Metagenome / Metatranscriptome Family F084897

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F084897
Family Type	Metagenome / Metatranscriptome
Number of Sequences	112
Average Sequence Length	48 residues
Representative Sequence	MAKSDAFAKTSKKRFEVADASEVKLGVGGTFKAEQIGTLGINSGNVE
Number of Associated Samples	74
Number of Associated Scaffolds	112

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	91.74 %
% of genes near scaffold ends (potentially truncated)	12.50 %
% of genes from short scaffolds (< 2000 bps)	56.25 %
Associated GOLD sequencing projects	59
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (91.071 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (41.071 % of family members)
Environment Ontology (ENVO)	Unclassified (62.500 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (67.857 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 30.67% β-sheet: 8.00% Coil/Unstructured: 61.33%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.16
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.16
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 112 Family Scaffolds
PF01238	PMI_typeI_C	12.50
PF13335	Mg_chelatase_C	5.36
PF00753	Lactamase_B	3.57
PF01321	Creatinase_N	2.68
PF00294	PfkB	1.79
PF00162	PGK	1.79
PF04055	Radical_SAM	1.79
PF02397	Bac_transf	1.79
PF13385	Laminin_G_3	1.79
PF10672	Methyltrans_SAM	1.79
PF00534	Glycos_transf_1	0.89
PF02775	TPP_enzyme_C	0.89
PF11412	DsbC	0.89
PF03649	UPF0014	0.89
PF02646	RmuC	0.89
PF00251	Glyco_hydro_32N	0.89
PF04773	FecR	0.89
PF02463	SMC_N	0.89
PF01029	NusB	0.89
PF01634	HisG	0.89
PF02806	Alpha-amylase_C	0.89
PF02195	ParBc	0.89
PF01026	TatD_DNase	0.89
PF00005	ABC_tran	0.89
PF12706	Lactamase_B_2	0.89
PF13398	Peptidase_M50B	0.89
PF12679	ABC2_membrane_2	0.89
PF02811	PHP	0.89
PF13416	SBP_bac_8	0.89
PF12675	DUF3795	0.89
PF01547	SBP_bac_1	0.89
PF13899	Thioredoxin_7	0.89
PF12836	HHH_3	0.89
PF00210	Ferritin	0.89
PF13505	OMP_b-brl	0.89
PF03851	UvdE	0.89
PF13193	AMP-binding_C	0.89
PF01797	Y1_Tnp	0.89
PF06283	ThuA	0.89
PF10142	PhoPQ_related	0.89
PF00849	PseudoU_synth_2	0.89

COG ID	Name	Functional Category	% Frequency in 112 Family Scaffolds
COG1482	Mannose-6-phosphate isomerase, class I	Carbohydrate transport and metabolism [G]	12.50
COG0006	Xaa-Pro aminopeptidase	Amino acid transport and metabolism [E]	2.68
COG0126	3-phosphoglycerate kinase	Carbohydrate transport and metabolism [G]	1.79
COG2148	Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)	Cell wall/membrane/envelope biogenesis [M]	1.79
COG0040	ATP phosphoribosyltransferase	Amino acid transport and metabolism [E]	0.89
COG0296	1,4-alpha-glucan branching enzyme	Carbohydrate transport and metabolism [G]	0.89
COG0366	Glycosidase/amylase (phosphorylase)	Carbohydrate transport and metabolism [G]	0.89
COG0390	ABC-type iron transport system FetAB, permease component	Inorganic ion transport and metabolism [P]	0.89
COG0564	Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific	Translation, ribosomal structure and biogenesis [J]	0.89
COG1187	Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605	Translation, ribosomal structure and biogenesis [J]	0.89
COG1322	DNA anti-recombination protein (rearrangement mutator) RmuC	Replication, recombination and repair [L]	0.89
COG1523	Pullulanase/glycogen debranching enzyme	Carbohydrate transport and metabolism [G]	0.89
COG1621	Sucrose-6-phosphate hydrolase SacC, GH32 family	Carbohydrate transport and metabolism [G]	0.89
COG1943	REP element-mobilizing transposase RayT	Mobilome: prophages, transposons [X]	0.89
COG2152	Predicted glycosyl hydrolase, GH43/DUF377 family	Carbohydrate transport and metabolism [G]	0.89
COG3507	Beta-xylosidase	Carbohydrate transport and metabolism [G]	0.89
COG4294	UV DNA damage repair endonuclease	Replication, recombination and repair [L]	0.89
COG4813	Trehalose utilization protein	Carbohydrate transport and metabolism [G]	0.89

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	91.96 %
Unclassified	root	N/A	8.04 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	91.96 %
Unclassified	root	N/A	8.04 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	91.07 %
Unclassified	root	N/A	8.04 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.89 %

Name	Rank	Taxonomy	Distribution
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	52.68 %
Unclassified	root	N/A	8.04 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.89 %

Name	Rank	Taxonomy	Distribution
Lentisphaerae	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae	16.07 %
Unclassified	root	N/A	8.04 %
Fungi	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	0.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.89 %

Name	Rank	Taxonomy	Distribution
unclassified Lentisphaerota	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota	16.07 %
Unclassified	root	N/A	8.04 %
Dikarya	subkingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	0.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.89 %

Name	Rank	Taxonomy	Distribution
Lentisphaerota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	15.18 %
Unclassified	root	N/A	8.04 %
Lentisphaerae bacterium RIFOXYA12_FULL_48_11	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	0.89 %
Ascomycota	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota	0.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.89 %

Name	Rank	Taxonomy	Distribution
Lentisphaerota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	15.18 %
Unclassified	root	N/A	8.04 %
saccharomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta	0.89 %
Lentisphaerae bacterium RIFOXYA12_FULL_48_11	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	0.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.89 %

Name	Rank	Taxonomy	Distribution
Lentisphaerota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	15.18 %
Unclassified	root	N/A	8.04 %
Pezizomycotina	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	0.89 %
Lentisphaerae bacterium RIFOXYA12_FULL_48_11	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	0.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.89 %

Name	Rank	Taxonomy	Distribution
Lentisphaerota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	15.18 %
Unclassified	root	N/A	8.04 %
leotiomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta	0.89 %
Lentisphaerae bacterium RIFOXYA12_FULL_48_11	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	0.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.89 %

Name	Rank	Taxonomy	Distribution
Lentisphaerota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	15.18 %
Unclassified	root	N/A	8.04 %
sordariomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta	0.89 %
Lentisphaerae bacterium RIFOXYA12_FULL_48_11	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	0.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.89 %

Name	Rank	Taxonomy	Distribution
Lentisphaerota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	15.18 %
Unclassified	root	N/A	8.04 %
Sordariomycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes	0.89 %
Lentisphaerae bacterium RIFOXYA12_FULL_48_11	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	0.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.89 %

Name	Rank	Taxonomy	Distribution
Lentisphaerota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	15.18 %
Unclassified	root	N/A	8.04 %
Hypocreomycetidae	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae	0.89 %
Lentisphaerae bacterium RIFOXYA12_FULL_48_11	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	0.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.89 %

Name	Rank	Taxonomy	Distribution
Lentisphaerota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	15.18 %
Unclassified	root	N/A	8.04 %
Microascales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Microascales	0.89 %
Lentisphaerae bacterium RIFOXYA12_FULL_48_11	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	0.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.89 %

Name	Rank	Taxonomy	Distribution
Lentisphaerota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	15.18 %
Unclassified	root	N/A	8.04 %
Ceratocystidaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Microascales → Ceratocystidaceae	0.89 %
Lentisphaerae bacterium RIFOXYA12_FULL_48_11	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	0.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.89 %

Name	Rank	Taxonomy	Distribution
Lentisphaerota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	15.18 %
Unclassified	root	N/A	8.04 %
Thielaviopsis	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Microascales → Ceratocystidaceae → Thielaviopsis	0.89 %
Lentisphaerae bacterium RIFOXYA12_FULL_48_11	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	0.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.89 %

Name	Rank	Taxonomy	Distribution
Lentisphaerota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	15.18 %
Unclassified	root	N/A	8.04 %
Thielaviopsis punctulata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Microascales → Ceratocystidaceae → Thielaviopsis → Thielaviopsis punctulata	0.89 %
Lentisphaerae bacterium RIFOXYA12_FULL_48_11	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	0.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.89 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2149837010\|_GVICOHK01ESB41	All Organisms → cellular organisms → Bacteria → PVC group	533	Open in IMG/M
3300001682\|SAHD_10000881	All Organisms → cellular organisms → Bacteria	60469	Open in IMG/M
3300001813\|JGI24123J20310_1014340	All Organisms → cellular organisms → Bacteria	1127	Open in IMG/M
3300002168\|JGI24712J26585_10095519	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	1018	Open in IMG/M
3300002173\|JGI24709J26583_10098888	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	948	Open in IMG/M
3300002220\|MLSBCLC_10597031	All Organisms → cellular organisms → Bacteria → PVC group	645	Open in IMG/M
3300002378\|JGI24502J29692_10076089	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	615	Open in IMG/M
3300002392\|JGI24503J29689_10078398	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	524	Open in IMG/M
3300002898\|draft_10051012	All Organisms → cellular organisms → Bacteria	3658	Open in IMG/M
3300003667\|LSCM3L_1034251	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	790	Open in IMG/M
3300004154\|Ga0066603_10151341	All Organisms → cellular organisms → Bacteria → PVC group	1034	Open in IMG/M
3300004154\|Ga0066603_10196796	All Organisms → cellular organisms → Bacteria → PVC group	909	Open in IMG/M
3300004238\|Ga0066635_10201770	All Organisms → cellular organisms → Bacteria → PVC group	930	Open in IMG/M
3300004628\|Ga0070399_1031899	All Organisms → cellular organisms → Bacteria → PVC group	2424	Open in IMG/M
3300006033\|Ga0075012_10000695	All Organisms → cellular organisms → Bacteria	35231	Open in IMG/M
3300006033\|Ga0075012_10033486	All Organisms → cellular organisms → Bacteria	4262	Open in IMG/M
3300006033\|Ga0075012_10047134	All Organisms → cellular organisms → Bacteria	3493	Open in IMG/M
3300006033\|Ga0075012_10047993	All Organisms → cellular organisms → Bacteria	3455	Open in IMG/M
3300006033\|Ga0075012_10088545	All Organisms → cellular organisms → Bacteria	2382	Open in IMG/M
3300006033\|Ga0075012_10093524	All Organisms → cellular organisms → Bacteria	2303	Open in IMG/M
3300006033\|Ga0075012_10101136	All Organisms → cellular organisms → Bacteria → PVC group	2193	Open in IMG/M
3300006033\|Ga0075012_10362988	All Organisms → cellular organisms → Bacteria → PVC group	966	Open in IMG/M
3300006033\|Ga0075012_10573205	All Organisms → cellular organisms → Bacteria → PVC group	714	Open in IMG/M
3300006595\|Ga0079080_1192812	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	677	Open in IMG/M
3300006600\|Ga0079065_1367511	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	559	Open in IMG/M
3300008002\|Ga0100390_10126722	All Organisms → cellular organisms → Bacteria	1482	Open in IMG/M
3300008086\|Ga0100388_10390119	All Organisms → cellular organisms → Bacteria → PVC group	659	Open in IMG/M
3300009175\|Ga0073936_10002064	All Organisms → cellular organisms → Bacteria	30242	Open in IMG/M
3300009652\|Ga0123330_1091361	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	1195	Open in IMG/M
3300009655\|Ga0116190_1001747	All Organisms → cellular organisms → Bacteria	18269	Open in IMG/M
3300009656\|Ga0123329_1091425	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	1216	Open in IMG/M
3300009659\|Ga0123328_1037333	All Organisms → cellular organisms → Bacteria → PVC group	2443	Open in IMG/M
3300009664\|Ga0116146_1015923	All Organisms → cellular organisms → Bacteria	4335	Open in IMG/M
3300009664\|Ga0116146_1020927	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	3572	Open in IMG/M
3300009664\|Ga0116146_1355483	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	545	Open in IMG/M
3300009666\|Ga0116182_1073502	All Organisms → cellular organisms → Bacteria	1811	Open in IMG/M
3300009666\|Ga0116182_1130810	All Organisms → cellular organisms → Bacteria → PVC group	1207	Open in IMG/M
3300009667\|Ga0116147_1002899	All Organisms → cellular organisms → Bacteria	16736	Open in IMG/M
3300009671\|Ga0123334_1045328	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	2550	Open in IMG/M
3300009690\|Ga0116143_10227637	All Organisms → cellular organisms → Bacteria → PVC group	989	Open in IMG/M
3300009692\|Ga0116171_10000261	All Organisms → cellular organisms → Bacteria	55935	Open in IMG/M
3300009692\|Ga0116171_10065931	All Organisms → cellular organisms → Bacteria	2279	Open in IMG/M
3300009692\|Ga0116171_10080827	All Organisms → cellular organisms → Bacteria → PVC group	2002	Open in IMG/M
3300009692\|Ga0116171_10609582	All Organisms → cellular organisms → Bacteria → PVC group	562	Open in IMG/M
3300009693\|Ga0116141_10596530	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	550	Open in IMG/M
3300009694\|Ga0116170_10001782	All Organisms → cellular organisms → Bacteria	21434	Open in IMG/M
3300009694\|Ga0116170_10155587	All Organisms → cellular organisms → Bacteria → PVC group	1388	Open in IMG/M
3300009694\|Ga0116170_10180097	All Organisms → cellular organisms → Bacteria → PVC group	1263	Open in IMG/M
3300009694\|Ga0116170_10295933	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	915	Open in IMG/M
3300009704\|Ga0116145_1003233	All Organisms → cellular organisms → Bacteria	13892	Open in IMG/M
3300009715\|Ga0116160_1058775	All Organisms → cellular organisms → Bacteria	1808	Open in IMG/M
3300009720\|Ga0116159_1080072	All Organisms → cellular organisms → Bacteria → PVC group	1550	Open in IMG/M
3300009773\|Ga0123333_10250592	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	754	Open in IMG/M
3300009780\|Ga0116156_10032176	All Organisms → cellular organisms → Bacteria	3544	Open in IMG/M
3300009782\|Ga0116157_10582486	Not Available	565	Open in IMG/M
3300010311\|Ga0116254_1010203	All Organisms → cellular organisms → Bacteria → PVC group	5534	Open in IMG/M
3300010347\|Ga0116238_10002474	All Organisms → cellular organisms → Bacteria	33408	Open in IMG/M
3300010352\|Ga0116247_10899403	All Organisms → cellular organisms → Bacteria → PVC group	651	Open in IMG/M
3300010356\|Ga0116237_10987932	All Organisms → cellular organisms → Bacteria → PVC group	707	Open in IMG/M
3300012886\|Ga0160425_1018929	All Organisms → cellular organisms → Bacteria → PVC group	2815	Open in IMG/M
(restricted) 3300013129\|Ga0172364_10754524	Not Available	601	Open in IMG/M
(restricted) 3300013137\|Ga0172375_10244307	All Organisms → cellular organisms → Bacteria → PVC group	1347	Open in IMG/M
3300014060\|Ga0119967_10078157	All Organisms → cellular organisms → Bacteria → PVC group	1990	Open in IMG/M
3300014203\|Ga0172378_10229516	All Organisms → cellular organisms → Bacteria → Proteobacteria	1459	Open in IMG/M
3300014206\|Ga0172377_10066923	All Organisms → cellular organisms → Bacteria	3351	Open in IMG/M
3300022555\|Ga0212088_10004438	All Organisms → cellular organisms → Bacteria	26795	Open in IMG/M
3300025036\|Ga0210049_1160504	All Organisms → cellular organisms → Bacteria → PVC group	1004	Open in IMG/M
3300025525\|Ga0208244_101370	All Organisms → cellular organisms → Bacteria	13515	Open in IMG/M
3300025613\|Ga0208461_1001526	All Organisms → cellular organisms → Bacteria	20660	Open in IMG/M
3300025613\|Ga0208461_1017546	All Organisms → cellular organisms → Bacteria	3233	Open in IMG/M
3300025677\|Ga0209719_1002559	All Organisms → cellular organisms → Bacteria	18562	Open in IMG/M
3300025677\|Ga0209719_1016772	All Organisms → cellular organisms → Bacteria → PVC group	3632	Open in IMG/M
3300025682\|Ga0209718_1006330	All Organisms → cellular organisms → Bacteria	8914	Open in IMG/M
3300025682\|Ga0209718_1119671	All Organisms → cellular organisms → Bacteria → PVC group	814	Open in IMG/M
3300025686\|Ga0209506_1061359	All Organisms → cellular organisms → Bacteria → PVC group	1285	Open in IMG/M
3300025708\|Ga0209201_1090536	All Organisms → cellular organisms → Bacteria → PVC group	1129	Open in IMG/M
3300025713\|Ga0208195_1026800	All Organisms → cellular organisms → Bacteria → PVC group	2793	Open in IMG/M
3300025713\|Ga0208195_1174763	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	684	Open in IMG/M
3300025713\|Ga0208195_1211484	All Organisms → cellular organisms → Bacteria → PVC group	590	Open in IMG/M
3300025842\|Ga0210054_1097579	All Organisms → cellular organisms → Bacteria → PVC group	1237	Open in IMG/M
3300025858\|Ga0209099_1000191	All Organisms → cellular organisms → Bacteria	70058	Open in IMG/M
3300025867\|Ga0209098_1018046	All Organisms → cellular organisms → Bacteria	4215	Open in IMG/M
3300025867\|Ga0209098_1024514	All Organisms → cellular organisms → Bacteria	3431	Open in IMG/M
3300025867\|Ga0209098_1094550	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Microascales → Ceratocystidaceae → Thielaviopsis → Thielaviopsis punctulata	1385	Open in IMG/M
3300025867\|Ga0209098_1201023	Not Available	820	Open in IMG/M
3300025867\|Ga0209098_1320147	Not Available	590	Open in IMG/M
3300025871\|Ga0209311_1159415	All Organisms → cellular organisms → Bacteria → PVC group	934	Open in IMG/M
3300027719\|Ga0209467_1041856	All Organisms → cellular organisms → Bacteria	1905	Open in IMG/M
3300027800\|Ga0209800_10283840	All Organisms → cellular organisms → Bacteria → PVC group	700	Open in IMG/M
3300027851\|Ga0209066_10000611	All Organisms → cellular organisms → Bacteria	51446	Open in IMG/M
3300027851\|Ga0209066_10001125	All Organisms → cellular organisms → Bacteria	36228	Open in IMG/M
3300027851\|Ga0209066_10008275	All Organisms → cellular organisms → Bacteria	10112	Open in IMG/M
3300027851\|Ga0209066_10011730	All Organisms → cellular organisms → Bacteria	7998	Open in IMG/M
3300027851\|Ga0209066_10106494	All Organisms → cellular organisms → Bacteria → PVC group	1838	Open in IMG/M
3300027851\|Ga0209066_10110689	All Organisms → cellular organisms → Bacteria	1792	Open in IMG/M
3300027851\|Ga0209066_10152875	All Organisms → cellular organisms → Bacteria → PVC group	1437	Open in IMG/M
3300027851\|Ga0209066_10261129	All Organisms → cellular organisms → Bacteria → PVC group	992	Open in IMG/M
3300028299\|Ga0268276_1005535	All Organisms → cellular organisms → Bacteria	8304	Open in IMG/M
(restricted) 3300028561\|Ga0255343_1041955	All Organisms → cellular organisms → Bacteria → PVC group	2419	Open in IMG/M
(restricted) 3300028561\|Ga0255343_1220437	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	720	Open in IMG/M
(restricted) 3300028567\|Ga0255342_1129899	All Organisms → cellular organisms → Bacteria → PVC group	1117	Open in IMG/M
3300028602\|Ga0265294_10004058	All Organisms → cellular organisms → Bacteria	18430	Open in IMG/M
3300028602\|Ga0265294_10418418	All Organisms → cellular organisms → Bacteria → PVC group	842	Open in IMG/M
3300028777\|Ga0302290_10157338	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium	599	Open in IMG/M
3300029989\|Ga0311365_10152256	All Organisms → cellular organisms → Bacteria	1988	Open in IMG/M
3300029989\|Ga0311365_11295188	Not Available	627	Open in IMG/M
3300030943\|Ga0311366_10647168	All Organisms → cellular organisms → Bacteria → PVC group	919	Open in IMG/M
3300031645\|Ga0307990_1007597	All Organisms → cellular organisms → Bacteria	7409	Open in IMG/M
3300034965\|Ga0370497_0138446	Not Available	603	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Engineered	Engineered	58.93%
Environmental	Environmental	41.07%

Habitat	Taxonomy	Distribution
Wastewater	Engineered → Wastewater	42.86%
Aquatic	Environmental → Aquatic	34.82%
Bioreactor	Engineered → Bioreactor	8.04%
Terrestrial	Environmental → Terrestrial	6.25%
Biotransformation	Engineered → Biotransformation	3.57%
Built Environment	Engineered → Built Environment	2.68%
Solid Waste	Engineered → Solid Waste	0.89%
Unclassified	Engineered → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	41.07%
Freshwater	Environmental → Aquatic → Freshwater	33.04%
Anaerobic	Engineered → Bioreactor → Anaerobic	8.04%
Peat	Environmental → Terrestrial → Peat	3.57%
Mixed Alcohol Bioreactor	Engineered → Biotransformation → Mixed Alcohol Bioreactor	3.57%
Water Treatment Plant	Engineered → Built Environment → Water Treatment Plant	2.68%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.79%
Marine	Environmental → Aquatic → Marine	0.89%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	0.89%
Soil	Environmental → Terrestrial → Soil	0.89%
Landfill	Engineered → Solid Waste → Landfill	0.89%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.89%
Nutrient Removal	Engineered → Wastewater → Nutrient Removal	0.89%
Unclassified	Engineered → Unclassified → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	41.07%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	24.11%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified	8.04%
Lake	Environmental → Aquatic → Freshwater → Lake	3.57%
Pond	Environmental → Aquatic → Freshwater → Pond	3.57%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	3.57%
Unclassified	Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified	3.57%
Unclassified	Engineered → Built Environment → Water Treatment Plant → Unclassified	2.68%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.79%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.89%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.89%
Unclassified	Environmental → Aquatic → Marine → Unclassified	0.89%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	0.89%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.89%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified	0.89%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.89%
Dissolved Organics (Anaerobic)	Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic)	0.89%
Unclassified	Engineered → Unclassified → Unclassified → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	41.07%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	23.21%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified	8.04%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	3.57%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	3.57%
Unclassified	Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified	3.57%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	2.68%
Unclassified	Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified	2.68%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.79%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	0.89%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.89%
Coalbed Water	Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water	0.89%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.89%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	0.89%
Unclassified	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified	0.89%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.89%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified → Unclassified	0.89%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.89%
Activated Sludge	Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge	0.89%
Unclassified	Engineered → Unclassified → Unclassified → Unclassified → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	41.07%
Watersheds	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds	15.18%
Anaerobic Biogas Reactor	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor	6.25%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	3.57%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	3.57%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	3.57%
Biogas Fermentantion	Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion	3.57%
Aquifer	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer	2.68%
Wastewater	Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater	2.68%
Freshwater Lake Hypolimnion	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion	1.79%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	1.79%
Serpentinite Rock And Fluid	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid	1.79%
Bioreactor	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor	1.79%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.89%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.89%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.89%
Coalbed Water	Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water	0.89%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.89%
Marine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine	0.89%
Saline Water	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water	0.89%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.89%
Landfill Leachate	Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate	0.89%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	0.89%
Activated Sludge	Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Activated Sludge	0.89%
Biogas Fermenter	Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2149837010	Fresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from pre-bloom	Environmental	Open in IMG/M
3300001682	Cattle waste upflow reactor	Engineered	Open in IMG/M
3300001813	Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_5A	Environmental	Open in IMG/M
3300002168	Biogas fermentation microbial communities from Germany - Plant 3 DNA2	Engineered	Open in IMG/M
3300002173	Biogas fermentation microbial communities from Germany - Plant 2 DNA1	Engineered	Open in IMG/M
3300002220	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011	Engineered	Open in IMG/M
3300002378	Biogas fermentation microbial communities from Germany - Plant 3 RNA1 (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300002392	Biogas fermentation microbial communities from Germany - Plant 3 RNA2 (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300002898	Metagenome Biopara biogasfermenter May 2013 pooled	Engineered	Open in IMG/M
3300003667	Lithgow State Coal Mine Metagenomic Study (LSCM 3 Late (Sample 2))	Environmental	Open in IMG/M
3300004154	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8	Environmental	Open in IMG/M
3300004238	Groundwater microbial communities from aquifer - Crystal Geyser CG06_land_8/20/14_3.00	Environmental	Open in IMG/M
3300004628	Microbial communities from bioreactor (seeded with sewage sludge) at LBNL, California, USA - Biofuel metagenome 4 (version 1)	Engineered	Open in IMG/M
3300006033	Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15	Environmental	Open in IMG/M
3300006595	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gly_01_SludgeMetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300006600	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_01_SludgeMetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300008002	Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-14	Environmental	Open in IMG/M
3300008086	Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-12	Environmental	Open in IMG/M
3300009175	Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG	Environmental	Open in IMG/M
3300009607	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA	Engineered	Open in IMG/M
3300009652	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C13 SIP DNA	Engineered	Open in IMG/M
3300009655	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG	Engineered	Open in IMG/M
3300009656	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C12 SIP DNA	Engineered	Open in IMG/M
3300009659	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C12 SIP DNA	Engineered	Open in IMG/M
3300009664	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG	Engineered	Open in IMG/M
3300009666	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG	Engineered	Open in IMG/M
3300009667	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG	Engineered	Open in IMG/M
3300009671	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA	Engineered	Open in IMG/M
3300009690	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG	Engineered	Open in IMG/M
3300009692	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG	Engineered	Open in IMG/M
3300009693	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG	Engineered	Open in IMG/M
3300009694	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG	Engineered	Open in IMG/M
3300009704	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaG	Engineered	Open in IMG/M
3300009715	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG	Engineered	Open in IMG/M
3300009720	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG	Engineered	Open in IMG/M
3300009773	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B C12 SIP DNA	Engineered	Open in IMG/M
3300009780	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG	Engineered	Open in IMG/M
3300009782	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG	Engineered	Open in IMG/M
3300010311	AD_JPTRca	Engineered	Open in IMG/M
3300010347	AD_JPHGca	Engineered	Open in IMG/M
3300010352	AD_JPHWca	Engineered	Open in IMG/M
3300010356	AD_USDEca	Engineered	Open in IMG/M
3300012886	Microbial communities from bioreactor (seeded with sewage sludge) at Lawrence Berkeley National Lab, California, USA - Biofuel Metagenome 8 (Illumina Assembly)	Engineered	Open in IMG/M
3300013129 (restricted)	Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm	Environmental	Open in IMG/M
3300013137 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m	Environmental	Open in IMG/M
3300014060	Freshwater microbial communities from Crystal Geyser, Utah, USA - CG_3.0	Environmental	Open in IMG/M
3300014203	Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG	Environmental	Open in IMG/M
3300014206	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG	Engineered	Open in IMG/M
3300022555	Alinen_combined assembly	Environmental	Open in IMG/M
3300025036	Groundwater microbial communities from aquifer - Crystal Geyser CG06_land_8/20/14_3.00 (SPAdes)	Environmental	Open in IMG/M
3300025525	Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_5A (SPAdes)	Environmental	Open in IMG/M
3300025613	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025677	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025682	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025686	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025708	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025713	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025842	Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-16 (SPAdes)	Environmental	Open in IMG/M
3300025858	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025867	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025871	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG (SPAdes)	Engineered	Open in IMG/M
3300026250	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C12 SIP DNA (SPAdes)	Engineered	Open in IMG/M
3300027719	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 (SPAdes)	Environmental	Open in IMG/M
3300027800	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 (SPAdes)	Environmental	Open in IMG/M
3300027851	Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes)	Environmental	Open in IMG/M
3300028299	Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_45m	Environmental	Open in IMG/M
3300028561 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant16	Engineered	Open in IMG/M
3300028567 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant14	Engineered	Open in IMG/M
3300028602	Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3	Environmental	Open in IMG/M
3300028777	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_3	Environmental	Open in IMG/M
3300029989	III_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030943	III_Fen_N2 coassembly	Environmental	Open in IMG/M
3300031645	Marine microbial communities from Ellis Fjord, Antarctic Ocean - #129	Environmental	Open in IMG/M
3300034965	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
LBLPr_02244570	2149837010	Freshwater	MAKSDAFVETSKKRFEVADASEVKLGVGGTFKAEQVGTLGLNSGDVP
SAHD_1000088110	3300001682	Activated Sludge	MGKKKSDAFVKTSKKRFEVADASEVRLGVGGNFRAEQIGTLGGDSGDVQ*
JGI24123J20310_10143402	3300001813	Serpentinite Rock And Fluid	MAKSDAFVETSKSRFEVADASEVSLGVGGTFRAEQIGTLGVDSGGSN*
JGI24712J26585_100955191	3300002168	Biogas Fermentantion	MGKKKSDAFVKTSKKRFEVADASEVRLGVGGNFRAEQIGTLGX
JGI24709J26583_100988881	3300002173	Biogas Fermentantion	MGKKKSDAFVKTSKKRFEVADASEVRLGVGGNFRAEQIGTLGXVSGDVQ
MLSBCLC_105970312	3300002220	Hydrocarbon Resource Environments	MAKSDAFVETSKKRFEVAGANEVKLGVGGTFKAEQIGTLGINSGDVE*
JGI24502J29692_100760891	3300002378	Biogas Fermentantion	MGKKKSDAFVKTSKKRFEVADASEVRLGVGGNFRAEQIGTLGAASGNVQ*
JGI24503J29689_100783981	3300002392	Biogas Fermentantion	WTMGKKKSDAFVKTSKKRFEVADASEVRLGVGGNFRAEQIGTLGGSGNVE*
draft_100510122	3300002898	Biogas Fermenter	MGKKKSDAFVKTSKKRFEVADASEVRLGVGGNFRAEQIGTLGAASGNVE*
LSCM3L_10342511	3300003667	Coalbed Water	MGRKKSDAFVKTSKKRFEVADASEVKLGVGGNFRAEQIGTLGGSGNVE*
Ga0066603_101513412	3300004154	Freshwater	MAKSDAFAATSKKRFEVADASEVKLGVGGTFKAEQIGTLGTNSGLLE*
Ga0066603_101967962	3300004154	Freshwater	MAKSDAFVATSKKRFEVAAANEVKLGVGGTFKAEQVGTLGINSGTVE*
Ga0066635_102017701	3300004238	Groundwater	RLFMAKSEAFVETAKERFEVADASEVKLGVGGTFKAEQVGTLGTDSSQIQ*
Ga0070399_10318992	3300004628	Bioreactor	MAKSDAFAETSKARFEVATAQEVNLGVGGSFKAAEIGVLGTSGGLND*
Ga0075012_1000069517	3300006033	Watersheds	MAKSDAFVETSKKRFEVADAREVKLGVGGTFKAEQVGTLGINSGDIE*
Ga0075012_100334863	3300006033	Watersheds	MSKSDAFADTSKQRFEVADATEVKLGLGGNFKAEQIGTLGMSEGNIQ*
Ga0075012_100471341	3300006033	Watersheds	MAKSDAFADTSKQRFEVADAPEVKLGLGGNFKAEQIGTLGISDGNAV*
Ga0075012_100479933	3300006033	Watersheds	MAKSDAFVETSKKRFEVADASEVKLGVGGTFKAEQVGTLGINSGDVP*
Ga0075012_100885452	3300006033	Watersheds	MAKSDAFADTSKQRFEVADATEVKLGLGGNFKAEQIGTLGISGGEGNVE*
Ga0075012_100935243	3300006033	Watersheds	MAKSDAFVATSKKRFEVADASEVKLGVGGTFKAEQIGTLGTNSGLLE*
Ga0075012_101011362	3300006033	Watersheds	MAKSDAFVESSRKRFEVADASEVKLGLGGTFKAEQIGTLGADSGALE*
Ga0075012_103629881	3300006033	Watersheds	MAKSDAFVATSKQRFEVADASEVKLGVGGTFKAEQIGTLGTNSGLLE*
Ga0075012_105732052	3300006033	Watersheds	MAKSDAFVETSKKRFEVADASEVKLGVGGTFKAEQVGTLGINSGDVE*
Ga0079080_11928122	3300006595	Anaerobic Digestor Sludge	MAKSDAFAKTSKKRFEVADASEVKLGVGGTFKAEQIGTLGINSGNVE*
Ga0079065_13675112	3300006600	Anaerobic Digestor Sludge	IMAKSDAFAKTSKKRFEVADASEVKLGVGGTFKAEQIGTLGINSGNVE*
Ga0100390_101267222	3300008002	Aquifer	MAKSEAFVETAKERFEVADASEVKLGVGGTFKAEQVGTLGTDSSQIP*
Ga0100388_103901192	3300008086	Aquifer	MAKSEAFVETSKERFEVADASEVKLGVGGTFKAEQVGTLGTDSSQIP*
Ga0073936_1000206410	3300009175	Freshwater Lake Hypolimnion	MAKSDAFVETSKQRFEVAAASDVNLGLGGTFKAEQIGTLGVDSGNNP*
Ga0123327_11996172	3300009607	Anaerobic Biogas Reactor	TSKKRFEVADASEVKLGVGGTFKAEQIGTLGINSGNVE*
Ga0123330_10913612	3300009652	Anaerobic Biogas Reactor	MGRFFSERWTMGKKKSDAFVKTSKKRFEVADASEVRLGVGGNFRAEQIGTLGGISGDVQ*
Ga0116190_100174712	3300009655	Anaerobic Digestor Sludge	MAKSDAFAKTSKKRFEVAEANEIKLGLGGNFRAEQIGTLGISGGEGNVE*
Ga0123329_10914251	3300009656	Anaerobic Biogas Reactor	MGRFFSERWTMGKKKSDAFVKTSKKRFEVADASEVRLGVGGNFRAEQIGTLGGVSGDVQ*
Ga0123328_10373333	3300009659	Anaerobic Biogas Reactor	MGRFFSERWTMGKKKSDAFVKTSKKRFEVADASEVRLGVGGNFRAEQIGTLGGVSGDVE*
Ga0116146_10159236	3300009664	Anaerobic Digestor Sludge	MAKSDAFAATSKERFEVGQAKEVKLGLGGSFAAEQIGTLGVNSGNVE*
Ga0116146_10209272	3300009664	Anaerobic Digestor Sludge	MGRKKSDSFVKTSKKRFDVADASEVKLGVGGNFRAEQIGTLGGSGNLE*
Ga0116146_13554832	3300009664	Anaerobic Digestor Sludge	MGKKKSDAFVKTSKKRFEVADASEVRLGVGGNFRAEQIGTLGGSGNVE*
Ga0116182_10735021	3300009666	Anaerobic Digestor Sludge	MGRKKSDAFVKTSKKRFEVADASEVKLGVGGNFRAEQIGTLGGSGNVD*
Ga0116182_11308102	3300009666	Anaerobic Digestor Sludge	MANSDQFVETSKKRFEVADASEVKLGLGGNFKAESIGTLGIDSQNFS*
Ga0116147_100289912	3300009667	Anaerobic Digestor Sludge	MAKSDAFAKTSKKRFEVAEANEIKLGLGGNFRAEQIGTLGISGG
Ga0123334_10453282	3300009671	Anaerobic Biogas Reactor	MAKSDAFEITSKKRFEVAEASEIKLGLGGNFKAEGIGTLGMNSGNE*
Ga0116143_102276372	3300009690	Anaerobic Digestor Sludge	MAKSDAFAKTSKKRFEVADASEVKLGVGGTFKAEQIGTLGINSGNVK*
Ga0116171_1000026132	3300009692	Anaerobic Digestor Sludge	MAKSDAFVATSKKRFEVAAANEVKLGVGGTFKAEQVGTLGINSGSVE*
Ga0116171_100659312	3300009692	Anaerobic Digestor Sludge	MAKSDAFVETSKKRFEVADAHEVKLGVGGTFKAEQIGTLGVNSGMVP*
Ga0116171_100808272	3300009692	Anaerobic Digestor Sludge	MANSDTFAETSKQRFEVANASEVNLGLGGTFKAEQVGTLGVNSAGVE*
Ga0116171_106095821	3300009692	Anaerobic Digestor Sludge	MAKSDAFVATSKKRFEVADANEVKLGVGGNFKAEQIGTLGISDGKIE*
Ga0116141_105965301	3300009693	Anaerobic Digestor Sludge	MGRKKSDAFVKTSKKRFEVADASEVKLGVGGNFRAEQIGTLGGTPGTGVE*
Ga0116170_100017822	3300009694	Anaerobic Digestor Sludge	MAKSDAFVETSKKRFEVADAHEVKLGVGGTFKAEQIGTLGTNSGMVE*
Ga0116170_101555872	3300009694	Anaerobic Digestor Sludge	MANSDAFAETSKQRFEIASASEVNLGLGGTFKAEQVGTLVASGGVE*
Ga0116170_101800972	3300009694	Anaerobic Digestor Sludge	MAKSDAFSASSKQRFEVADASEVKLGLGGTFKAEQIGTLGVNSGNVE*
Ga0116170_102959331	3300009694	Anaerobic Digestor Sludge	MAKSDAFAETSKQRFEVANASEVKLGLGGAFKGTQVGTLATSGGLVDE*
Ga0116145_10032333	3300009704	Anaerobic Digestor Sludge	MAKSDAFAKTSKKRFEVAEANEIKLGLGGNFRAEQIGTLGISGGKGNVE*
Ga0116160_10587752	3300009715	Anaerobic Digestor Sludge	MGRKKSDAFVKTSKKRFEVADASEVKLGVGGNFRAEQIGTLGGSDNVE*
Ga0116159_10800723	3300009720	Anaerobic Digestor Sludge	MAKSDKFVETSKKRFEVADASEVKLGLGGNFKAESVGTFGFSGGGIG*
Ga0123333_102505922	3300009773	Anaerobic Biogas Reactor	MGRFFSERWTMGKKKSDAFVKTSKKRFEVADASEVRLGVGGNFRAEQIGTLGAASGNVQ*
Ga0116156_100321764	3300009780	Anaerobic Digestor Sludge	MAKSDAFAKTSKKRFEVADASEVKLGVGGTFKAEQIGTLGLNSGNVE*
Ga0116157_105824862	3300009782	Anaerobic Digestor Sludge	MAKSDAFVETAKERFEVAEAKDVKLGLGGTFKAEQVGTLGVDSGTVP*
Ga0116254_10102034	3300010311	Anaerobic Digestor Sludge	MGKKKSDAFVKTSKKRFEVADASEVRLGVGGNFRAEQIGTLGGTGGNIE*
Ga0116238_1000247410	3300010347	Anaerobic Digestor Sludge	MAKSDAFAKTSKKRFEVAEANEIKLGLGGNFRAEQIGTLGISGGEGNAE*
Ga0116247_108994032	3300010352	Anaerobic Digestor Sludge	EITRWFMANSDAFAETSKQRFEIASASEVNLGLGGTFKAEQVGTLVASGGVE*
Ga0116237_109879322	3300010356	Anaerobic Digestor Sludge	MAKSDAFAETSKKRFEVAEASEVKLGLGGTFTAEQIGTLGINSGNVE*
Ga0160425_10189292	3300012886	Bioreactor	MAKSDAFAETSKARFEVATAQEVNLGVGGSFKAAEIGVLGTSGGGLKD*
(restricted) Ga0172364_107545241	3300013129	Sediment	MAKSDAFAETSKERFEIADASEVKLGLGGTFTAGQVGTLGVDSGKVTD*
(restricted) Ga0172375_102443071	3300013137	Freshwater	MAKSDAFATTSKQRFEVAQASEVKLGLGGSFTAEQIGTLGVNSGNVE*
Ga0119967_100781572	3300014060	Freshwater	MAKSEAFVETAKERFEVADASEVKLGVGGTFKAEQVGTLGTDSSQIQ*
Ga0172378_102295161	3300014203	Groundwater	MAKSDAFAKTSKKRFEVADASEVKLGVGGTFKAEQIGTL
Ga0172378_102316583	3300014203	Groundwater	TSKKRFEVADASEVKLGVGGTFKAEQIGTLGINSGNVK*
Ga0172377_100669234	3300014206	Landfill Leachate	MADSDQFVETSKKRFEVADASEVKLGLGGNFKAESIGTLGLGSGELN*
Ga0212088_1000443815	3300022555	Freshwater Lake Hypolimnion	MAKSDAFVETSKQRFEVAAASDVNLGLGGTFKAEQIGTLGVDSGNNP
Ga0210049_11605042	3300025036	Groundwater	MAKSEAFVETAKERFEVADASEVKLGVGGTFKAEQVGTLGTDSSQIQ
Ga0208244_1013708	3300025525	Serpentinite Rock And Fluid	MAKSDAFVETSKSRFEVADASEVSLGVGGTFRAEQIGTLGVDSGGSN
Ga0208461_10015263	3300025613	Anaerobic Digestor Sludge	MAKSDAFAKTSKKRFEVAEANEIKLGLGGNFRAEQIGTLGISGGEGNVE
Ga0208461_10175462	3300025613	Anaerobic Digestor Sludge	MGKKKSDAFVKTSKKRFEVADASEVRLGVGGNFRAEQIGTLGGTGGNIE
Ga0209719_10025595	3300025677	Anaerobic Digestor Sludge	MGRKKSDAFVKTSKKRFEVADASEVKLGVGGNFRAEQIGTLGGSDNVE
Ga0209719_10167722	3300025677	Anaerobic Digestor Sludge	MGRKKSDSFVKTSKKRFDVADASEVKLGVGGNFRAEQIGTLGGSGNLE
Ga0209718_10063302	3300025682	Anaerobic Digestor Sludge	MGRKKSDAFVKTSKKRFEVADASEVKLGVGGNFRAEQIGTLGGSGNVE
Ga0209718_11196712	3300025682	Anaerobic Digestor Sludge	MGWFMAKSDKFVETSKKRFEVADASEVKLGLGGNFKAESVGTFGFSGGGIG
Ga0209506_10613592	3300025686	Anaerobic Digestor Sludge	MAKSDAFAATSKERFEVGQAKEVKLGLGGSFAAEQIGTLGVNSGNVE
Ga0209201_10905361	3300025708	Anaerobic Digestor Sludge	TDGAYCAYTAFQILSERCTMAKSDAFAKTSKKRFEVADASEVKLGVGGTFKAEQIGTLGINSGNVE
Ga0208195_10268002	3300025713	Anaerobic Digestor Sludge	MGKKKSDAFVKTSKKRFEVADASEVRLGVGGNFRAEQIGTLGGVSGDVE
Ga0208195_11747631	3300025713	Anaerobic Digestor Sludge	MGRKKSDAFVKTSKKRFEVADASEVKLGVGGNFRAEQIGTLGGSGNVD
Ga0208195_12114841	3300025713	Anaerobic Digestor Sludge	MANSDQFVETSKKRFEVADASEVKLGLGGNFKAESIGTLGIDSQNL
Ga0210054_10975792	3300025842	Aquifer	MAKSEAFVETAKERFEVADASEVKLGVGGTFKAEQVGTLGTDSSQIP
Ga0209099_100019144	3300025858	Anaerobic Digestor Sludge	MAKSDAFVATSKKRFEVAAANEVKLGVGGTFKAEQVGTLGINSGSVE
Ga0209098_10180464	3300025867	Anaerobic Digestor Sludge	MANSDTFAETSKQRFEVANASEVNLGLGGTFKAEQVGTLGVNSAGVE
Ga0209098_10245144	3300025867	Anaerobic Digestor Sludge	WIMAKSDAFVETSKKRFEVADAHEVKLGVGGTFKAEQIGTLGTNSGMVE
Ga0209098_10945502	3300025867	Anaerobic Digestor Sludge	MAKSDAFSASSKQRFEVADASEVKLGLGGTFKAEQIGTLGVNSGNVE
Ga0209098_12010232	3300025867	Anaerobic Digestor Sludge	MAKSDAFAETSKQRFEVANASEVKLGLGGAFKGTQVGTLATSGGLVDE
Ga0209098_13201471	3300025867	Anaerobic Digestor Sludge	MANSDAFAETSKQRFEIASASEVNLGLGGTFKAEQVGTLGAGT
Ga0209311_11594152	3300025871	Anaerobic Digestor Sludge	MAKSDAFAKTSKKRFEVADASEVKLGVGGTFKAEQIGTLGLNSGNVE
Ga0209612_10304671	3300026250	Anaerobic Biogas Reactor	KRFEVADASEVKLGVGGTFKAEQIGTLGINSGNVE
Ga0209467_10418563	3300027719	Freshwater	MAKSDAFVATSKKRFEVAAANEVKLGVGGTFKAEQVGTLGINSGTVE
Ga0209800_102838402	3300027800	Freshwater	MAKSDAFAATSKKRFEVADASEVKLGVGGTFKAEQIGTLGTNSGLLE
Ga0209066_1000061131	3300027851	Watersheds	MSKSDAFADTSKQRFEVADATEVKLGLGGNFKAEQIGTLGMSEGNIQ
Ga0209066_1000112512	3300027851	Watersheds	MAKSDAFVETSKKRFEVADAREVKLGVGGTFKAEQVGTLGINSGDIE
Ga0209066_100082756	3300027851	Watersheds	MAKSDAFADTSKQRFEVADATEVKLGLGGNFKAEQIGTLGISGGEGNVE
Ga0209066_100117307	3300027851	Watersheds	MAKSDAFADTSKQRFEVADAPEVKLGLGGNFKAEQIGTLGISDGNAV
Ga0209066_101064942	3300027851	Watersheds	MAKSDAFVETSKKRFEVADASEVKLGVGGTFKAEQVGTLGINSGDVE
Ga0209066_101106892	3300027851	Watersheds	MAKSDAFVETSKKRFEVADASEVKLGVGGTFKAEQVGTLGINSGDVP
Ga0209066_101528751	3300027851	Watersheds	MAKSDAFVESSRKRFEVADASEVKLGLGGTFKAEQIGTLGADSGALE
Ga0209066_102611292	3300027851	Watersheds	MAKSDAFVATSKKRFEVADASEVKLGVGGTFKAEQIGTLGTNSGLLE
Ga0268276_10055352	3300028299	Saline Water	MAKSDAFAETSKKRFEVADASEVKLGLGGNFKAEQIGVLSIGSGDIE
(restricted) Ga0255343_10419553	3300028561	Wastewater	MGRKKSDSFVKTSKKRFDVADASEVKLGVGGNFRAEQIGTLGGSEGDLQ
(restricted) Ga0255343_12204372	3300028561	Wastewater	MGRKKSDAFVKTSKKRFEVADASEVKLGVGGNFRAEQIGTLGGTPGTGVE
(restricted) Ga0255342_11298992	3300028567	Wastewater	MGWFMAKSDKFVETSKKRFEVADACEVKLGLGGNFKAESVGTFGFSPIE
Ga0265294_100040586	3300028602	Groundwater	MAKSDAFAKTSKKRFEVADASEVKLGVGGTFKAEQIGTLGINSGNVK
Ga0265294_104184181	3300028602	Groundwater	MANSDQFVETSKKRFEVADASEVKLGLGGNFKAESIGTLGIDSQNFS
Ga0302290_101573382	3300028777	Fen	MAKSDAFAETSRQRFEVADASEVKLGVGGTFKAEQIGTLGSGTGIP
Ga0311365_101522563	3300029989	Fen	MVKSDAFAETSRQRFEVADASEVKLGVGGTFKAEQIGTLGSGTGIP
Ga0311365_112951881	3300029989	Fen	MAKSDAFVETSKQRFEVAAASEVKLGLGGTFKAEQVGTLGADSGTIP
Ga0311366_106471682	3300030943	Fen	MAKSDAFVETSKSRFELASANEVKLGLGGTFKAQQIGTLGVDSGNVE
Ga0307990_10075973	3300031645	Marine	MASKDTFAKSSKKRFEVAEASEVELGVGGTFKAEEVGVLGGSPGSGLEIP
Ga0370497_0138446_206_349	3300034965	Untreated Peat Soil	MAKSDAFAETSKQRLEVANASEVNLGVGGTFKAEQIGTLGVDSLNVP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters