 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F085595 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.87 % |
| % of genes near scaffold ends (potentially truncated) | 93.69 % |
| % of genes from short scaffolds (< 2000 bps) | 73.87 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (49.550 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (16.216 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.450 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.568 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF13252 | DUF4043 | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.45 % |
| Unclassified | root | N/A | 49.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001851|RCM31_10082033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 3973 | Open in IMG/M |
| 3300002274|B570J29581_111071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 546 | Open in IMG/M |
| 3300002408|B570J29032_109361556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 713 | Open in IMG/M |
| 3300002408|B570J29032_109621807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 950 | Open in IMG/M |
| 3300005525|Ga0068877_10680264 | Not Available | 552 | Open in IMG/M |
| 3300005527|Ga0068876_10003844 | All Organisms → cellular organisms → Bacteria | 10659 | Open in IMG/M |
| 3300005527|Ga0068876_10008604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 6848 | Open in IMG/M |
| 3300005527|Ga0068876_10297229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 917 | Open in IMG/M |
| 3300005527|Ga0068876_10719165 | Not Available | 532 | Open in IMG/M |
| 3300005528|Ga0068872_10103776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1696 | Open in IMG/M |
| 3300005581|Ga0049081_10137152 | Not Available | 900 | Open in IMG/M |
| 3300005581|Ga0049081_10313429 | Not Available | 538 | Open in IMG/M |
| 3300005582|Ga0049080_10232408 | Not Available | 605 | Open in IMG/M |
| 3300006641|Ga0075471_10342868 | Not Available | 755 | Open in IMG/M |
| 3300006641|Ga0075471_10601526 | Not Available | 539 | Open in IMG/M |
| 3300006802|Ga0070749_10016439 | All Organisms → Viruses → Predicted Viral | 4715 | Open in IMG/M |
| 3300007162|Ga0079300_10022604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2226 | Open in IMG/M |
| 3300007177|Ga0102978_1008791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 9768 | Open in IMG/M |
| 3300007212|Ga0103958_1027822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1192 | Open in IMG/M |
| 3300008113|Ga0114346_1186967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 842 | Open in IMG/M |
| 3300008114|Ga0114347_1156792 | Not Available | 810 | Open in IMG/M |
| 3300008114|Ga0114347_1170636 | Not Available | 758 | Open in IMG/M |
| 3300008117|Ga0114351_1227083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 948 | Open in IMG/M |
| 3300008117|Ga0114351_1371436 | Not Available | 628 | Open in IMG/M |
| 3300008120|Ga0114355_1202364 | Not Available | 638 | Open in IMG/M |
| 3300008259|Ga0114841_1129525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1504 | Open in IMG/M |
| 3300008262|Ga0114337_1004143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 14124 | Open in IMG/M |
| 3300008262|Ga0114337_1095164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1404 | Open in IMG/M |
| 3300008266|Ga0114363_1204646 | Not Available | 602 | Open in IMG/M |
| 3300008448|Ga0114876_1243298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 565 | Open in IMG/M |
| 3300008448|Ga0114876_1270898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 508 | Open in IMG/M |
| 3300008450|Ga0114880_1028649 | Not Available | 2505 | Open in IMG/M |
| 3300009158|Ga0114977_10697695 | Not Available | 540 | Open in IMG/M |
| 3300009168|Ga0105104_10458168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 714 | Open in IMG/M |
| 3300010296|Ga0129348_1235717 | Not Available | 617 | Open in IMG/M |
| 3300010354|Ga0129333_10623824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 934 | Open in IMG/M |
| 3300010354|Ga0129333_11479534 | Not Available | 557 | Open in IMG/M |
| 3300010354|Ga0129333_11575865 | Not Available | 537 | Open in IMG/M |
| 3300010354|Ga0129333_11600784 | Not Available | 532 | Open in IMG/M |
| 3300010370|Ga0129336_10107836 | All Organisms → Viruses → Predicted Viral | 1629 | Open in IMG/M |
| 3300010370|Ga0129336_10758614 | Not Available | 512 | Open in IMG/M |
| 3300010885|Ga0133913_10044074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 11986 | Open in IMG/M |
| 3300012706|Ga0157627_1115117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 506 | Open in IMG/M |
| 3300012721|Ga0157612_1156424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 872 | Open in IMG/M |
| 3300012725|Ga0157610_1019837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 754 | Open in IMG/M |
| 3300012731|Ga0157616_1185937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 584 | Open in IMG/M |
| 3300012733|Ga0157606_1420043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 601 | Open in IMG/M |
| 3300013005|Ga0164292_10006272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 9749 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10625670 | Not Available | 575 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10023817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 6869 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10978636 | Not Available | 512 | Open in IMG/M |
| 3300013372|Ga0177922_10588271 | Not Available | 587 | Open in IMG/M |
| 3300013372|Ga0177922_11089964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1032 | Open in IMG/M |
| 3300014050|Ga0119952_1077929 | Not Available | 816 | Open in IMG/M |
| 3300017701|Ga0181364_1000223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 10251 | Open in IMG/M |
| 3300017707|Ga0181363_1075843 | Not Available | 579 | Open in IMG/M |
| 3300017722|Ga0181347_1032396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1624 | Open in IMG/M |
| 3300017784|Ga0181348_1307787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 528 | Open in IMG/M |
| 3300017785|Ga0181355_1326037 | Not Available | 570 | Open in IMG/M |
| 3300017785|Ga0181355_1332027 | Not Available | 563 | Open in IMG/M |
| 3300017785|Ga0181355_1377298 | Not Available | 517 | Open in IMG/M |
| 3300019784|Ga0181359_1102359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1048 | Open in IMG/M |
| 3300020084|Ga0194110_10786481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 578 | Open in IMG/M |
| 3300020161|Ga0211726_10948645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 961 | Open in IMG/M |
| 3300021438|Ga0213920_1071809 | Not Available | 684 | Open in IMG/M |
| 3300022179|Ga0181353_1012868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2135 | Open in IMG/M |
| 3300022190|Ga0181354_1237973 | Not Available | 524 | Open in IMG/M |
| 3300022200|Ga0196901_1089259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1088 | Open in IMG/M |
| 3300024298|Ga0255178_1049290 | Not Available | 820 | Open in IMG/M |
| 3300024350|Ga0255167_1057745 | Not Available | 663 | Open in IMG/M |
| 3300024351|Ga0255141_1064131 | Not Available | 535 | Open in IMG/M |
| 3300024352|Ga0255142_1071689 | Not Available | 523 | Open in IMG/M |
| 3300024481|Ga0256330_1077580 | Not Available | 704 | Open in IMG/M |
| 3300024496|Ga0255151_1003451 | Not Available | 3084 | Open in IMG/M |
| 3300024503|Ga0255152_1007348 | Not Available | 2256 | Open in IMG/M |
| 3300024509|Ga0255175_1012672 | Not Available | 1766 | Open in IMG/M |
| 3300024548|Ga0256342_1041848 | Not Available | 1071 | Open in IMG/M |
| 3300024866|Ga0255272_1024142 | Not Available | 1523 | Open in IMG/M |
| 3300026566|Ga0256334_1075749 | Not Available | 767 | Open in IMG/M |
| 3300027133|Ga0255070_1025549 | Not Available | 961 | Open in IMG/M |
| 3300027141|Ga0255076_1077463 | Not Available | 547 | Open in IMG/M |
| 3300027396|Ga0255146_1043481 | Not Available | 948 | Open in IMG/M |
| 3300027547|Ga0209864_1003332 | Not Available | 1797 | Open in IMG/M |
| 3300027627|Ga0208942_1126808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 705 | Open in IMG/M |
| 3300027710|Ga0209599_10200558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 539 | Open in IMG/M |
| 3300027793|Ga0209972_10173167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1018 | Open in IMG/M |
| (restricted) 3300027970|Ga0247837_1009597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 11520 | Open in IMG/M |
| 3300027975|Ga0209391_10430511 | Not Available | 502 | Open in IMG/M |
| 3300028269|Ga0255193_1013693 | Not Available | 1182 | Open in IMG/M |
| 3300028286|Ga0256331_1080516 | Not Available | 737 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1013108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 7306 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10030338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 4933 | Open in IMG/M |
| 3300031673|Ga0307377_10920376 | Not Available | 594 | Open in IMG/M |
| 3300031857|Ga0315909_10890386 | Not Available | 550 | Open in IMG/M |
| 3300031951|Ga0315904_10370663 | Not Available | 1309 | Open in IMG/M |
| 3300031951|Ga0315904_10557668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 996 | Open in IMG/M |
| 3300031963|Ga0315901_10010988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 10234 | Open in IMG/M |
| 3300032050|Ga0315906_10009955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 11226 | Open in IMG/M |
| 3300032050|Ga0315906_11298552 | Not Available | 519 | Open in IMG/M |
| 3300032093|Ga0315902_11188821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 549 | Open in IMG/M |
| 3300032116|Ga0315903_10012478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 9907 | Open in IMG/M |
| 3300032116|Ga0315903_10093020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2902 | Open in IMG/M |
| 3300033981|Ga0334982_0026699 | All Organisms → Viruses → Predicted Viral | 3321 | Open in IMG/M |
| 3300034073|Ga0310130_0001995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 10099 | Open in IMG/M |
| 3300034096|Ga0335025_0012896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 5959 | Open in IMG/M |
| 3300034103|Ga0335030_0565860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 704 | Open in IMG/M |
| 3300034112|Ga0335066_0694543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 514 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.22% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.22% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 14.41% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.01% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.11% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 6.31% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.41% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.60% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.60% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.80% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.80% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.90% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.90% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.90% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.90% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002274 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012721 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300024350 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300024509 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8d | Environmental | Open in IMG/M |
| 3300024548 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026566 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027547 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
| 3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028269 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300028286 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM31_100820331 | 3300001851 | Marine Plankton | PQPQQAQLGAQVPAAGVAPVPASQPTPEQMGAAPAAGAPQGAPQGRPDIASLLAQIAG* |
| B570J29581_1110713 | 3300002274 | Freshwater | PVAGAAPVPASQPTPEQQSGEAPAAGQPQPDIAQLLASIGGAA* |
| B570J29032_1093615561 | 3300002408 | Freshwater | PNIPAVGAAPVPASQPTPEQQSGEAPAAGQPQPDIAQLLASISGAA* |
| B570J29032_1096218074 | 3300002408 | Freshwater | AAGALPAPASQPTPEQPGGAPAAAQRPDIGQLLAAIGGAA* |
| Ga0068877_106802643 | 3300005525 | Freshwater Lake | MAPVPASQPTPEQMGAAPAAGSRPDIASLLASIAG* |
| Ga0068876_100038441 | 3300005527 | Freshwater Lake | PGAPGTPAAGAAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA* |
| Ga0068876_100086041 | 3300005527 | Freshwater Lake | EPQPEVPAEMMGGEVPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG* |
| Ga0068876_102972291 | 3300005527 | Freshwater Lake | PEMPMGEQVPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG* |
| Ga0068876_107191651 | 3300005527 | Freshwater Lake | EVPMMGEEVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIATLLASIAG* |
| Ga0068872_101037765 | 3300005528 | Freshwater Lake | AGAAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA* |
| Ga0049081_101371521 | 3300005581 | Freshwater Lentic | APVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA* |
| Ga0049081_103134291 | 3300005581 | Freshwater Lentic | EVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIASLLASIAG* |
| Ga0049080_102324083 | 3300005582 | Freshwater Lentic | GAPGTPAAGAAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA* |
| Ga0075471_103428684 | 3300006641 | Aqueous | MGAEVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIATLLASIAG* |
| Ga0075471_106015263 | 3300006641 | Aqueous | VPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG* |
| Ga0070749_100164391 | 3300006802 | Aqueous | QPEMPMGEQVPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG* |
| Ga0079300_100226045 | 3300007162 | Deep Subsurface | GAAPVPASQPTPEQQSGEAPAAGQPQPDIAQLLASISGAA* |
| Ga0102978_10087911 | 3300007177 | Freshwater Lake | QVPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG* |
| Ga0103958_10278221 | 3300007212 | Freshwater Lake | VPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLAQIAG* |
| Ga0114346_11869671 | 3300008113 | Freshwater, Plankton | MMPEQQVPVAGAAPVPASQPTPEQQSGEAPAAGQPQPDIAQLLASIGGAA* |
| Ga0114347_11567921 | 3300008114 | Freshwater, Plankton | GTPAAGAAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA* |
| Ga0114347_11706364 | 3300008114 | Freshwater, Plankton | EVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIATLLASIAG* |
| Ga0114351_12270831 | 3300008117 | Freshwater, Plankton | GALPAPASQPTPEQPGGAPAAAQRPDIANLLAAIGGAA* |
| Ga0114351_13714361 | 3300008117 | Freshwater, Plankton | VPMGAEVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIATLLASIAG* |
| Ga0114355_12023641 | 3300008120 | Freshwater, Plankton | QPEVPMGAEVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIATLLASIAG* |
| Ga0114841_11295252 | 3300008259 | Freshwater, Plankton | MMGEEVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIATLLASIAG* |
| Ga0114337_100414310 | 3300008262 | Freshwater, Plankton | MMPGAPGTPAAGAAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA* |
| Ga0114337_10951641 | 3300008262 | Freshwater, Plankton | PVPASQPTPEQQSGEAPAAGQPQPDIAQLLASIGGAA* |
| Ga0114363_12046461 | 3300008266 | Freshwater, Plankton | EMMGGEVPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG* |
| Ga0114876_12432983 | 3300008448 | Freshwater Lake | ASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA* |
| Ga0114876_12708981 | 3300008448 | Freshwater Lake | APGTPAAGAAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA* |
| Ga0114880_10286491 | 3300008450 | Freshwater Lake | MAMMPGAPGTPAAGAAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA* |
| Ga0114977_106976951 | 3300009158 | Freshwater Lake | PAAGMVPTAASQVPPSQGATPAAGPQTRPDIAQLLASIGGAA* |
| Ga0105104_104581681 | 3300009168 | Freshwater Sediment | IPAVGAAPVPASQPTPEQQSGEAPAAGQPQPDIAQLLASISGAA* |
| Ga0129348_12357174 | 3300010296 | Freshwater To Marine Saline Gradient | PEPEVPMGEEVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIASLLASIAG* |
| Ga0129333_106238244 | 3300010354 | Freshwater To Marine Saline Gradient | GEQVPAAGMAPVPASQPTPEMTTGAAPAAGARPDIATLLAQIAG* |
| Ga0129333_114795343 | 3300010354 | Freshwater To Marine Saline Gradient | EVPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG* |
| Ga0129333_115758651 | 3300010354 | Freshwater To Marine Saline Gradient | EVPTEMMGEQVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIASLLASIAG* |
| Ga0129333_116007843 | 3300010354 | Freshwater To Marine Saline Gradient | PAPASQPTPEMMTGAAPAAGARPDIASLLAQIAG* |
| Ga0129336_101078365 | 3300010370 | Freshwater To Marine Saline Gradient | PAPASQPTPEQMTGAAPAAGARPDIASLLAQIAG* |
| Ga0129336_107586143 | 3300010370 | Freshwater To Marine Saline Gradient | APVPASQPTPEQMGAAPAAGARPDIATLLASIAG* |
| Ga0133913_100440741 | 3300010885 | Freshwater Lake | PGTPAAGAAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA* |
| Ga0157627_11151173 | 3300012706 | Freshwater | PASQPTPEQQSGEAPAAGQPQPDIAQLLASIGGAA* |
| Ga0157612_11564244 | 3300012721 | Freshwater | ASQPTPEQSGAAPAAGPEQRPDIATLLASISGAA* |
| Ga0157610_10198373 | 3300012725 | Freshwater | AAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA* |
| Ga0157616_11859371 | 3300012731 | Freshwater | AAPVPASQPTPEQQSGEAPAAGQPQPDIAQLLASIGGAA* |
| Ga0157606_14200431 | 3300012733 | Freshwater | PAAGAAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA* |
| Ga0164292_100062721 | 3300013005 | Freshwater | AAGAAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA* |
| (restricted) Ga0172367_106256701 | 3300013126 | Freshwater | QVPAAGMAPVPASQPTPEMMTGAAPAAGARPDIATLLAQIAG* |
| (restricted) Ga0172372_100238176 | 3300013132 | Freshwater | VPAAGMAPVPASQPTPEMMTGAAPAAGARPDIATLLAQIAG* |
| (restricted) Ga0172372_109786361 | 3300013132 | Freshwater | PVPASQPTPEMMTGAAPAAGARPDIATLLAQIAG* |
| Ga0177922_105882714 | 3300013372 | Freshwater | GMAPVPASQPTPEQMGAAPAAGSRPDIATLLASIAG* |
| Ga0177922_110899641 | 3300013372 | Freshwater | PEVPMGAEVPAAGMAPVPASQPTPEQMGAAPAAGPRPDIATLLASIAG* |
| Ga0119952_10779294 | 3300014050 | Freshwater | EQPPQPEVPMGAEVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIATLLASIAG* |
| Ga0181364_100022310 | 3300017701 | Freshwater Lake | GAAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA |
| Ga0181363_10758433 | 3300017707 | Freshwater Lake | EMMGEQVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIATLLASIAG |
| Ga0181347_10323961 | 3300017722 | Freshwater Lake | PAPEVPAEMMGEQVPAAGMAPVPASQPNPEQMGAAPAAGSRPDIATLLASIAG |
| Ga0181343_10199474 | 3300017766 | Freshwater Lake | VAGAAPAPASQPTQEQQVGAAPATGQSQPGIEQLLAAIGGS |
| Ga0181348_13077871 | 3300017784 | Freshwater Lake | VPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA |
| Ga0181355_13260374 | 3300017785 | Freshwater Lake | VPTEMMGEQVPAAGMAPVPASQPTQEQMGAAPAAGSRPDIATLLASIAG |
| Ga0181355_13320271 | 3300017785 | Freshwater Lake | QPEVPMGAEVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIASLLASIAG |
| Ga0181355_13772983 | 3300017785 | Freshwater Lake | MMGEEVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIATLLASIAG |
| Ga0181359_11023595 | 3300019784 | Freshwater Lake | PEPQPEMPMGEEVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIASLLASIAG |
| Ga0194110_107864813 | 3300020084 | Freshwater Lake | VPEQQIPVAGAAPVPASQPTPQQPSGEAPAAGQARPDIAQLLASIGGAA |
| Ga0211726_109486454 | 3300020161 | Freshwater | VFAPEPQPEMPMGEEVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIASLLASIAG |
| Ga0213920_10718094 | 3300021438 | Freshwater | QGMPQMPAAGMAPVPASQPTPVQTGGAAPAPGQQPQGKPDIASLLASIGGAA |
| Ga0222712_102384531 | 3300021963 | Estuarine Water | PAPASQPTQEQQVGAAPATGQSQPDIGQLLAAIGGA |
| Ga0181353_10128681 | 3300022179 | Freshwater Lake | PAAGMAPVPASQPTQEQMGAAPAAGSRPDIATLLASIAG |
| Ga0181354_12379733 | 3300022190 | Freshwater Lake | VFAPEPAPEVPTEMMGEQVPAAGMAPVPASQPTQEQMGAAPAAGSRPDIATLLASIAG |
| Ga0196901_10892595 | 3300022200 | Aqueous | GMAPVPASQPTPEQMGAAPAAGSRPDIASLLASIAG |
| Ga0255178_10492904 | 3300024298 | Freshwater | MGAEVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIATLLASIAG |
| Ga0255167_10577454 | 3300024350 | Freshwater | PEVPMGAEVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIASLLASIAG |
| Ga0255141_10641311 | 3300024351 | Freshwater | PQPEVPMGEQVPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG |
| Ga0255142_10716891 | 3300024352 | Freshwater | PMGAEVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIASLLASIAG |
| Ga0256330_10775801 | 3300024481 | Freshwater | QVPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG |
| Ga0255151_10034516 | 3300024496 | Freshwater | AAGMAPVPASQPTPEQMGAAPAAGSRPDIATLLASIAG |
| Ga0255152_10073481 | 3300024503 | Freshwater | AGMAPVPASQPTPEQMGAAPAAGSRPDIATLLASIAG |
| Ga0255175_10126721 | 3300024509 | Freshwater | QVPAAGMAPVPASQPTPEQMGAAPAAGARPDIASLLASIAG |
| Ga0256342_10418481 | 3300024548 | Freshwater | VPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG |
| Ga0255272_10241421 | 3300024866 | Freshwater | VPMGAEVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIATLLASIAG |
| Ga0256334_10757494 | 3300026566 | Freshwater | EVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIASLLASIAG |
| Ga0255070_10255491 | 3300027133 | Freshwater | PAEMMGEQVPAAGMAPVPASQPNPEQMGAAPAAGSRPDIATLLASIAG |
| Ga0255076_10774633 | 3300027141 | Freshwater | EVPAEMMGEQVPAAGMAPVPASQPNPEQMGAAPAAGSRPDIATLLASIAG |
| Ga0255146_10434814 | 3300027396 | Freshwater | KVFAPEPQPEVPMGEQVPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG |
| Ga0209864_10033321 | 3300027547 | Sand | AEMMGEQVPAAGMAPVPASQPTQEQMGAAPAAGSRPDIATLLASIAG |
| Ga0208942_11268081 | 3300027627 | Freshwater Lentic | APASQPNQTPQGGATPAAGQRPDIATLLASIGGAA |
| Ga0209599_102005582 | 3300027710 | Deep Subsurface | APGTPAAGAAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA |
| Ga0209972_101731671 | 3300027793 | Freshwater Lake | AGAAPVGASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA |
| (restricted) Ga0247837_10095971 | 3300027970 | Freshwater | APAPVMPEQQVPVAGAAPVPASQPTPQQQSGEAPAAGQPRPDIAQLLASIGGAA |
| Ga0209391_104305112 | 3300027975 | Freshwater Sediment | MPGAPGTPAAGAAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASIGGAA |
| Ga0255193_10136931 | 3300028269 | Freshwater | PEPQVEVPMGAEVPAAGMAPVPASQPTPEQMGAAPAAGSRPDIASLLASIAG |
| Ga0256331_10805164 | 3300028286 | Freshwater | FTPEPQPEMPMGEQVPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG |
| (restricted) Ga0247839_10131087 | 3300028553 | Freshwater | PEQQVPVAGAAPVPASQPTPQQQSGEAPAAGQPRPDIAQLLASIGGAA |
| (restricted) Ga0247840_100303381 | 3300028581 | Freshwater | QQVPVAGAAPVPASQPTPQQQSGEAPAAGQPRPDIAQLLASIGGAA |
| Ga0307377_109203761 | 3300031673 | Soil | MAPVPASQPTPEQMGAAPAAGSRPDIASLLASIAG |
| Ga0315909_108903864 | 3300031857 | Freshwater | AAGMAPVPASQPTPEQMGAAPAAGSRPDIASLLASIAG |
| Ga0315904_103706636 | 3300031951 | Freshwater | GAAPAPASQPTPETPGGAAPAGATRPDIATLLASIGGA |
| Ga0315904_105576681 | 3300031951 | Freshwater | PEPQPEMPMGEQVPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG |
| Ga0315901_100109881 | 3300031963 | Freshwater | EVPAEMMGGEVPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG |
| Ga0315906_1000995510 | 3300032050 | Freshwater | AGMAPVPASQPTPEQMGAAPAAGSRPDIASLLASIAG |
| Ga0315906_112985521 | 3300032050 | Freshwater | PAEMMGGEVPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG |
| Ga0315902_111888213 | 3300032093 | Freshwater | MMPGAPGTPAAGAAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA |
| Ga0315903_100124781 | 3300032116 | Freshwater | MAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG |
| Ga0315903_100930201 | 3300032116 | Freshwater | PQPEMPMGEQVPAAGMAPVPASQPTPEQMGAAPAAGARPDIATLLASIAG |
| Ga0334982_0026699_3179_3319 | 3300033981 | Freshwater | PGTPAAGAAPVPASQPTPEQGGAAPAAGPEQRPDIATLLASISGAA |
| Ga0334987_0375173_3_110 | 3300034061 | Freshwater | PASQPTPEEQSGAAPAAGQPRPDIAQLLASIGGAA |
| Ga0310130_0001995_2_148 | 3300034073 | Fracking Water | PTEMMGEQVPAAGMAPVPASQPTQEQMGAAPAAGSRPDIATLLASIAG |
| Ga0335025_0012896_5799_5957 | 3300034096 | Freshwater | APEVPTEMMGEQVPAAGMAPVPASQPTQEQMGAAPAAGSRPDIASLLASIAG |
| Ga0335027_0752235_462_569 | 3300034101 | Freshwater | PASQPTPEQQSGAAPAAGQPQPDIAQLLASIGGAA |
| Ga0335030_0565860_2_160 | 3300034103 | Freshwater | APVMPEQQVPVAGAAPVPASQPTPEQQSGEAPAAGQPQPDIAQLLASIGGAA |
| Ga0335066_0694543_385_513 | 3300034112 | Freshwater | AVGAAPVPASQPTPEQQSGEAPAAGQPQPDIAQLLASISGAA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |