere	MSSILIKNGTLVMMDQQNTIVRGDVLITDGRIAEIAGSGQTA
Ga0307408_1010863212	3300031548	Rhizosphere	MSSVLIKNGTLVTMDSANTIVRGDLLVSDGRITGIGS
Ga0307469_112819881	3300031720	Hardwood Forest Soil	MTQSILIKNGTIVTMDADDSIVRGDLLIRDRRIAEAG
Ga0307468_1001133871	3300031740	Hardwood Forest Soil	MKSILIKGGTILTMDERDAIARGDLLIRDGVIASIGETGQTADIVI
Ga0307468_1023735801	3300031740	Hardwood Forest Soil	MSESILIKGGTVVTMDEKNSIVRGDVLIRDGRIAE
Ga0310896_108226801	3300032211	Soil	MKSILIKGGTLLTMDRANPIVRGDLLINGNRITTIGQTG
Ga0373959_0170554_450_560	3300034820	Rhizosphere Soil	MSSILIKNGTLVTMDPANTIVRGDLLIRDERIAEIGS

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign