NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F084896

Metagenome Family F084896

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084896
Family Type Metagenome
Number of Sequences 112
Average Sequence Length 48 residues
Representative Sequence FRVNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEVVEGQFWEMK
Number of Associated Samples 103
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.89 %
% of genes near scaffold ends (potentially truncated) 94.64 %
% of genes from short scaffolds (< 2000 bps) 96.43 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.13

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(13.393 % of family members)
Environment Ontology (ENVO) Unclassified
(25.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.857 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 5.41%    Coil/Unstructured: 94.59%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.13
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF02746MR_MLE_N 46.43
PF13378MR_MLE_C 42.86
PF13343SBP_bac_6 2.68
PF07883Cupin_2 1.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 92.86

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886006|SwRhRL3b_contig_263579All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101347986All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300000890|JGI11643J12802_12049342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1302Open in IMG/M
3300003993|Ga0055468_10276392All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300004114|Ga0062593_102369416All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300004463|Ga0063356_104147331All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300005093|Ga0062594_100926686All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300005332|Ga0066388_106718647All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium579Open in IMG/M
3300005364|Ga0070673_100866884All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300005365|Ga0070688_100337948All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300005444|Ga0070694_101416994All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria587Open in IMG/M
3300005445|Ga0070708_100232768All Organisms → cellular organisms → Bacteria1729Open in IMG/M
3300005446|Ga0066686_10439129All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300005576|Ga0066708_10375683All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300005718|Ga0068866_11038936All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300005719|Ga0068861_102650750All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005764|Ga0066903_108421675All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005840|Ga0068870_11338440All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria523Open in IMG/M
3300005843|Ga0068860_100726126All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300005890|Ga0075285_1009786All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300005983|Ga0081540_1164442All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300006032|Ga0066696_10345134All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300006034|Ga0066656_11018781All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300006796|Ga0066665_11456919All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300006796|Ga0066665_11456921All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300006846|Ga0075430_100237512All Organisms → cellular organisms → Bacteria1510Open in IMG/M
3300006846|Ga0075430_100238799All Organisms → cellular organisms → Bacteria1506Open in IMG/M
3300006852|Ga0075433_10272431All Organisms → cellular organisms → Bacteria1500Open in IMG/M
3300006852|Ga0075433_10348283All Organisms → cellular organisms → Bacteria1309Open in IMG/M
3300006853|Ga0075420_100535131All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300006854|Ga0075425_100213607All Organisms → cellular organisms → Bacteria2218Open in IMG/M
3300006871|Ga0075434_101279262All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300006871|Ga0075434_101443482All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium698Open in IMG/M
3300006880|Ga0075429_100378009All Organisms → cellular organisms → Bacteria1240Open in IMG/M
3300006880|Ga0075429_101975901All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300006918|Ga0079216_10068307All Organisms → cellular organisms → Bacteria1611Open in IMG/M
3300006954|Ga0079219_12482883All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300006969|Ga0075419_11528036All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300007004|Ga0079218_13623184All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300009012|Ga0066710_103573923All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300009094|Ga0111539_11998633All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300009094|Ga0111539_12183697All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium642Open in IMG/M
3300009137|Ga0066709_101204958All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300009137|Ga0066709_103733731All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300009147|Ga0114129_13248590All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300009157|Ga0105092_10062957All Organisms → cellular organisms → Bacteria2002Open in IMG/M
3300009157|Ga0105092_10459853All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium727Open in IMG/M
3300009162|Ga0075423_11207506All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300009553|Ga0105249_11711071All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300010358|Ga0126370_10514893All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300010366|Ga0126379_12896115All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300010400|Ga0134122_11097586All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300011403|Ga0137313_1030329All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium896Open in IMG/M
3300012207|Ga0137381_11612873All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria540Open in IMG/M
3300012209|Ga0137379_10198920All Organisms → cellular organisms → Bacteria1917Open in IMG/M
3300012212|Ga0150985_122202978All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300012349|Ga0137387_10515157All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300012359|Ga0137385_10466944All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300012469|Ga0150984_121103500All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300012474|Ga0157356_1018586All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300012486|Ga0157331_1002399All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300012896|Ga0157303_10247188All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300012944|Ga0137410_11254031All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium640Open in IMG/M
3300012976|Ga0134076_10128529All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300014301|Ga0075323_1174966All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300014881|Ga0180094_1041193All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300014883|Ga0180086_1152966All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300015201|Ga0173478_10857189All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300015357|Ga0134072_10035175All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300015372|Ga0132256_102490843All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300016341|Ga0182035_10171066All Organisms → cellular organisms → Bacteria1691Open in IMG/M
3300017659|Ga0134083_10133009All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300017939|Ga0187775_10152394All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300018032|Ga0187788_10155264All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300018052|Ga0184638_1101634All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1054Open in IMG/M
3300018072|Ga0184635_10387807All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300018076|Ga0184609_10165390All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1022Open in IMG/M
3300018078|Ga0184612_10388680All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300018422|Ga0190265_11171990All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300018422|Ga0190265_13765542All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300018920|Ga0190273_11827922All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria554Open in IMG/M
3300019356|Ga0173481_10468349All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300019377|Ga0190264_11503900All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300022563|Ga0212128_10269292All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300022898|Ga0247745_1047219All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300025310|Ga0209172_10271530All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium855Open in IMG/M
3300025319|Ga0209520_10780361All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300025537|Ga0210061_1026320All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300025922|Ga0207646_10228809All Organisms → cellular organisms → Bacteria1680Open in IMG/M
3300025923|Ga0207681_11000568All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300025930|Ga0207701_10368712All Organisms → cellular organisms → Bacteria1240Open in IMG/M
3300025938|Ga0207704_11397116All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria600Open in IMG/M
3300025959|Ga0210116_1059406All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300025960|Ga0207651_10686019All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300026075|Ga0207708_10834672All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300026324|Ga0209470_1222622All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300026547|Ga0209156_10145197All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300026550|Ga0209474_10198931All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300027527|Ga0209684_1003481All Organisms → cellular organisms → Bacteria2681Open in IMG/M
3300027903|Ga0209488_10633524All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium772Open in IMG/M
3300030006|Ga0299907_10832703All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300030619|Ga0268386_10286099All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300031228|Ga0299914_10513661All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300031538|Ga0310888_11106951All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031954|Ga0306926_11641386All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300031965|Ga0326597_12074990All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300032005|Ga0307411_10342642All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300032075|Ga0310890_11675798All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300032180|Ga0307471_100142847All Organisms → cellular organisms → Bacteria → Proteobacteria2284Open in IMG/M
3300033004|Ga0335084_10659413All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300033486|Ga0316624_10518975All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300034690|Ga0364923_0054479All Organisms → cellular organisms → Bacteria952Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere13.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.82%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.36%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.57%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.68%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.68%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.68%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.79%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.79%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.89%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.89%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.89%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.89%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.89%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.89%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.89%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.89%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.89%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886006Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005890Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011403Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012474Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610EnvironmentalOpen in IMG/M
3300012486Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014301Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1EnvironmentalOpen in IMG/M
3300014881Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1DaEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300022563OV2_combined assemblyEnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025537Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025959Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027527Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300034690Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SwRhRL3b_0132.000021702162886006Switchgrass RhizosphereSAKKGNKPKVLRVDAEGNKRTDEEVDFVVVDGEVVQGQFWEMK
INPhiseqgaiiFebDRAFT_10134798623300000364SoilXTGEVPLALFRVSAKKGNKPKVVRVDAEGNRRQDEEIDFVVVDGEVVXGQYWEMX*
JGI11643J12802_1204934223300000890SoilTGDKPLALFRVSAKKGNKPKVLRVDNEGNKRTDEEIDFVVVDGQVVEGQFWEMK*
Ga0055468_1027639223300003993Natural And Restored WetlandsYYYFQNTGEGPLALLRVSAKKGTKPKVVRVDTEGNRRTEEESEFIVVDGTTVEGKFWELR
Ga0062593_10236941623300004114SoilKKGNKPKVLRVDNEGNKRTDEEIDFVVVDGQVVEGQFWEMK*
Ga0063356_10414733113300004463Arabidopsis Thaliana RhizosphereTPLALFRVSAKKGNKPKVLRVDTEGNQRTDEEIDYVVVDGEKVDGKFWELT*
Ga0062594_10092668613300005093SoilPLALFRVNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEVIEGQFWEMK*
Ga0066388_10671864713300005332Tropical Forest SoilPLALFRVSAKKGNKPKVVRVDTEGNRRTEEENEFIVVDGTTVEGKFWELT*
Ga0070673_10086688423300005364Switchgrass RhizosphereYFASTGDVPLALFRVNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEVVEGQFWEMK*
Ga0070688_10033794813300005365Switchgrass RhizosphereKKGNKPKVVRVDAEGNKRVDEEIDFIVVDGEVVEGQFWDMK*
Ga0070694_10141699423300005444Corn, Switchgrass And Miscanthus RhizosphereKKGNKPKVLRVDSEGNKRTDEEVDFVVVDGQIVEGQYWEMK*
Ga0070708_10023276813300005445Corn, Switchgrass And Miscanthus RhizosphereLFRVSAKKDNKPKVARIDSEGNKRIDEEIDFVVVDGQIVEGKFWELA*
Ga0066686_1043912923300005446SoilGDKPLALFRVSAKKDNKPKVVRVDAEGNKRTEEENGFVVVDGAAIEGKFWELT*
Ga0066708_1037568323300005576SoilNKPKVVRVDAEGNKRTEEENEFVVVDGAAIEGKFWELT*
Ga0068866_1103893613300005718Miscanthus RhizosphereKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEVVEGQFWEMK*
Ga0068861_10265075023300005719Switchgrass RhizosphereTGDRPLALFRVSAKKGNNPKVLRIDSEGNKRTDEETEFVVVDGSAIEGKYWEFA*
Ga0066903_10842167513300005764Tropical Forest SoilAKKGNKPKVVRVDTEGNRRTEEENEFIVVDGTTVEGKFWELT*
Ga0068870_1133844013300005840Miscanthus RhizosphereRVSAKKGNKPKVLRVDSEGNKRTDEEVDFVVVDGQIVEGQYWEMK*
Ga0068860_10072612613300005843Switchgrass RhizosphereVVRVDAEGNKRLDEEIDFIVVDGEVVEGQFWEMK*
Ga0075285_100978623300005890Rice Paddy SoilGNKPKVLRVDNEGNKRTDEEVDFVVVDGQVVDGQFWEMK*
Ga0081540_116444223300005983Tabebuia Heterophylla RhizosphereGDGPLALFRVSAKKGNKPKVVRVDTEGNRRTEEENEFIVVDGTTVEGKFWELT*
Ga0066696_1034513423300006032SoilFRVSAKKDNKPKVVRVDAEGNKRTEEENGFVVVDGAAIEGKFWELT*
Ga0066656_1101878123300006034SoilKPKVVRVDAEGNKRTEEENEFVVVDGAAIEGKFWELT*
Ga0066665_1145691913300006796SoilYFQSTGDKPLALFRVSAKKDNKPKVVRVDAEGNKRTEEENGFVVVDGAAIEGKFWELT*
Ga0066665_1145692113300006796SoilYFQSTGDKPLALFRVSAKKDNKPKVVRVDAEGNKRTEEENEFVVVDGAAIEGKFWELT*
Ga0075430_10023751233300006846Populus RhizosphereGDRPLALFRVSAKKGNKPKVLRVDSEGNKRTDEEIDFVVVDGETVEGKFWELS*
Ga0075430_10023879933300006846Populus RhizosphereRPLALFRVSAKKGNKPKVLRVDSEGNKRTDEEVDFVVVDGQVVDGQYWEMK*
Ga0075433_1027243113300006852Populus RhizosphereSSGERPLALFRVSAKKGNNPKVVRIDTEGNRRTDEENDFIVVDGSTIEGKYWEFA*
Ga0075433_1034828323300006852Populus RhizosphereLALFRVNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEVVQGQYWEMK*
Ga0075420_10053513123300006853Populus RhizosphereVSAKKGNKPKVLRVDSEGNKRTDEEVDFVVVDGETVEGKFWELS*
Ga0075425_10021360713300006854Populus RhizosphereGDVPLALFRVNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEVVEGQFWEMK*
Ga0075434_10127926213300006871Populus RhizosphereVPLALFRVNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEVVEGQFWEMK*
Ga0075434_10144348223300006871Populus RhizosphereRVSAKKGNKPKVVRVDAEGNRRTDEEVDFVVVDGQVVEGQYWEFK*
Ga0075429_10037800913300006880Populus RhizosphereKPLALFRVSAKKGNKPKVVRVDAEGNRRQDEEIDFIVVDGQVVEGQYWEMK*
Ga0075429_10197590113300006880Populus RhizosphereVPLALFRVNAKKGNKPKVVRVDAEGNRRLDEEIDFIVVDGDVVEGQFWEMK*
Ga0079216_1006830713300006918Agricultural SoilKPKVLRIDSEGNKRTDEEIDFVVVDGETVEGKFWELT*
Ga0079219_1248288323300006954Agricultural SoilFASTGDVPLALFRVNAKKGNKPKVVRVDAEGNKRLDEEIDFVVVDGEVVEGQFWEMK*
Ga0075419_1152803613300006969Populus RhizosphereALFRVNAKKGNKPKVVRVDAEGNRRLDEEIDFIVVDGDVVEGQFWEMK*
Ga0079218_1362318413300007004Agricultural SoilRVSAKKGTKPKVLRVDSEGNKRTDEEIDFVVVDGETVEGKFWELT*
Ga0066710_10357392323300009012Grasslands SoilYFQSTGDKPLALFRVSAKKDNKPKVVRVDAEGNKRTEEENEFVVVDWAAIEGKFWELT
Ga0111539_1199863313300009094Populus RhizosphereASTGEVPLALFRVNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEVVEGQFWEMK*
Ga0111539_1218369713300009094Populus RhizosphereNKPKVVRVDTEGNRRTEEENEFIVVDGTTVEGKFWELT*
Ga0066709_10120495813300009137Grasslands SoilKPKAVRVDTEGNKRSDEEVDFIVVDGQVVEGQYWEMK*
Ga0066709_10373373113300009137Grasslands SoilGPLALFRVSAKKGNKPKVVRVDTEGNRRTDEENEFVVVDGTTVEGKFWELS*
Ga0114129_1324859013300009147Populus RhizosphereLFRVSAKKGTKPKVLRIDSEGNKRTDEEIDFVVVDGETVEGKFWELT*
Ga0105092_1006295713300009157Freshwater SedimentFQSTGDRPLALFRVSAKKGAKPKVLRVDSEGNKRTDEEIDFVVVDGETVEGKFWELS*
Ga0105092_1045985323300009157Freshwater SedimentKKGNKPKVVRVDTEGNRRTEEENEFIVVDGTTVEGKFWELA*
Ga0075423_1120750623300009162Populus RhizosphereRVNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEVVEGQFWEMK*
Ga0105249_1171107113300009553Switchgrass RhizosphereYYYFASTGDVPLALFRVNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGKVVEGQFWEMK
Ga0126370_1051489313300010358Tropical Forest SoilKPKVARIDSEGNKRLDEEIDFIVVDGEIVEGQYWEMK*
Ga0126379_1289611523300010366Tropical Forest SoilVARIDAEGNKRLDEEIDFIVVDGEVVEGQYWEMK*
Ga0134122_1109758623300010400Terrestrial SoilLALFRVSAKKGNKPKVLRVDAEGNKRVDEEVDFVVVDGEVVQGQFWEMK*
Ga0137313_103032923300011403SoilLALFRVSAKKGNKPKVVRVDTEGNRRTEEENEFIVVDGTTVEGKFWELA*
Ga0137381_1161287313300012207Vadose Zone SoilKPLALFRVSAKKGNKPTAVRVDTEGNKRQNEEMDFIVVDGQVVEGQYWEMK*
Ga0137379_1019892023300012209Vadose Zone SoilLFRVSAKKDNKPKVVRVDAEGNKRTEEENEFVVVDGAAIEGKFWELT*
Ga0150985_12220297813300012212Avena Fatua RhizosphereVRKKGNNPKVLRIDTEGNKRTDEETDFVVVDGSAIEGKYWEFA*
Ga0137387_1051515713300012349Vadose Zone SoilRVSAKKGNKPKVVRVDAEGNKRTEEENGFVVVDGAAIEGKFWELT*
Ga0137385_1046694413300012359Vadose Zone SoilNKLKVVRIDVEGNKRTEEENEFVVVDEATIEGKF*
Ga0150984_12110350023300012469Avena Fatua RhizosphereETPLALFRVSSKKGNKPKVLRVDTDGNKRTDEEIDYVVVDGETVEGKFWEFA*
Ga0157356_101858613300012474Unplanted SoilKVVRVDAEGNRRQDEEIDFIVVDGQVVEGQYWEMK*
Ga0157331_100239913300012486SoilPLALFRVNAKKGNKPKVVRVDAEGNKRVDEEIDFIVVDGEVVEGQFWEMK*
Ga0157303_1024718823300012896SoilFRVNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEVVEGQFWEMK*
Ga0137410_1125403123300012944Vadose Zone SoilGNKSKVVRVDTEGNRRTEEENEFIVVDGTTVEGKFWELS*
Ga0134076_1012852913300012976Grasslands SoilLLRVSAKKDNKPKVVRVDAEGNKRTEEENEFVVVDGAAIEGKFWELT*
Ga0075323_117496623300014301Natural And Restored WetlandsYYFASTGDRPLALFRVSAKKGNKPKVLRVDNEGNKRTDEEVDFVVVDGQVVDGQFWEMK*
Ga0180094_104119323300014881SoilSAKKGNKPKAVRVDTEGNRRVNEEMDFIVVDGQVVEGQYWELT*
Ga0180086_115296613300014883SoilTGDTPLALFRVSAKKGNKPKVLRVDNEGNKRTDEEVDFVVVDGQVVDGQFWEMK*
Ga0173478_1085718913300015201SoilNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGKVVEGQFWEMK*
Ga0134072_1003517523300015357Grasslands SoilKDNKPKVVRVDAEGNKRTEEENEFVVVDRAAIEGKFWELT*
Ga0132256_10249084323300015372Arabidopsis RhizosphereLFRVSAKKGNKPKVVRVDAEGNRRQDEEIDFIVVDGQVVEGQYWEMK*
Ga0182035_1017106633300016341SoilAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEIVEGQFWEMK
Ga0134083_1013300923300017659Grasslands SoilYYFQSTGDKPLALFRVSAKKGNKPKAVRVDAEGNRRTDEEVDFVVVDGQVVEGQYWEFK
Ga0187775_1015239413300017939Tropical PeatlandNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEVVDGQFWELK
Ga0187788_1015526413300018032Tropical PeatlandALFRVNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEVVDGQFWELK
Ga0184638_110163423300018052Groundwater SedimentLFRVSAKKGNKPKVIRVDAEGNKRLDEEIDFVVVDGQVVEGQFWEMK
Ga0184635_1038780713300018072Groundwater SedimentKGNKPKAVRVDTEGNRRTEEENEFIVVDGTTVEGKFWELS
Ga0184609_1016539023300018076Groundwater SedimentLALFRVSAKKGNKPKVIRVDAEGNKRLDEEIDFVVVDGQVVEGQFWEKK
Ga0184612_1038868023300018078Groundwater SedimentALFRVNAKKGNKPKVVRVDAEGNRRLDEEIDFIVVDGAVVEGQFWEMK
Ga0190265_1117199013300018422SoilRPLALFRVSAKKGTTPKVLRIDSEVNKRTDEEIDFVVVDGETIDGKFWELT
Ga0190265_1376554223300018422SoilASTGDRPLALFRVSAKKGNKPKVLRVDNEGNKRTDEEVDFVVVDGQVVDGQFWEMK
Ga0190273_1182792223300018920SoilLFRVSAKKGNKPKVLRVDSEGNKRTDEEVDFVVVDGQIVEGQYWEMK
Ga0173481_1046834923300019356SoilYFASTGDVPLPLFRVNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEVVEGQFWEMK
Ga0190264_1150390023300019377SoilKVLRVDSEGNKRTDEEIDFVVVDGETVEGKFWELT
Ga0212128_1026929213300022563Thermal SpringsYFHSTGDKPLALFRVSAKTGAKPKVVRVDTEGNKRTDEEIDFVVVDGQVVEGKFWQLT
Ga0247745_104721913300022898SoilALFRVNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGKVVEGQFWEMK
Ga0209172_1027153013300025310Hot Spring SedimentTGDKPLALFRVSAKKGNKPKVVRVDAEGNRRTDEEIDFIVVDGQVVEGQFWELT
Ga0209520_1078036123300025319SoilKPKVLRVDNEGHQRTDEEVDFVVVDGQVVEGQFWELK
Ga0210061_102632023300025537Natural And Restored WetlandsRVSAKKGNKPKVLRVDNEGNKRTDEEVDFVVVDGQVVDGQFWEMK
Ga0207646_1022880913300025922Corn, Switchgrass And Miscanthus RhizosphereALFRVNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEVVQGQYWEMK
Ga0207681_1100056813300025923Switchgrass RhizospherePKVVRVDAEGNKRLDEEIDFIVVDGEVVEGQFWEMK
Ga0207701_1036871223300025930Corn, Switchgrass And Miscanthus RhizosphereKPKVLRVDSEGNKRTDEEIDFVVVDGETVEGKFWELS
Ga0207704_1139711613300025938Miscanthus RhizosphereNKPKVLRVDSEGNKRTDEEVDFVVVDGQIVEGQYWEMK
Ga0210116_105940623300025959Natural And Restored WetlandsFQNTGEGPLALLRVSAKKGTKPKVVRVDTEGNRRTEEENEFIVVDGTTVEGKFWELG
Ga0207651_1068601913300025960Switchgrass RhizosphereGDVPLALFRVNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEVVEGQFWEMK
Ga0207708_1083467233300026075Corn, Switchgrass And Miscanthus RhizosphereLALFRVSAKKGNKPKVLRVDSEGNKRTDEEVDFVVVDGQIVEGQYWEMK
Ga0209470_122262223300026324SoilFRVSAKKGNKPKVVRVDAEGNKRTEEENEFVVVDGAAIEGKFWELT
Ga0209156_1014519713300026547SoilDKPLALFRVSAKKGNKPKVVRVDAEGNKRTEEENEFVVVDGAAIEGKFWELT
Ga0209474_1019893123300026550SoilKDNKPKGVRVDAEGNKRTEEENGFVVVDGAAIEGKFWELT
Ga0209684_100348133300027527Tropical Forest SoilLALFRVSAKKGNKPKVVRIDAEGNRRQDEEIDFIVVDGEVVEGQYWEMK
Ga0209488_1063352413300027903Vadose Zone SoilYYFASTGDKPLALFRVSAKKGNKPKVVRVDAEGNRRQDEEIDFIVVDGQVVEGQYWEMK
Ga0299907_1083270323300030006SoilKVLRVDNEGNKRTDEEVNFVVVDGQVVEGQFWEMK
Ga0268386_1028609913300030619SoilYYYFQSTGEKPLALFRVSAKKGNKPKVLRVDNEGHQRTDEEVDFVVVDGQVVEGQFWELK
Ga0299914_1051366123300031228SoilSAKKGNKPKVLRVDSEGNKRTDEEVDFVVVDGQVVEGQFWEMK
Ga0310888_1110695113300031538SoilQSTGDRPLALFRVSAKKGTKPKVLRVDSEGNKRTDEEIDFVVVDGETVEGKFWELS
Ga0306926_1164138613300031954SoilQSTGDKPLALFRVSAKKGNKPKVARIDSEGNKRVDEEIDFVVVDGQIVEGKFWELA
Ga0326597_1207499023300031965SoilGDIPLALFRVSAKKGAKPKAVRVDTEGNRRANEEMDFIVVDGQVVEGQYWEMK
Ga0307411_1034264213300032005RhizospherePLALFRVSAKKGTKPKVLRVDSEGNKRTDEEIDFVVVDGETVEGKFWELS
Ga0310890_1167579813300032075SoilSTGDVPLALFRVNAKKGNKPKVVRVDAEGNKRVDEEIDFIVVDGEVVEGQFWEMK
Ga0307471_10014284753300032180Hardwood Forest SoilGEVPLALFRVNAKKGNKPKVVRVDAEGNKRLDEEIDFIVVDGEVVQGQYWEMK
Ga0335084_1065941313300033004SoilYYYFASTGDQPLALFRVSAKKGNNPKVVRVDTEGNRRTDEENEFIVVDGSTVEGKYWEMT
Ga0316624_1051897523300033486SoilFASTGEVPLALFRVNAKKGNKPKVVRVDSEGNRRTDEEIDFVVVDGEVVEGQFWEMK
Ga0364923_0054479_17_1513300034690SedimentVSAKKGNKPKAVRVDTEGNRRANEEMDFIVVDGQVVEGQFWEMK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.