NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F084385

Metagenome Family F084385

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084385
Family Type Metagenome
Number of Sequences 112
Average Sequence Length 55 residues
Representative Sequence MNQPKPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Number of Associated Samples 94
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.19 %
% of genes near scaffold ends (potentially truncated) 33.04 %
% of genes from short scaffolds (< 2000 bps) 82.14 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.500 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.429 % of family members)
Environment Ontology (ENVO) Unclassified
(41.964 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(55.357 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 3.57%    β-sheet: 0.00%    Coil/Unstructured: 96.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF02627CMD 44.64
PF03928HbpS-like 2.68
PF10067DUF2306 1.79
PF00691OmpA 1.79
PF03743TrbI 0.89
PF08386Abhydrolase_4 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 44.64
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 44.64
COG2948Type IV secretory pathway, VirB10 componentIntracellular trafficking, secretion, and vesicular transport [U] 0.89

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.50 %
UnclassifiedrootN/A12.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000363|ICChiseqgaiiFebDRAFT_10697091All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300000956|JGI10216J12902_107543759All Organisms → cellular organisms → Bacteria1482Open in IMG/M
3300000956|JGI10216J12902_108340498All Organisms → cellular organisms → Bacteria3116Open in IMG/M
3300004156|Ga0062589_100768645All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium867Open in IMG/M
3300004157|Ga0062590_103012693All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium505Open in IMG/M
3300004479|Ga0062595_100913817All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300005289|Ga0065704_10469746All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium690Open in IMG/M
3300005290|Ga0065712_10214198All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1062Open in IMG/M
3300005294|Ga0065705_10325368All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1002Open in IMG/M
3300005328|Ga0070676_10294652All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1098Open in IMG/M
3300005328|Ga0070676_10713764All Organisms → cellular organisms → Bacteria → Proteobacteria733Open in IMG/M
3300005330|Ga0070690_101032979All Organisms → cellular organisms → Bacteria → Proteobacteria649Open in IMG/M
3300005331|Ga0070670_100177983All Organisms → cellular organisms → Bacteria1846Open in IMG/M
3300005334|Ga0068869_100032433All Organisms → cellular organisms → Bacteria3681Open in IMG/M
3300005347|Ga0070668_100288824All Organisms → cellular organisms → Bacteria1372Open in IMG/M
3300005353|Ga0070669_100038115All Organisms → cellular organisms → Bacteria3489Open in IMG/M
3300005353|Ga0070669_101159717Not Available667Open in IMG/M
3300005366|Ga0070659_101695367All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium565Open in IMG/M
3300005367|Ga0070667_101915775Not Available558Open in IMG/M
3300005544|Ga0070686_100451967All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium988Open in IMG/M
3300005564|Ga0070664_102035927All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium545Open in IMG/M
3300005617|Ga0068859_102152417All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium616Open in IMG/M
3300005718|Ga0068866_10442577All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium848Open in IMG/M
3300005840|Ga0068870_10676677All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300006358|Ga0068871_101210544All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium709Open in IMG/M
3300006845|Ga0075421_100392182All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1669Open in IMG/M
3300006846|Ga0075430_100146063All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1970Open in IMG/M
3300006881|Ga0068865_100145005All Organisms → cellular organisms → Bacteria1795Open in IMG/M
3300007004|Ga0079218_12096348All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium651Open in IMG/M
3300009094|Ga0111539_11314346All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium839Open in IMG/M
3300009100|Ga0075418_10297452All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1720Open in IMG/M
3300009176|Ga0105242_13124352All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium513Open in IMG/M
3300009678|Ga0105252_10166658All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium927Open in IMG/M
3300010399|Ga0134127_12984588All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium552Open in IMG/M
3300010400|Ga0134122_11448210Not Available703Open in IMG/M
3300011432|Ga0137428_1069809All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium958Open in IMG/M
3300012883|Ga0157281_1040972All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium677Open in IMG/M
3300012906|Ga0157295_10017989All Organisms → cellular organisms → Bacteria1372Open in IMG/M
3300012908|Ga0157286_10301383All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium586Open in IMG/M
3300012916|Ga0157310_10034829All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300012943|Ga0164241_10377434All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1016Open in IMG/M
3300013096|Ga0157307_1021798All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300013306|Ga0163162_12171945All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium637Open in IMG/M
3300014325|Ga0163163_10626703All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300015077|Ga0173483_10665163Not Available582Open in IMG/M
3300015201|Ga0173478_10079017All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1159Open in IMG/M
3300015373|Ga0132257_101775387All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium792Open in IMG/M
3300017792|Ga0163161_10067748All Organisms → cellular organisms → Bacteria2607Open in IMG/M
3300018073|Ga0184624_10085580All Organisms → cellular organisms → Bacteria1332Open in IMG/M
3300018081|Ga0184625_10167176All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1150Open in IMG/M
3300018083|Ga0184628_10211626All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300018469|Ga0190270_10184507All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1742Open in IMG/M
3300018476|Ga0190274_10055777All Organisms → cellular organisms → Bacteria2890Open in IMG/M
3300018476|Ga0190274_10258669All Organisms → cellular organisms → Bacteria1585Open in IMG/M
3300018476|Ga0190274_10923113All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium942Open in IMG/M
3300018476|Ga0190274_12570490All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium606Open in IMG/M
3300018481|Ga0190271_10066658All Organisms → cellular organisms → Bacteria3156Open in IMG/M
3300019356|Ga0173481_10173047All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium912Open in IMG/M
3300019362|Ga0173479_10190744All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300021082|Ga0210380_10084859All Organisms → cellular organisms → Bacteria1392Open in IMG/M
3300021082|Ga0210380_10144243All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1067Open in IMG/M
3300025315|Ga0207697_10129447All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300025893|Ga0207682_10015373All Organisms → cellular organisms → Bacteria2979Open in IMG/M
3300025893|Ga0207682_10038712All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1936Open in IMG/M
3300025893|Ga0207682_10101309All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300025901|Ga0207688_10061927All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium2109Open in IMG/M
3300025901|Ga0207688_10446874Not Available805Open in IMG/M
3300025903|Ga0207680_10111506All Organisms → cellular organisms → Bacteria1775Open in IMG/M
3300025907|Ga0207645_10297334All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1074Open in IMG/M
3300025908|Ga0207643_10065151All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium2087Open in IMG/M
3300025923|Ga0207681_10660099All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium867Open in IMG/M
3300025925|Ga0207650_10155010All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1811Open in IMG/M
3300025926|Ga0207659_10456101All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1077Open in IMG/M
3300025926|Ga0207659_10592826All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium944Open in IMG/M
3300025930|Ga0207701_10863161All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium760Open in IMG/M
3300025933|Ga0207706_10194757All Organisms → cellular organisms → Bacteria1778Open in IMG/M
3300025937|Ga0207669_11288724Not Available620Open in IMG/M
3300025938|Ga0207704_11339060All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300025972|Ga0207668_10085839All Organisms → cellular organisms → Bacteria2298Open in IMG/M
3300026118|Ga0207675_100458226All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1264Open in IMG/M
3300026121|Ga0207683_10026537All Organisms → cellular organisms → Bacteria4999Open in IMG/M
3300028380|Ga0268265_11785781All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium621Open in IMG/M
3300028597|Ga0247820_10894003All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium629Open in IMG/M
3300028812|Ga0247825_10168218All Organisms → cellular organisms → Bacteria1508Open in IMG/M
3300028889|Ga0247827_11329406All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium504Open in IMG/M
3300031226|Ga0307497_10041141All Organisms → cellular organisms → Bacteria1571Open in IMG/M
3300031547|Ga0310887_10640828All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium655Open in IMG/M
3300031562|Ga0310886_10206948All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300031716|Ga0310813_10126493All Organisms → cellular organisms → Bacteria2025Open in IMG/M
3300031847|Ga0310907_10528685All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300031854|Ga0310904_10810803All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium656Open in IMG/M
3300031858|Ga0310892_10110920All Organisms → cellular organisms → Bacteria1522Open in IMG/M
3300031858|Ga0310892_10283772All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1037Open in IMG/M
3300031908|Ga0310900_10489813All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium953Open in IMG/M
3300031913|Ga0310891_10191386All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300031943|Ga0310885_10345291All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium780Open in IMG/M
3300032012|Ga0310902_10130185All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300032013|Ga0310906_11030477Not Available593Open in IMG/M
3300032144|Ga0315910_10025510All Organisms → cellular organisms → Bacteria4357Open in IMG/M
3300032144|Ga0315910_10137744All Organisms → cellular organisms → Bacteria1812Open in IMG/M
3300032144|Ga0315910_10694841All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium790Open in IMG/M
3300032157|Ga0315912_10103237All Organisms → cellular organisms → Bacteria → Proteobacteria2234Open in IMG/M
3300032157|Ga0315912_10356659All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1155Open in IMG/M
3300032157|Ga0315912_10802687Not Available749Open in IMG/M
3300032179|Ga0310889_10360840All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium714Open in IMG/M
3300034151|Ga0364935_0264799All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium562Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil13.39%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere8.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere8.04%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere6.25%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.57%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.68%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.68%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.79%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.79%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.79%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.79%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.79%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.79%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1069709123300000363SoilMDCSPPSWESTMDQRAPKQPPRDKTDPFRKPPIRPEEKEDQADSGPDRDNPITQESTHSTPKHKAH*
JGI10216J12902_10754375923300000956SoilMDPRTPSPAPPKDTANPFRKPVIRPDEKEDQADSGPDRDNPITQHSKDTGSKRKTR*
JGI10216J12902_10834049843300000956SoilMNPRTSKQAPPKDNTNPFRKPVIRPDEKEDQGDSGPDRDNPVTQESKQP
Ga0062589_10076864523300004156SoilMNQPKPQQVPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0062590_10301269313300004157SoilMNHHKPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0062595_10091381723300004479SoilPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0065704_1046974623300005289Switchgrass RhizosphereMNQPKPQQVPPKDNTNPFRKPVVRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0065712_1021419823300005290Miscanthus RhizosphereMNQPKPQQGPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0065705_1032536823300005294Switchgrass RhizosphereMNQPKPQQVPPKDNTNPFRKPVVRPDEKEDQADSGPDRDNPITRETKQPPSKQPAR*
Ga0070676_1029465223300005328Miscanthus RhizosphereMNQPKPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0070676_1071376423300005328Miscanthus RhizosphereMNPRTSKQPPPQDNTNPFRKPVIRPDEKEDQGDSGPDSDNPVTQESKQPAPRPNRR*
Ga0070690_10103297923300005330Switchgrass RhizosphereMNKHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITRESKQPAAKQPTR*
Ga0070670_10017798323300005331Switchgrass RhizosphereMNPRTSKQPPPQDNTNPFRKPVIRPDEKEDQGDSGPDSDNPVTQESKQPAPRPTRR*
Ga0068869_10003243323300005334Miscanthus RhizosphereMNPRTSKQPPPQDNTNPFRKPVIRPDEKEDQGDSGPDSDNPVTQESKEPAPRPTRR*
Ga0070668_10028882413300005347Switchgrass RhizosphereATMNKHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0070669_10003811523300005353Switchgrass RhizosphereMNKHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITRESEQPAAKQPTR*
Ga0070669_10115971713300005353Switchgrass RhizosphereMNQDKAQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0070659_10169536723300005366Corn RhizosphereMNKHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0070667_10191577523300005367Switchgrass RhizosphereGRATMNKHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0070681_1153848023300005458Corn RhizosphereMNPRTSKQPPPQDNTNPFRKPVIRPDEKEDQGDSGPDSDNPV
Ga0070686_10045196723300005544Switchgrass RhizosphereMNQPKPQQGPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITRESKQPAAKQPTR*
Ga0070664_10203592723300005564Corn RhizosphereMNKHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITRESK
Ga0068859_10215241723300005617Switchgrass RhizosphereMNKHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITRESEQPAKKQPTR*
Ga0068866_1044257723300005718Miscanthus RhizosphereMNQHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITRESKQPAAKQP
Ga0068870_1028030623300005840Miscanthus RhizosphereMNQPKPQQVPPKDNTNPFRKPVVRPDEKEDQADSGPDRDN
Ga0068870_1067667723300005840Miscanthus RhizosphereMNQHRPQQVPQKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0097621_10045554913300006237Miscanthus RhizosphereMNQPKPQQGPPKDHTNPFRKPVIRPDEKEDQADSG
Ga0068871_10121054413300006358Miscanthus RhizosphereMNQPKPQQGPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQET
Ga0075421_10039218233300006845Populus RhizosphereMEQRPPKPAPARDTRDPFRKPVIRPDEKEDQADSGPDRDNPVTQESKQPSSRPQPR*
Ga0075430_10014606333300006846Populus RhizosphereMEQRPPKPAPARDTRDPFRKPVIRPDEKEDQADSGPDRDNPVTQESNSSRPQPR*
Ga0068865_10014500533300006881Miscanthus RhizosphereMDQPRPQPAPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITRESKQPAAKQPTR*
Ga0079218_1209634813300007004Agricultural SoilMNQHRPQQVPPKDNTNPFHKPVIRPDEKEDQADSGPDRDNPITQESRQPASKQPAR*
Ga0111539_1131434623300009094Populus RhizosphereMNQHKPQQVPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0075418_1029745223300009100Populus RhizosphereMEQRPPKPAPARDTRDPFRKPAIRPDEKEDQADSGPDRDNPVTQESKQPSSRPQPR*
Ga0105242_1312435223300009176Miscanthus RhizosphereMNQPKPQQVPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQESRQPASKQPAR*
Ga0105252_1016665813300009678SoilMNQHKPQQVPPKDTTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0134127_1298458823300010399Terrestrial SoilMNKHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITRESKPAAKQPTR*
Ga0134122_1144821013300010400Terrestrial SoilGRATMNPRTSKQPPPQDNTNPFRKPVIRPDEKEDQGDSGPDSDNPVTQESKEPAPRPTRR
Ga0137428_106980923300011432SoilMNQDKPHQVPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0157281_104097223300012883SoilMNQPKPQQGPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQESRQPASKQPAR*
Ga0157295_1001798913300012906SoilLVSSRKGTWIALLLEGRATMNQPKPQQVPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0157286_1030138323300012908SoilMNQPKPQQVPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPER*
Ga0157310_1003482923300012916SoilMNQPKPQQVPPKDHTNPFRKPAIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0164241_1037743423300012943SoilMNQHKPQQVSPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0157307_102179823300013096SoilMNHHKPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPER*
Ga0163162_1217194513300013306Switchgrass RhizosphereMNQHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPER*
Ga0157375_1100893533300013308Miscanthus RhizosphereMNKHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPIT
Ga0163163_1062670323300014325Switchgrass RhizosphereKGTWIALLLEGRATMNQPKPQQVPPKDNTNPFRKPVVRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR*
Ga0173483_1066516313300015077SoilTGRATMNPRTSKQPPPQDNTNPFRKPVIRPDEKEDQGDSGPDSDNPVTQESKQPAPRPTRR*
Ga0173478_1007901723300015201SoilMNQPKPQQGPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKRPPSKQPAR*
Ga0132257_10177538723300015373Arabidopsis RhizosphereMNQPKPQQVPPKDHTNPFRKPVIRPDEKEDQADSGPDRDHPITTGKVN*
Ga0163161_1006774813300017792Switchgrass RhizosphereMNQDKAQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPKQPAR
Ga0184624_1008558023300018073Groundwater SedimentMNQDKAQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0184625_1016717613300018081Groundwater SedimentMNQPKPQQVPPKDNTNPCRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0184628_1021162613300018083Groundwater SedimentQPRPQQAPPKDTTNPFRKPAIRPDEKEDQADSGPDRDNPVTQESKQPRSKHQRR
Ga0190270_1018450733300018469SoilMNQDKPHQVPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0190274_1005577733300018476SoilMDQPRPQQAPPKDTTNPFRKPAIRPDEKEDQADSGPDRDNPVTQESKRPASKHQRR
Ga0190274_1025866913300018476SoilGTWIALLLEGRATMNQHTPQQVPPKDNSNPFRKPLIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0190274_1092311323300018476SoilMDTRTPKQNPPKDSANPFRKPVIRPDEKEDQADSGPDRENPITQESKHSSSKRQTR
Ga0190274_1257049013300018476SoilMNPRTPKQTPSKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQE
Ga0190271_1006665843300018481SoilMNQHKPQQVPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0173481_1017304723300019356SoilMNHHKPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0173479_1019074423300019362SoilMNQPKPQQVPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0210380_1008485933300021082Groundwater SedimentDMPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0210380_1014424323300021082Groundwater SedimentMNQPKPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQET
Ga0207697_1012944723300025315Corn, Switchgrass And Miscanthus RhizosphereLVSSRKGTWIALLLEGRATMNQPKPQQVPPKDNTNPFRKPVVRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0207682_1001537323300025893Miscanthus RhizosphereMNPRTSKQPPPQDNTNPFRKPVIRPDEKEDQGDSGPDSDNPVTQESKQPAPRPNRR
Ga0207682_1003871223300025893Miscanthus RhizosphereMNKHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITRESKQPAAKQPTR
Ga0207682_1010130923300025893Miscanthus RhizosphereLLEGRATMNQPKPQQGPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0207682_1043335223300025893Miscanthus RhizosphereMNQPKPQQVPPKDHTNPFRKPVIRPDEKEDQADSGPDRD
Ga0207688_1006192733300025901Corn, Switchgrass And Miscanthus RhizosphereMNKHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0207688_1044687423300025901Corn, Switchgrass And Miscanthus RhizosphereMNPRTSKQPPPQDNTNPFRKPVIRPDEKEDQGDSGPDSDNPVTQESKEPAPRPTRR
Ga0207680_1011150623300025903Switchgrass RhizosphereMNQPKPQQVPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITRESKQPAAKQPTR
Ga0207645_1029733423300025907Miscanthus RhizosphereMNQPKPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITRESKQPAAKQPTR
Ga0207643_1006515133300025908Miscanthus RhizosphereMNQPKPQQVPPKDNTNPFRKPVVRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0207660_1086365713300025917Corn RhizosphereMNPRTSKQPPPQDNTNPFRKPVIRPDEKEDQGDSGPDS
Ga0207681_1066009923300025923Switchgrass RhizosphereMNKHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITRES
Ga0207650_1015501023300025925Switchgrass RhizosphereMNPRTSKQPPPQDNTNPFRKPVIRPDEKEDQGDSGPDSDNPVTQESKQPAPRPTRR
Ga0207659_1045610123300025926Miscanthus RhizosphereMNPRTSKQPPPQDNTNPFRKPVIRPDEKEDQGDSGPDSDNPVTQE
Ga0207659_1059282613300025926Miscanthus RhizosphereMNKHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITRESEQPAA
Ga0207701_1086316113300025930Corn, Switchgrass And Miscanthus RhizosphereMNPRTSKQPPPQDNTNPFRKPVIRPDEKEDQGDSGPDSDNPVTQES
Ga0207706_1019475723300025933Corn RhizosphereMNQPKPQQGPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITRESKQPAAKQPTR
Ga0207669_1128872413300025937Miscanthus RhizospherePQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITRESKQPAAKQPTR
Ga0207704_1133906023300025938Miscanthus RhizosphereMDQPRPQPAPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0207668_1008583923300025972Switchgrass RhizosphereMNQPKPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0207675_10045822613300026118Switchgrass RhizosphereMNQPKPQQVPPKDNTNPFRKPVVRPDEKEDQADSGPDRDNPITRETK
Ga0207683_1002653773300026121Miscanthus RhizosphereMNQPKPQQGPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0268265_1178578113300028380Switchgrass RhizosphereMNKHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITRESEQPAKKQPTR
Ga0247820_1089400323300028597SoilMNHHKPQQVPPKDNTNPFRKPVVRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0247825_1016821823300028812SoilMNHHKPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPER
Ga0247827_1132940613300028889SoilMNQHKPQQVPPKDHTNPFRKPVIRPDEKEDQADSGPDRDNPITQESKQPASKQPAR
Ga0307497_1004114123300031226SoilMNQHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPMTQESKQPASKQPAQ
Ga0310887_1064082813300031547SoilMNQPKPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITRESKQPASKQ
Ga0310886_1020694823300031562SoilMNQDKAQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITRESKQPASKQPAR
Ga0310813_1012649313300031716SoilPPPQDNTNPFRKPVIRPDEKEDQGDSGPDSDNPVTQESKQPAPRPTRR
Ga0310907_1052868513300031847SoilKHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0310904_1081080323300031854SoilMKHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITRESKQPASKQPAR
Ga0310892_1011092033300031858SoilKHRRQQVPPKDNINPFRKPVIRPDEKEDQADSGPDRDNPVTRESKQPASKRPAR
Ga0310892_1028377233300031858SoilMNQPKPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPE
Ga0310900_1048981323300031908SoilMNHHKPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKH
Ga0310891_1019138613300031913SoilKGTWIALLLEGRATMNQHKPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQESRQPASKQPAR
Ga0310885_1034529123300031943SoilMNQHRPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQESRQPASKQPAR
Ga0310902_1013018523300032012SoilMNQHKPQQVPPKDNTNPFRKPVVRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0310906_1103047713300032013SoilLLVSSLKGTWIALLLEGRATMNQPKPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPAR
Ga0315910_1002551043300032144SoilMDPRTPRQTPPKDNDNPFRKPVIRPDEKEDQADSGPDRDNPITQHSKDVSPKRESR
Ga0315910_1013774413300032144SoilMDQRPPTQNPSRDKTDPFRKPVIRPDEKEDQADSGPDRDNPITQESKDSAQKQQAR
Ga0315910_1069484113300032144SoilMDTRTTKQTPPKDSSNPFRKPVIRPDEKEDQADSGPDRENPITQESKEPGAKHQPR
Ga0315912_1010323733300032157SoilMDPRPPAQNPRKKERDPFRAPVIRPDDDKEDQADSGPDRDNPVTQESKHPAPKHQPR
Ga0315912_1035665923300032157SoilMDPRTSKQTPPKDRTNPFRKPVIRPDEKEDQADSGPDRDNPVTQESKQPTNRSRAQ
Ga0315912_1080268713300032157SoilRQTPPKDNYNPFRKPVIRPDEKEDQADSGPDRDNPITQHSKDVSPKRESR
Ga0310889_1036084013300032179SoilMNQPKPQQVPPKDNTNPFRKPVIRPDEKEDQADSGPDRDNPITQETKQPPSKQPA
Ga0364935_0264799_2_1663300034151SedimentMDQPRPQQAPPKDTTNPFRKPAIRPDEKEDQADSGPDRDNPVTQESKRPASKHQR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.