NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F084741

Metagenome / Metatranscriptome Family F084741

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084741
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 63 residues
Representative Sequence MKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGIDYKKLLNGLK
Number of Associated Samples 93
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 8.04 %
% of genes near scaffold ends (potentially truncated) 32.14 %
% of genes from short scaffolds (< 2000 bps) 67.86 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (42.857 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine
(22.321 % of family members)
Environment Ontology (ENVO) Unclassified
(70.536 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(94.643 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 78.46%    β-sheet: 0.00%    Coil/Unstructured: 21.54%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF04304DUF454 6.25
PF01467CTP_transf_like 4.46
PF13671AAA_33 1.79
PF00118Cpn60_TCP1 1.79
PF00478IMPDH 1.79
PF02668TauD 1.79
PF01041DegT_DnrJ_EryC1 1.79
PF02562PhoH 0.89
PF09511RNA_lig_T4_1 0.89
PF07507WavE 0.89
PF00132Hexapep 0.89
PF04055Radical_SAM 0.89
PF09414RNA_ligase 0.89
PF00685Sulfotransfer_1 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG2832Uncharacterized membrane protein YbaN, DUF454 familyFunction unknown [S] 6.25
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 1.79
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 1.79
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 1.79
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 1.79
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 1.79
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 1.79
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 1.79
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 1.79
COG1702Phosphate starvation-inducible protein PhoH, predicted ATPaseSignal transduction mechanisms [T] 0.89
COG1875Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domainsGeneral function prediction only [R] 0.89

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms57.14 %
UnclassifiedrootN/A42.86 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10161184All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium806Open in IMG/M
3300000116|DelMOSpr2010_c10058549All Organisms → Viruses → Predicted Viral1634Open in IMG/M
3300000159|LPaug08P2610mDRAFT_c1000209Not Available14412Open in IMG/M
3300000418|P_2C_Liq_1_UnCtyDRAFT_1001075Not Available10712Open in IMG/M
3300001344|JGI20152J14361_10004839Not Available7102Open in IMG/M
3300001346|JGI20151J14362_10068712All Organisms → Viruses → Predicted Viral1394Open in IMG/M
3300002131|M2t2BS1_1250023Not Available1717Open in IMG/M
3300002154|JGI24538J26636_10029083All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Shirahamavirus → Shirahamavirus PTm11354Open in IMG/M
3300003216|JGI26079J46598_1001588Not Available8973Open in IMG/M
3300003263|JGI26117J46588_1022187Not Available585Open in IMG/M
3300003263|JGI26117J46588_1030921Not Available503Open in IMG/M
3300003345|JGI26080J50196_1002719Not Available7000Open in IMG/M
3300003345|JGI26080J50196_1015099All Organisms → Viruses → Predicted Viral2107Open in IMG/M
3300003345|JGI26080J50196_1035656All Organisms → Viruses → Predicted Viral1046Open in IMG/M
3300003346|JGI26081J50195_1006197All Organisms → Viruses → Predicted Viral3419Open in IMG/M
3300003409|JGI26088J50261_1058666Not Available683Open in IMG/M
3300003410|JGI26086J50260_1002600Not Available9565Open in IMG/M
3300003410|JGI26086J50260_1030265All Organisms → Viruses → Predicted Viral1455Open in IMG/M
3300003427|JGI26084J50262_1001576Not Available12583Open in IMG/M
3300003427|JGI26084J50262_1002502All Organisms → cellular organisms → Bacteria9532Open in IMG/M
3300003427|JGI26084J50262_1013101All Organisms → Viruses → Predicted Viral3014Open in IMG/M
3300003427|JGI26084J50262_1040434Not Available1185Open in IMG/M
3300003617|JGI26082J51739_10054250Not Available1227Open in IMG/M
3300003617|JGI26082J51739_10140123Not Available565Open in IMG/M
3300003621|JGI26083J51738_10014727All Organisms → Viruses → Predicted Viral2886Open in IMG/M
3300004097|Ga0055584_101475893All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium706Open in IMG/M
3300004279|Ga0066605_10053142All Organisms → Viruses → Predicted Viral1821Open in IMG/M
3300004642|Ga0066612_1048169Not Available1779Open in IMG/M
3300004642|Ga0066612_1302865All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium520Open in IMG/M
3300005239|Ga0073579_1694351All Organisms → Viruses → Predicted Viral1992Open in IMG/M
3300005941|Ga0070743_10099651Not Available977Open in IMG/M
3300006164|Ga0075441_10001111All Organisms → cellular organisms → Bacteria13170Open in IMG/M
3300006789|Ga0098054_1012152All Organisms → Viruses → Predicted Viral3533Open in IMG/M
3300006793|Ga0098055_1041843Not Available1870Open in IMG/M
3300006947|Ga0075444_10077213Not Available1501Open in IMG/M
3300007620|Ga0102871_1113240Not Available775Open in IMG/M
3300007692|Ga0102823_1216080Not Available513Open in IMG/M
3300007957|Ga0105742_1027212All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium697Open in IMG/M
3300007973|Ga0105746_1183867All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium711Open in IMG/M
3300007992|Ga0105748_10399552Not Available593Open in IMG/M
3300008791|Ga0103696_1032264All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium571Open in IMG/M
3300009024|Ga0102811_1017115All Organisms → Viruses → Predicted Viral2837Open in IMG/M
3300009050|Ga0102909_1159752Not Available541Open in IMG/M
3300009172|Ga0114995_10011373All Organisms → cellular organisms → Bacteria5532Open in IMG/M
3300009420|Ga0114994_10376173Not Available942Open in IMG/M
3300009432|Ga0115005_10439238All Organisms → Viruses → Predicted Viral1037Open in IMG/M
3300009496|Ga0115570_10265506All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium753Open in IMG/M
3300009507|Ga0115572_10704967All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium549Open in IMG/M
3300009512|Ga0115003_10702241Not Available589Open in IMG/M
3300009544|Ga0115006_10328970All Organisms → cellular organisms → Bacteria1340Open in IMG/M
3300009599|Ga0115103_1346682All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium982Open in IMG/M
3300017719|Ga0181390_1022100All Organisms → Viruses → Predicted Viral2064Open in IMG/M
3300017719|Ga0181390_1031208All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1666Open in IMG/M
3300017741|Ga0181421_1078998All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium861Open in IMG/M
3300017824|Ga0181552_10272382Not Available844Open in IMG/M
3300017950|Ga0181607_10332901Not Available844Open in IMG/M
3300018036|Ga0181600_10381019Not Available689Open in IMG/M
3300020185|Ga0206131_10004999Not Available14226Open in IMG/M
3300020347|Ga0211504_1017741All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1952Open in IMG/M
3300020352|Ga0211505_1026979All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1466Open in IMG/M
3300021185|Ga0206682_10002603All Organisms → cellular organisms → Bacteria16185Open in IMG/M
3300021957|Ga0222717_10003963All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales10995Open in IMG/M
(restricted) 3300023109|Ga0233432_10082461All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1871Open in IMG/M
(restricted) 3300023109|Ga0233432_10366656Not Available641Open in IMG/M
3300024188|Ga0228602_1087146All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium541Open in IMG/M
3300024226|Ga0228667_1004290All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3367Open in IMG/M
3300024235|Ga0228665_1058729Not Available793Open in IMG/M
(restricted) 3300024261|Ga0233439_10229821All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium832Open in IMG/M
(restricted) 3300024264|Ga0233444_10124905All Organisms → Viruses → Predicted Viral1293Open in IMG/M
(restricted) 3300024264|Ga0233444_10324631All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium656Open in IMG/M
3300024281|Ga0228610_1027080Not Available722Open in IMG/M
3300024294|Ga0228664_1012454All Organisms → Viruses → Predicted Viral2754Open in IMG/M
3300024328|Ga0228635_1027944All Organisms → Viruses → Predicted Viral1701Open in IMG/M
3300024343|Ga0244777_10138641Not Available1572Open in IMG/M
3300024346|Ga0244775_10626423Not Available871Open in IMG/M
3300025070|Ga0208667_1001547Not Available8253Open in IMG/M
3300025070|Ga0208667_1009318All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2324Open in IMG/M
3300025083|Ga0208791_1002166Not Available6742Open in IMG/M
3300025085|Ga0208792_1000608Not Available13294Open in IMG/M
3300025108|Ga0208793_1025470All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2029Open in IMG/M
3300025138|Ga0209634_1023735All Organisms → cellular organisms → Bacteria3367Open in IMG/M
3300025608|Ga0209654_1054257Not Available1226Open in IMG/M
3300025617|Ga0209138_1040199All Organisms → Viruses → Predicted Viral1785Open in IMG/M
3300025617|Ga0209138_1051752Not Available1460Open in IMG/M
3300025626|Ga0209716_1005847Not Available6552Open in IMG/M
3300025626|Ga0209716_1044171Not Available1520Open in IMG/M
3300025640|Ga0209198_1087188All Organisms → Viruses → Predicted Viral1010Open in IMG/M
3300025658|Ga0209659_1036195All Organisms → Viruses → Predicted Viral1916Open in IMG/M
3300025695|Ga0209653_1024847All Organisms → Viruses → Predicted Viral2685Open in IMG/M
3300025701|Ga0209771_1059237All Organisms → Viruses → Predicted Viral1380Open in IMG/M
3300025701|Ga0209771_1104955All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium931Open in IMG/M
3300025701|Ga0209771_1238119Not Available507Open in IMG/M
3300025705|Ga0209374_1029482All Organisms → Viruses → Predicted Viral2261Open in IMG/M
3300025886|Ga0209632_10297798Not Available805Open in IMG/M
3300025890|Ga0209631_10472740All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium564Open in IMG/M
3300026426|Ga0247570_1103249Not Available534Open in IMG/M
3300026479|Ga0228622_1060998All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300026504|Ga0247587_1098245All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium721Open in IMG/M
3300027233|Ga0208678_1062952Not Available756Open in IMG/M
3300027250|Ga0208310_1060842All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium546Open in IMG/M
3300027704|Ga0209816_1139788Not Available880Open in IMG/M
3300027714|Ga0209815_1001023All Organisms → cellular organisms → Bacteria19295Open in IMG/M
3300027752|Ga0209192_10036633Not Available2291Open in IMG/M
3300027752|Ga0209192_10137992All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300027780|Ga0209502_10008578Not Available6906Open in IMG/M
3300027788|Ga0209711_10207019All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Shirahamavirus → Shirahamavirus PTm1900Open in IMG/M
3300027813|Ga0209090_10045601All Organisms → Viruses → Predicted Viral2476Open in IMG/M
3300027813|Ga0209090_10126030All Organisms → Viruses → Predicted Viral1368Open in IMG/M
3300027883|Ga0209713_10216867All Organisms → Viruses → Predicted Viral1288Open in IMG/M
3300028109|Ga0247582_1053039Not Available1058Open in IMG/M
3300028134|Ga0256411_1251051All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium545Open in IMG/M
3300031519|Ga0307488_10014959All Organisms → cellular organisms → Bacteria6283Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine22.32%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine20.54%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater9.82%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine8.04%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.25%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater4.46%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.46%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine4.46%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water2.68%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.68%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.68%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.79%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.79%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.89%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.89%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.89%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.89%
EnviromentalEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental0.89%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.89%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.89%
MarineEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine0.89%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000159Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 10mEnvironmentalOpen in IMG/M
3300000418Marine microbial community from Union City, CA, USA - Pond 2C Liquid 1EnvironmentalOpen in IMG/M
3300001344Pelagic Microbial community sample from North Sea - COGITO 998_met_02EnvironmentalOpen in IMG/M
3300001346Pelagic Microbial community sample from North Sea - COGITO 998_met_01EnvironmentalOpen in IMG/M
3300002131Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS1 (111f)EnvironmentalOpen in IMG/M
3300002154Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 MetagenomeEnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003263Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_48_BLW_10EnvironmentalOpen in IMG/M
3300003345Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNAEnvironmentalOpen in IMG/M
3300003346Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNAEnvironmentalOpen in IMG/M
3300003409Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNAEnvironmentalOpen in IMG/M
3300003410Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNAEnvironmentalOpen in IMG/M
3300003427Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNAEnvironmentalOpen in IMG/M
3300003617Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNAEnvironmentalOpen in IMG/M
3300003621Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300004642Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_10m_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007620Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007957Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_3.0umEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008791Microbial communities from seawater in eastern North Pacific Ocean - P1 free-living McLaneEnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009050Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300024188Seawater microbial communities from Monterey Bay, California, United States - 2DEnvironmentalOpen in IMG/M
3300024226Seawater microbial communities from Monterey Bay, California, United States - 81DEnvironmentalOpen in IMG/M
3300024235Seawater microbial communities from Monterey Bay, California, United States - 79DEnvironmentalOpen in IMG/M
3300024261 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MGEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024281Seawater microbial communities from Monterey Bay, California, United States - 11DEnvironmentalOpen in IMG/M
3300024294Seawater microbial communities from Monterey Bay, California, United States - 78DEnvironmentalOpen in IMG/M
3300024328Seawater microbial communities from Monterey Bay, California, United States - 44DEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025608Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025617Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025658Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025695Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025705Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026426Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 23R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026479Seawater microbial communities from Monterey Bay, California, United States - 26DEnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027233Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027250Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027704Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1016118423300000101MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLIGLK*
DelMOSpr2010_1005854913300000116MarineYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIVGIDYKKLLNGLK*
LPaug08P2610mDRAFT_1000209273300000159MarineVREFKPFKTNKMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKQLLNGLK*
P_2C_Liq_1_UnCtyDRAFT_1001075113300000418EnviromentalMKNYQAILMIVIGFGLGIQTLNGVVQMYIPFAGVKNEIAFAFVGIMMGTLGIFAVDYKKILKALI*
JGI20152J14361_10004839103300001344Pelagic MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFAIDYKKLLNGLK*
JGI20151J14362_1006871223300001346Pelagic MarineMKNYQGILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMLGTLGIFGIDYKKLLNGLK*
M2t2BS1_125002333300002131MarineMKNYQAILMIIVGFGLAIGTMNGSVQNYIHFVGTLNELAFAFLTGMLGVVGCFGIDYKKILKALI*
JGI24538J26636_1002908333300002154MarineMIIIGFGLSIGTMNGFVQTYIGFAGVDNEMAFSFMGMMIGTLGIFAVDYKKLLIGLK*
JGI26079J46598_100158843300003216MarineLSERVKPFKTNKMKNYQAXXMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTSGIFAIDYKKLLNGLK*
JGI26117J46588_102218713300003263MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLINGLK*
JGI26117J46588_103092113300003263MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLNGLK*
JGI26080J50196_100271933300003345MarineMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTLGIFAVDYKKLLNGLK*
JGI26080J50196_101509943300003345MarineMKNYQGILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLNGLK*
JGI26080J50196_103565633300003345MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIVGIDYKKLLNGLK*
JGI26081J50195_100619783300003346MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTLGIFAVDYKKLLNGLK*
JGI26088J50261_105866623300003409MarineMIVIGFGLGIQTLNGVVQMYIPFAGVKNEIAFAFVGIMMGTLGIFAVDYKKILKALI*
JGI26086J50260_100260013300003410MarineLSERVKPFKTNKMKNYQAILMIIIGFGLGIQTLNGVIQMYIPFAGVKNEIAFAFVGIMMGTLGIFAVDYKKILKALI*
JGI26086J50260_103026543300003410MarineMKNYQALLMIVIGFGLGIGTMNGTIQNYXHFVGVENEMAFSFVGIMMGVLGIFAIDYKKILKALI*
JGI26084J50262_1001576263300003427MarineMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLNGLK*
JGI26084J50262_100250283300003427MarineMKNYQALLMIVIGFGLGIGTMNGTIQNYVHFVGVENEMAFSFVGIMMGVLGIFAIDYKKILKALI*
JGI26084J50262_101310173300003427MarineLSERVKPFKTNKMKNYQAILMIVIGFGLGIQTLNGVVQMYIPFAGVKNEIAFAFVGIMMGTLGIFAVDYKKILKALI*
JGI26084J50262_104043413300003427MarineMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTSGIFAIDYKKLLNGLK*
JGI26082J51739_1005425023300003617MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTSGIFAIDYKKLLNGLK*
JGI26082J51739_1014012323300003617MarineMIIXGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIVGIDYKKLLNGLK*
JGI26083J51738_1001472743300003621MarineMKNYQGILMIIIGFGLSIGTMNGFVQNYXGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLNGLK*
Ga0055584_10147589323300004097Pelagic MarineLSERVKPFKTNKMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFAIDYKKLLNGLK*
Ga0066605_1005314243300004279MarineMKNYQGILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIVGIDYKKLLNGLK*
Ga0066612_104816943300004642MarineMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTLGIFAVDYKKLLIGLK*
Ga0066612_130286513300004642MarineFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGIDYKKLLNGLK*
Ga0073579_169435133300005239MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMIFGTLGIVGIDYKKLLNGLK*
Ga0070743_1009965133300005941EstuarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTLGIFAVDYKKLLIGLK*
Ga0075441_10001111233300006164MarineMKNYQAILMIIIGFGLSIGTMNGFVQTYIGFAGVDNEMAFSFMGMMIGTLGIFAVDYKKLLIGLN*
Ga0098054_101215293300006789MarineMKNYQAILMIIIGFGLSIGTMNGTVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGIDYKKLLNGLK*
Ga0098055_104184363300006793MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMIFGTLGIFGIDYKKLLNGLK*
Ga0075444_1007721333300006947MarineMKNYQAILMIIIGFGLSIGTMNGFVQTYIGFAGVDNEMAFSFMGMMIGTLGIFAVDYKKLLIGLK*
Ga0102871_111324013300007620EstuarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTLGIFAVDYKK
Ga0102823_121608023300007692EstuarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIDFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLNGLK*
Ga0105742_102721223300007957Estuary WaterMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMLGTLGIFGIDYKKLLNGLK*
Ga0105746_118386723300007973Estuary WaterMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGIDYKKLLNGLK*
Ga0105748_1039955213300007992Estuary WaterMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTLGIFAVDYKKL
Ga0103696_103226423300008791Ocean WaterKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGIDYKKTINRIKINKTLKP*
Ga0102811_101711523300009024EstuarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGIDYKKLINGLK*
Ga0102909_115975233300009050EstuarineFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTLGIFAVDYKKLLIGLK*
Ga0114995_1001137313300009172MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGINYKKLLIGLK*
Ga0114994_1037617323300009420MarineVRELNLLKQTKMKNYQAILMIIIGFGLSIGTMNGFVQTYIGFAGVDNEMAFSFMGMMFGTLGIVGIDYKKLLNGLK*
Ga0115005_1043923813300009432MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVVNEMAFSFMGMMFGTLGIVGIDYKKLLNGLK*
Ga0115570_1026550613300009496Pelagic MarineKMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFAIDYKKLLNGLK*
Ga0115572_1070496723300009507Pelagic MarineYQGILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMLGTLGIFGIDYKKLLNGLK*
Ga0115003_1070224113300009512MarineIIGFGLSIGTMNGFVQTYIGFAGVDNEMAFSFMGMMIGTLGIFAVDYKKLLIGLK*
Ga0115006_1032897063300009544MarineILMIIIGFGLSIGTMNGFVQTYIGFAGMDNEMAFSFMGMMIGTLGIFAVDYKKLLIGLK*
Ga0115103_134668233300009599MarineMKNYQGILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLIGLK*
Ga0181390_102210013300017719SeawaterMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFG
Ga0181390_103120863300017719SeawaterFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLNGLK
Ga0181421_107899813300017741SeawaterMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLINGLK
Ga0181552_1027238213300017824Salt MarshMKNYQAILMIVIGFGLGIQTLNGVVQMYIPFAGVKNEIAFAFVGIMMGTLGIFAVDYKKILKALI
Ga0181607_1033290113300017950Salt MarshVKPFKTNKMKNYQAILMIVIGFGLGIQTLNGVVQMYIPFAGVKNEIAFAFVGIMMGTLGIFAVDYKKILKALI
Ga0181600_1038101933300018036Salt MarshGIQTLNGVVQMYIPFAGVKNEIAFAFVGIMMGTLGIFAVDYKKILKALI
Ga0206131_10004999293300020185SeawaterMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFAIDYKKLLNGLK
Ga0211504_101774173300020347MarineMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLNGLK
Ga0211505_102697953300020352MarineMKNYQGILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLNGLK
Ga0206682_10002603173300021185SeawaterMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLNGLK
Ga0222717_1000396333300021957Estuarine WaterMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTLGIFAVDYKKLLIGLK
(restricted) Ga0233432_1008246113300023109SeawaterLMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGIDYKKLINGLK
(restricted) Ga0233432_1036665613300023109SeawaterMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTSGIFAIDYKKLLNGLK
Ga0228602_108714613300024188SeawaterMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMXMMFGTLGIFGIDYKKLLNGLK
Ga0228667_100429023300024226SeawaterMKNYQGILMIIIGFGLSIGTMNGLVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLNGLK
Ga0228665_105872913300024235SeawaterMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGIDYKKLLNGLK
(restricted) Ga0233439_1022982123300024261SeawaterMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGIDYKKLINGLK
(restricted) Ga0233444_1012490543300024264SeawaterMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTLGIFGIDYKKLLIGLK
(restricted) Ga0233444_1032463113300024264SeawaterLIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLNGLK
Ga0228610_102708033300024281SeawaterMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTLGIFAVDYKKLLI
Ga0228664_101245493300024294SeawaterKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLNGLK
Ga0228635_102794453300024328SeawaterMKNYQGILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLIGLK
Ga0244777_1013864153300024343EstuarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTLGIFAVDYKKLLIGLK
Ga0244775_1062642333300024346EstuarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIVGIDYKKLLNGLK
Ga0208667_100154713300025070MarineMIIIGFGLSIGTMNGTVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLNGL
Ga0208667_100931883300025070MarineMKNYQGILMIIIGFGLSIGTMNGTVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGIDYKKLLNGLK
Ga0208791_100216673300025083MarineMKNYQAILMIIIGFGLSIGTMNGTVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGIDYKKLLNGLK
Ga0208792_100060843300025085MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMIFGTLGIFGIDYKKLLNGLK
Ga0208793_102547073300025108MarineMIIIGFGLSIGTMNGTVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGIDYKKLLNGLK
Ga0209634_102373543300025138MarineVREFKPFKTNKMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKQLLNGLK
Ga0209654_105425743300025608MarineMKNYQALLMIVIGFGLGIGTMNGTIQNYVHFVGVENEMAFSFVGIMMGVLGIFAIDYKKILKALI
Ga0209138_104019953300025617MarineQAILMIVIGFGLGIQTLNGVIQMYIPFAGVKNEIAFAFVGIMMGTLGIFAVDYKKILKAL
Ga0209138_105175213300025617MarineMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTLGIFAVDYKKLLNGLK
Ga0209716_1005847153300025626Pelagic MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGINYKKLLIGLK
Ga0209716_104417113300025626Pelagic MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFAIDYKKLLNGLK
Ga0209198_108718843300025640Pelagic MarineMKNYQGILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMLGTLGIFGIDYKKLLNGLK
Ga0209659_103619513300025658MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGI
Ga0209653_102484783300025695MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTLGIFAVDYKKLLNGLK
Ga0209771_105923713300025701MarineFKTNKMKNYQAILMIVIGFGLGIQTLNGVIQMYIPFAGVKNEIAFAFVGIMMGTLGIFAVDYKKILKALI
Ga0209771_110495553300025701MarineIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIVGIDYKKLLNGLK
Ga0209771_123811913300025701MarineILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTSGIFAIDYKKLLNGLK
Ga0209374_102948213300025705MarineFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIVGIDYKKLLNGLK
Ga0209632_1029779833300025886Pelagic MarineMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLNGL
Ga0209631_1047274023300025890Pelagic MarineFKTNKMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFAIDYKKLLNGLK
Ga0247570_110324923300026426SeawaterMKNYQGILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLN
Ga0228622_106099813300026479SeawaterNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTLGIFAVDYKKLLIGLK
Ga0247587_109824523300026504SeawaterMKNYQGILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGIDYKKLLNGLK
Ga0208678_106295233300027233EstuarineMKNYQGILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMAMLIGTLGIFAVDYKKLLIGLK
Ga0208310_106084223300027250EstuarineLMIIIGFGLSIGTMNGFVQNYIGFAGVDNEIAFSFMGMMFGTLGIFGIDYKKLLNGLK
Ga0209816_113978833300027704MarineMKNYQAILMIIIGFGLSIGTMNGFVQTYIGFAGVDNEMAFSFMGMMIGTLGIFAVDYKKLLIGLK
Ga0209815_1001023363300027714MarineMKNYQAILMIIIGFGLSIGTMNGFVQTYIGFAGVDNEMAFSFMGMMIGTLGIFAVDYKKLLIGLN
Ga0209192_1003663313300027752MarineMKNYQAILMIIIGFGLSIGTMNGFVQTYIGFAGVDNEMAFSFMGMMFGTLGIVGIDYKKL
Ga0209192_1013799253300027752MarineTNKMKNYQAILMIIIGFGLSIGTMNGFVQTYIGFAGVDNEMAFSFMGMMIGTLGIFAVDYKKLLIGLK
Ga0209502_1000857863300027780MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMIFGTLGIVGIDYKKLLNGLK
Ga0209711_1020701923300027788MarineMKNYQAILMIIIGFGLSIGTMNGFVQTYIGFAGVDNEMAFSFMGMMFGTLGIVGIDYKKLLNGLK
Ga0209090_1004560193300027813MarineMKNYQAILMIIIGFGLGIGTISGVVQNYIGFAGVDNEMAFSFMGIFMGTLGIFAVDYKKLLIGLK
Ga0209090_1012603033300027813MarineVRELNLLKQTKMKNYQAILMIIIGFGLSIGTMNGFVQTYIGFAGVDNEMAFSFMGMMFGTLGIVGIDYKKLLNGLK
Ga0209713_1021686763300027883MarineMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIVGIDYKKLLNGL
Ga0247582_105303913300028109SeawaterVRELNPFKTNKMKNYQAILMIIIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGIDYKKLLNGLK
Ga0256411_125105113300028134SeawaterIGFGLSIGTMNGFVQNYIGFAGVDNEMAFSFMGMMFGTLGIFGIDYKKLINGLK
Ga0307488_1001495923300031519Sackhole BrineMKNYQAILMIIIGFGLSIGTMNGFVQTYIGFAGVDNEMAFSFMGMMIGTLGIVGIDYKKLLNGLK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.