NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F085324

Metagenome / Metatranscriptome Family F085324

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085324
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 36 residues
Representative Sequence MSMFRKVVLGAALVGLVAVLRKSVPDLARYFKIRQM
Number of Associated Samples 81
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 88.29 %
% of genes near scaffold ends (potentially truncated) 15.32 %
% of genes from short scaffolds (< 2000 bps) 80.18 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.495 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.820 % of family members)
Environment Ontology (ENVO) Unclassified
(28.829 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(31.532 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.56%    β-sheet: 0.00%    Coil/Unstructured: 48.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF01750HycI 33.33
PF01155HypA 32.43
PF01455HupF_HypC 16.22
PF01924HypD 7.21
PF02769AIRS_C 2.70
PF14659Phage_int_SAM_3 0.90
PF00586AIRS 0.90
PF07503zf-HYPF 0.90
PF00730HhH-GPD 0.90
PF01106NifU 0.90
PF14720NiFe_hyd_SSU_C 0.90
PF13580SIS_2 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG0680Ni,Fe-hydrogenase maturation factorEnergy production and conversion [C] 33.33
COG0375Hydrogenase maturation factor HypA/HybF, metallochaperone involved in Ni insertionPosttranslational modification, protein turnover, chaperones [O] 32.43
COG0298Hydrogenase maturation factor HybG, HypC/HupF familyPosttranslational modification, protein turnover, chaperones [O] 16.22
COG0409Hydrogenase maturation factor HypDPosttranslational modification, protein turnover, chaperones [O] 7.21
COG0068Hydrogenase maturation factor HypF (carbamoyltransferase)Posttranslational modification, protein turnover, chaperones [O] 0.90
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.90
COG0177Endonuclease IIIReplication, recombination and repair [L] 0.90
COG0694Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domainPosttranslational modification, protein turnover, chaperones [O] 0.90
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.90
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 0.90
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 0.90

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.50 %
UnclassifiedrootN/A4.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig1209951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia597Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0678292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia644Open in IMG/M
3300004016|Ga0058689_10119343All Organisms → cellular organisms → Bacteria → Terrabacteria group578Open in IMG/M
3300004016|Ga0058689_10180144Not Available506Open in IMG/M
3300004114|Ga0062593_101656235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae697Open in IMG/M
3300005562|Ga0058697_10106701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1169Open in IMG/M
3300005562|Ga0058697_10159583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria991Open in IMG/M
3300005562|Ga0058697_10560672Not Available591Open in IMG/M
3300005719|Ga0068861_100043723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3364Open in IMG/M
3300005937|Ga0081455_10047190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. ATCC PTA-50243732Open in IMG/M
3300005981|Ga0081538_10006746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae10036Open in IMG/M
3300005981|Ga0081538_10015131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae5992Open in IMG/M
3300005981|Ga0081538_10015846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. ATCC PTA-50245813Open in IMG/M
3300005981|Ga0081538_10021750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae4668Open in IMG/M
3300005981|Ga0081538_10049026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium roseum2567Open in IMG/M
3300005981|Ga0081538_10108313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1373Open in IMG/M
3300005981|Ga0081538_10113811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1320Open in IMG/M
3300005981|Ga0081538_10265894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia645Open in IMG/M
3300005981|Ga0081538_10292941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae601Open in IMG/M
3300005983|Ga0081540_1030082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae3014Open in IMG/M
3300005985|Ga0081539_10005342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia13183Open in IMG/M
3300005985|Ga0081539_10067980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium roseum1925Open in IMG/M
3300005985|Ga0081539_10268559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia749Open in IMG/M
3300005985|Ga0081539_10317570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia664Open in IMG/M
3300006844|Ga0075428_100012144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia9581Open in IMG/M
3300006844|Ga0075428_100914291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia930Open in IMG/M
3300006847|Ga0075431_100522370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1176Open in IMG/M
3300006852|Ga0075433_10575161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae990Open in IMG/M
3300006969|Ga0075419_10000352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia28165Open in IMG/M
3300009094|Ga0111539_10157593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2656Open in IMG/M
3300009100|Ga0075418_11515517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia728Open in IMG/M
3300009100|Ga0075418_12390034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300009789|Ga0126307_10042009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae3553Open in IMG/M
3300009789|Ga0126307_10165595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1771Open in IMG/M
3300009840|Ga0126313_10151607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1751Open in IMG/M
3300010038|Ga0126315_10228532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1129Open in IMG/M
3300010038|Ga0126315_10600524All Organisms → cellular organisms → Bacteria → Terrabacteria group710Open in IMG/M
3300010038|Ga0126315_10615605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria702Open in IMG/M
3300010038|Ga0126315_10927054All Organisms → cellular organisms → Bacteria → Terrabacteria group580Open in IMG/M
3300010042|Ga0126314_10769109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae708Open in IMG/M
3300010045|Ga0126311_11373046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300010362|Ga0126377_10160619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2120Open in IMG/M
3300011000|Ga0138513_100002662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1792Open in IMG/M
3300012896|Ga0157303_10106299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria689Open in IMG/M
3300012939|Ga0162650_100052366All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300014487|Ga0182000_10084945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1030Open in IMG/M
3300014487|Ga0182000_10444494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300014487|Ga0182000_10523661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300014488|Ga0182001_10172963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria762Open in IMG/M
3300015371|Ga0132258_10016876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria15726Open in IMG/M
3300017965|Ga0190266_10545527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300017997|Ga0184610_1009417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae2420Open in IMG/M
3300018000|Ga0184604_10034070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1315Open in IMG/M
3300018000|Ga0184604_10130140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria812Open in IMG/M
3300018027|Ga0184605_10137838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1093Open in IMG/M
3300018028|Ga0184608_10333284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300018031|Ga0184634_10136578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1093Open in IMG/M
3300018054|Ga0184621_10011358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2585Open in IMG/M
3300018071|Ga0184618_10486666Not Available518Open in IMG/M
3300018072|Ga0184635_10064034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1430Open in IMG/M
3300018073|Ga0184624_10203152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria884Open in IMG/M
3300018081|Ga0184625_10305951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria830Open in IMG/M
3300018432|Ga0190275_10247603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1717Open in IMG/M
3300018466|Ga0190268_10531613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria809Open in IMG/M
3300018466|Ga0190268_10704808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria742Open in IMG/M
3300018476|Ga0190274_10240467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1632Open in IMG/M
3300019279|Ga0184642_1620439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1424Open in IMG/M
3300019767|Ga0190267_10589436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria685Open in IMG/M
3300019873|Ga0193700_1069535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300021078|Ga0210381_10061448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1151Open in IMG/M
3300021510|Ga0222621_1107515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300021972|Ga0193737_1030055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria774Open in IMG/M
3300022534|Ga0224452_1045881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1291Open in IMG/M
3300025933|Ga0207706_10012770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7645Open in IMG/M
3300025972|Ga0207668_11428257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300026699|Ga0208707_102027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300027718|Ga0209795_10085007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria915Open in IMG/M
3300027750|Ga0209461_10171025Not Available540Open in IMG/M
3300027809|Ga0209574_10073577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria921Open in IMG/M
3300027873|Ga0209814_10000316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria15312Open in IMG/M
3300028380|Ga0268265_12460380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300028704|Ga0307321_1082161All Organisms → cellular organisms → Bacteria → Terrabacteria group640Open in IMG/M
3300028705|Ga0307276_10147532Not Available597Open in IMG/M
3300028705|Ga0307276_10198152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300028712|Ga0307285_10076529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria862Open in IMG/M
3300028712|Ga0307285_10121503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae701Open in IMG/M
3300028771|Ga0307320_10140861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia930Open in IMG/M
3300028811|Ga0307292_10310711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300028828|Ga0307312_10106652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1742Open in IMG/M
3300028878|Ga0307278_10015067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae3589Open in IMG/M
3300028881|Ga0307277_10155942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria991Open in IMG/M
3300030496|Ga0268240_10024900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1162Open in IMG/M
3300030496|Ga0268240_10044912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria932Open in IMG/M
3300030499|Ga0268259_10052342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia835Open in IMG/M
3300030510|Ga0268243_1129812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300030511|Ga0268241_10150852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia568Open in IMG/M
3300030513|Ga0268242_1024015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1046Open in IMG/M
3300031114|Ga0308187_10184958All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300031548|Ga0307408_100019064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae4616Open in IMG/M
3300031548|Ga0307408_100024646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces4112Open in IMG/M
3300031548|Ga0307408_100481084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1083Open in IMG/M
3300031731|Ga0307405_10803329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria788Open in IMG/M
3300031938|Ga0308175_101994063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300032002|Ga0307416_102956895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300032080|Ga0326721_10230581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria995Open in IMG/M
3300032080|Ga0326721_10245590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria970Open in IMG/M
3300032159|Ga0268251_10278488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae686Open in IMG/M
3300032180|Ga0307471_100560508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1298Open in IMG/M
3300034131|Ga0334911_019099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria942Open in IMG/M
3300034354|Ga0364943_0286824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300034687|Ga0334905_058243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.82%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment9.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.11%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil8.11%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere8.11%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.11%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere5.41%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave5.41%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere4.50%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave3.60%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.80%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.80%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Soil0.90%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.90%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.90%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300004016Agave microbial communities from Guanajuato, Mexico - As.Ma.rzHost-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300021972Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026699Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN574 (SPAdes)EnvironmentalOpen in IMG/M
3300027718Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027809Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300030499Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300030510Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300030513Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034131Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 7HMSEnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M
3300034687Soil microbial communities from Mojave Desert, California, United States - 1NOCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_156786802124908045SoilMSMFRKVVLGAALVGLVAVLRKSMPDLARYLKIRSM
ICChiseqgaiiDRAFT_067829223300000033SoilMSMFRKVVLGAALVGLVAVLRKSMPDLARYLKIRSM*
Ga0058689_1011934313300004016AgaveDRRAREREGGMSMFRKVLLGAALVGLVALLRKSVPDVARYFKIRSM*
Ga0058689_1018014413300004016AgaveAHRRARERGGGMSMFRKVLLGAALVGLVAVLRKSVPDLARYFKIRSM*
Ga0062593_10165623513300004114SoilADRRARERGGGMSMFRKVVLGAALVGLVAVLRKSMPDLARYLKIRSM*
Ga0058697_1010670123300005562AgaveMSMLRKLVLGAALVGLVALLRKSVPDVARYFKIRSM*
Ga0058697_1015958323300005562AgaveMSMFRKLVLGAALVGLVAVLRKSMPDLVRYLKIRSM*
Ga0058697_1056067213300005562AgaveMSMFRKVVLGAVLVGLVALLRKSAPDLARYLKIRSM*
Ga0068861_10004372333300005719Switchgrass RhizosphereMSMFRKLALGAVLVGLVAVLRKQAPDLARYFRMRQM*
Ga0081455_1004719033300005937Tabebuia Heterophylla RhizosphereMSMFRKVLLGAALVGLVAILRKSVPDLARYFKIRQM*
Ga0081538_1000674673300005981Tabebuia Heterophylla RhizosphereMLRKVVLGAALVGLVAVLRKSVPDLARYFKIRSM*
Ga0081538_1001513143300005981Tabebuia Heterophylla RhizosphereMSMFRKVLLGAALVGLVAVLRKSVPDLARYFKIRQM*
Ga0081538_1001584673300005981Tabebuia Heterophylla RhizosphereMSMLRRVVLGAALVGLVALLRKSVPDLARYFKIRSM*
Ga0081538_1002175043300005981Tabebuia Heterophylla RhizosphereMSMFRKVLLGAVLVGLVAVLRKSVPDLARYFKIRQM*
Ga0081538_1004902643300005981Tabebuia Heterophylla RhizosphereMSMLRRVVLGAALVGLVAVLRKSVPDIARYLKIRSM*
Ga0081538_1010831333300005981Tabebuia Heterophylla RhizosphereMSMLRRLVVGAALLGLVAVLRKQVPDIARYLRIRSM*
Ga0081538_1011381123300005981Tabebuia Heterophylla RhizosphereMSMLRRLLVGAALVGLAAVLRKNAPDLARYFKIRQM*
Ga0081538_1026589423300005981Tabebuia Heterophylla RhizosphereMSMLRKAVIVAAVAGLVAVLRKSVPDLARYFKIRSM*
Ga0081538_1029294123300005981Tabebuia Heterophylla RhizosphereMSMFRKVALGAALVGLVAVLRKSVPDLARYFKIRQM*
Ga0081540_103008253300005983Tabebuia Heterophylla RhizosphereMFRKVLLGAALVGLVAVLRKQVPDLARYFKIRQM*
Ga0081539_10005342143300005985Tabebuia Heterophylla RhizosphereMSMFRKVVLGAALVGLVMVLRKSVPDLARYFKIRQM*
Ga0081539_1006798033300005985Tabebuia Heterophylla RhizosphereMSMFRKVVLGAVLVGLVAVLRKTAPDLARYFKIRQM*
Ga0081539_1026855923300005985Tabebuia Heterophylla RhizosphereMSMFRKLVLGAVLVGLVAVLRKNAPDLARYLRIRQM*
Ga0081539_1031757023300005985Tabebuia Heterophylla RhizosphereMSMFRKLVLGAALVGLVMVLRKSVPDLARYFKIRQM*
Ga0075428_10001214463300006844Populus RhizosphereMSMFRKVVLGAVLVGLVAVLRKTAPDLARYIKIRQM*
Ga0075428_10091429143300006844Populus RhizosphereMSMFRKLALGAALVGLVAVLRKQAPDLARYFRMRQM*
Ga0075431_10052237043300006847Populus RhizosphereMSMVRRLVLFAALVGLVAVLRKQVPDLARYFKIRSM*
Ga0075433_1057516123300006852Populus RhizosphereMFRKLVLGAALVGLVAVLRKSMPDLVRYFKIRSM*
Ga0075419_10000352163300006969Populus RhizosphereMSMFRRVVLGAVLVGLVAVLRKTAPDLARYIKIRQM*
Ga0111539_1015759343300009094Populus RhizosphereMFRKLALGAALVGLVAVLRKQAPDLARYFKMRQM*
Ga0075418_1151551723300009100Populus RhizosphereMSMVRRLVLFAALVGLVALLRKQVPDLARYFKIRSM*
Ga0075418_1239003423300009100Populus RhizosphereMFRKLALGAVLVGLVAVLRKQAPDLARYFRMRQM*
Ga0126307_1004200943300009789Serpentine SoilMSMFRKVVLGAVLVGLVAVLRKSVPDLARYLKIRQM*
Ga0126307_1016559543300009789Serpentine SoilMTMFRKLALGAVLVGLVAVLRKTAPDLARYFKMRQM*
Ga0126313_1015160733300009840Serpentine SoilMSMVRKVVLGAVLVGLVAVVRKQLPDVVRYLKIRSM*
Ga0126315_1022853233300010038Serpentine SoilMSMFRKVLLGAALVGLVAVLRKSMPDLARYLKIRSM*
Ga0126315_1060052423300010038Serpentine SoilMSMVRKVLLGAVLVGLVAVLRKQLPDVVRYLKIRSM*
Ga0126315_1061560513300010038Serpentine SoilSMFRKVLLGAALVGLVAVLRKSVLDLARYFKIRQM*
Ga0126315_1092705413300010038Serpentine SoilGMSMFRKVVLGAALVGLVAVLRKSMPDLARYLKIRSM*
Ga0126314_1076910933300010042Serpentine SoilSMVRKVLLGAVLVGLVAVLRKQLPDVVRYLKIRSM*
Ga0126311_1137304623300010045Serpentine SoilMSMFRKVVLGAVLVGLVAVLRKSVPDLARYFKIRQM*
Ga0126377_1016061933300010362Tropical Forest SoilMSMFRKLVLGAVLVGLVAVLRKNAPDLARYFKIRQM*
Ga0138513_10000266243300011000SoilMFRKLALGAVLVGLVAVLRKNAPDLARYFKMRQM*
Ga0157303_1010629933300012896SoilMSMLRKLVLGAALVGLVAVLRKSMPDLVRYLKIRSM*
Ga0162650_10005236633300012939SoilMTMFRKLALGAVLVGLVAVLRKQAPDLARYFKMRQM*
Ga0182000_1008494533300014487SoilMSMFRKVVLGAVLVGLVAVLRKQGPDLVRYFKIRSM*
Ga0182000_1044449423300014487SoilMSMLRRVVLGAALVGLVAVLRKSVPDLARYFKIRQM*
Ga0182000_1052366123300014487SoilMSMFRKVVLGAALVGLVAVLRKSVPDLARYFKIRQM*
Ga0182001_1017296333300014488SoilMSMLRKVALGAALVGLVAVLRKSVPDLARYFKIRQM*
Ga0132258_10016876133300015371Arabidopsis RhizosphereMFRKLALGAVLVGLVAVLRKQAPDLARYFKMRQM*
Ga0190266_1054552723300017965SoilMSMLRRLVLLAALVGLVAVLRKQVPDLARYFKIRSM
Ga0184610_100941753300017997Groundwater SedimentMSMFRKLALGAVLVGLVAVLRKQAPDLARYFKMRQM
Ga0184604_1003407023300018000Groundwater SedimentMSMFRKVLLGAALVGLVAVLRKQVPDVVRYLKIRSM
Ga0184604_1013014023300018000Groundwater SedimentMTMFRKLALGAVLVGLVAVLRKNAPDLARYFKMRQM
Ga0184605_1013783823300018027Groundwater SedimentMTMFRKLVLGAVLVGLVAVLRKQAPDLARYFKMRQM
Ga0184608_1033328423300018028Groundwater SedimentMSMFRKVLLGAALVGLVAVLRKSVPDLARYFKIRSM
Ga0184634_1013657833300018031Groundwater SedimentMSMFRKLALGAVLVGLVAVLRKNAPDLARYFKMRQM
Ga0184621_1001135823300018054Groundwater SedimentMSMFRKLALGAVLVGLVAVLRKQAPDLARYLKMRQM
Ga0184618_1048666613300018071Groundwater SedimentMSMFRKVLLGAALVGLVAVLRKQMPDVVRYLKIRSM
Ga0184635_1006403443300018072Groundwater SedimentMSMVRRLVLGAALVGLVAVLRKQVPDLARYFKIRSM
Ga0184624_1020315233300018073Groundwater SedimentMSMVRRLVLGAALVGLVVVLRKQVPDLARYFKIRSM
Ga0184625_1030595133300018081Groundwater SedimentMSMVRRLVLFAALVGLVAVLRKQVPDLARYFKIRSM
Ga0190275_1024760323300018432SoilMSMFRKVLLGAALVGLVAVLRKSVPDLARYFKIRQM
Ga0190268_1053161323300018466SoilMSMVRRLVLFAALVGLVALLRKQVPDLARYFKIRSM
Ga0190268_1070480823300018466SoilMSMVRKVVLGAVLVGLVAVLRKQLPDLVRYLKIRSM
Ga0190274_1024046723300018476SoilMSMLRRLVLGAALVGLVVVLRKQVPDLARYFKIRSM
Ga0184642_162043943300019279Groundwater SedimentTMFRKLALGAVLVGLVAVLRKTAPDLARYFKMRQM
Ga0190267_1058943623300019767SoilMRMFRKLALGAVLVGLVAVLRKQAPDLARYFRMRQM
Ga0193700_106953513300019873SoilMSMVRKVVLGAVLVGLVAVLRKQLPDVVRYLKIRSM
Ga0210381_1006144823300021078Groundwater SedimentMSMFRKVVLGAVLVGLVAVLRKQLPDVVRYLKIRSM
Ga0222621_110751523300021510Groundwater SedimentMTMFRKLVLGAVLVGLVAVLRKQAPDLARYLKMRQM
Ga0193737_103005523300021972SoilMSMLRRLVVGAALVGLVAVLRKSIPDLARYFKIRQM
Ga0224452_104588113300022534Groundwater SedimentMSMFRKVLLGAALVGLVAVLRKSIPDLARYFKIRQM
Ga0207706_1001277023300025933Corn RhizosphereMSMFRKLALGAALVGLVAVLRKQAPDLARYFKMRQM
Ga0207668_1142825723300025972Switchgrass RhizosphereMSMFRKLALGAVLVGLVAVLRKQAPDLARYFRMRQM
Ga0208707_10202713300026699SoilRRARERGGGMSMFRKVVLGAALVGLVAVLRKSMPDLARYLKIRSM
Ga0209795_1008500723300027718AgaveMSMFRKVVLGAVLVGLVAVLRKQAPDLVRYFKIRSM
Ga0209461_1017102523300027750AgaveMSMFRKVVLGAVLVGLVALLRKSAPDLARYLKIRSM
Ga0209574_1007357733300027809AgaveMSMFRKLVLGAALVGLVAVLRKSMPDLVRYLKIRSM
Ga0209814_1000031663300027873Populus RhizosphereMSMFRKVVLGAVLVGLVAVLRKTAPDLARYIKIRQM
Ga0268265_1246038023300028380Switchgrass RhizosphereMSMFRKLALGTVLVGLVAVLRKQAPDLARYFRMRQM
Ga0307321_108216123300028704SoilMTMFRKLALGAVLVGLVAVLRKTAPDLARYFKMRQM
Ga0307276_1014753223300028705SoilMSMFRKVLLGAALVGLVALLRKSVPDVARYLKIRQM
Ga0307276_1019815223300028705SoilMSMFRKVLLGAALVGLVAVLRKQIPDLARYFKIRQM
Ga0307285_1007652933300028712SoilMSMFRKLALGAVLVGLVAVLRKQAPDLARYFKMRQ
Ga0307285_1012150333300028712SoilADRRARERGGGMSMFRKLALGAVLVGLVAVLRKQAPDLARYLKMRQM
Ga0307320_1014086123300028771SoilMSMFRKVVLGAALVGLVAVLRKSVPDLARYFRIRQM
Ga0307292_1031071133300028811SoilRRARERGGGMSMVRKVVLGAVLVGLVAVLRKQLPDVVRYLKIRSM
Ga0307312_1010665243300028828SoilMSMFRKLALGAVLVGLVAVLRKTAPDLARYFKMRQM
Ga0307278_1001506753300028878SoilMSMFRKVVLGAALVGLVAVLRKTAPDLVRYFKIRSM
Ga0307277_1015594233300028881SoilMSMFRKVVLGAALVGLIAVLRKSMPDLARYLKIRSM
Ga0268240_1002490033300030496SoilMSMFRKLVLGAALVGLVAVLRKSIPDLARYLKIRSM
Ga0268240_1004491223300030496SoilMSMFRKVVLGAALVGLVMVLRKSVPDLARYFKIRQM
Ga0268259_1005234223300030499AgaveMSMFRKLVLGAALVGLVAVLRKSMPDLARYLKIRSM
Ga0268243_112981223300030510SoilMSMFRKVVLGAVLVGLVAVLRKQGPDLVRYFKIRSM
Ga0268241_1015085213300030511SoilMSMFRKVMLGAALVGLVALLRKSAPDLARYLKIRSM
Ga0268242_102401523300030513SoilMSMLRKVALGAALVGLVAVLRKSVPDLARYFKIRQM
Ga0308187_1018495823300031114SoilMTMFRKLALGAVLVGLVAVLRKQAPDLARYLKMRQM
Ga0307408_10001906443300031548RhizosphereMSMFRKVLLGAVLVGLVAVLRKSVPDLARYFKIRQM
Ga0307408_10002464663300031548RhizosphereMSMFRKLVLGAALVGLVMVLRKSVPDLARYFKIRQM
Ga0307408_10048108423300031548RhizosphereMSMVRKVLLGAVLVGLVAVLRKQLPDVVRYLKIRSM
Ga0307405_1080332923300031731RhizosphereMSMFRKVLLGAALVGLVAILRKSVPDLARYFKIRQM
Ga0308175_10199406323300031938SoilMSMFRKVLLGAALVALVAVLRKSVPDLARYFKIRSM
Ga0307416_10295689513300032002RhizosphereGGGMSMFRKVLLGAVLVGLVAVLRKSVPDLARYFKIRQM
Ga0326721_1023058133300032080SoilMSMFRKVVLGAALVGLVAVLRKSVPDLARYFKIRQM
Ga0326721_1024559033300032080SoilMSMFRKVVLGAVLVGLVAVLRKSVPDLARYFKIRQM
Ga0268251_1027848813300032159AgaveMSMLRKLVLGAALVGLVALLRKSVPDVARYFKIRSM
Ga0307471_10056050813300032180Hardwood Forest SoilGGMSMFRKLALGAVLVGLVAVLRKQAPDLARYFKMRQM
Ga0334911_019099_833_9403300034131Sub-Biocrust SoilMSMFRKVVLGAALVGLVALLRKSVPDVARYFKIRSM
Ga0364943_0286824_182_2923300034354SedimentMSMVRRLVLLAALVGLVAVLRKQVPDLARYFKIRSM
Ga0334905_058243_402_5123300034687SoilMSMFRKVLLGAALVGLVAVLRKSMPDLARYFKIRSM

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.