NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F085816

Metagenome Family F085816

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085816
Family Type Metagenome
Number of Sequences 111
Average Sequence Length 44 residues
Representative Sequence KKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGTKQRYRSI
Number of Associated Samples 33
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 94.59 %
% of genes from short scaffolds (< 2000 bps) 83.78 %
Associated GOLD sequencing projects 32
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.991 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine
(63.063 % of family members)
Environment Ontology (ENVO) Unclassified
(96.396 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.090 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.49%    β-sheet: 0.00%    Coil/Unstructured: 63.51%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF02557VanY 65.77
PF01494FAD_binding_3 9.01
PF03144GTP_EFTU_D2 8.11
PF00009GTP_EFTU 7.21
PF04290DctQ 0.90
PF03745DUF309 0.90
PF01425Amidase 0.90
PF01427Peptidase_M15 0.90
PF02092tRNA_synt_2f 0.90
PF01578Cytochrom_C_asm 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG2173D-alanyl-D-alanine dipeptidaseCell wall/membrane/envelope biogenesis [M] 66.67
COG1876LD-carboxypeptidase LdcB, LAS superfamilyCell wall/membrane/envelope biogenesis [M] 65.77
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 18.02
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 9.01
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 9.01
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 9.01
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.90
COG0751Glycyl-tRNA synthetase, beta subunitTranslation, ribosomal structure and biogenesis [J] 0.90
COG1547Predicted metal-dependent hydrolaseFunction unknown [S] 0.90


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.99 %
UnclassifiedrootN/A9.01 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001962|GOS2239_1034923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus677Open in IMG/M
3300005523|Ga0066865_10324966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus582Open in IMG/M
3300005606|Ga0066835_10126483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus833Open in IMG/M
3300005606|Ga0066835_10199318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus675Open in IMG/M
3300005946|Ga0066378_10267599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus533Open in IMG/M
3300005960|Ga0066364_10149381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus800Open in IMG/M
3300005960|Ga0066364_10223879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus654Open in IMG/M
3300005971|Ga0066370_10305035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus570Open in IMG/M
3300005971|Ga0066370_10367467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus519Open in IMG/M
3300006305|Ga0068468_1079512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus2376Open in IMG/M
3300006305|Ga0068468_1090311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus2606Open in IMG/M
3300006305|Ga0068468_1118519Not Available6464Open in IMG/M
3300006305|Ga0068468_1138346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus4260Open in IMG/M
3300006305|Ga0068468_1138622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1958Open in IMG/M
3300006316|Ga0068473_1728413Not Available889Open in IMG/M
3300006334|Ga0099675_1151010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1908Open in IMG/M
3300006334|Ga0099675_1181553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1205Open in IMG/M
3300006334|Ga0099675_1207595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1320Open in IMG/M
3300006334|Ga0099675_1232239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1502Open in IMG/M
3300006334|Ga0099675_1310708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus651Open in IMG/M
3300006334|Ga0099675_1406416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1329Open in IMG/M
3300006334|Ga0099675_1446800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria662Open in IMG/M
3300006334|Ga0099675_1500000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus830Open in IMG/M
3300006337|Ga0068495_1218113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus5499Open in IMG/M
3300006337|Ga0068495_1226721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus2898Open in IMG/M
3300006337|Ga0068495_1283517Not Available1051Open in IMG/M
3300006337|Ga0068495_1305622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus995Open in IMG/M
3300006337|Ga0068495_1308743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1652Open in IMG/M
3300006337|Ga0068495_1313330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1367Open in IMG/M
3300006337|Ga0068495_1592833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → unclassified Prochlorococcus → Prochlorococcus sp.959Open in IMG/M
3300006345|Ga0099693_1025168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique4363Open in IMG/M
3300006345|Ga0099693_1025169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1711Open in IMG/M
3300006345|Ga0099693_1120590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus716Open in IMG/M
3300006345|Ga0099693_1122484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus2024Open in IMG/M
3300006345|Ga0099693_1123442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus687Open in IMG/M
3300006345|Ga0099693_1139394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1288Open in IMG/M
3300006345|Ga0099693_1158580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1489Open in IMG/M
3300006345|Ga0099693_1202038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus697Open in IMG/M
3300006345|Ga0099693_1402545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus816Open in IMG/M
3300006350|Ga0099954_1092389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus3406Open in IMG/M
3300006350|Ga0099954_1094817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus3422Open in IMG/M
3300006350|Ga0099954_1150644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus770Open in IMG/M
3300006350|Ga0099954_1156448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus3057Open in IMG/M
3300006350|Ga0099954_1157924All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300006350|Ga0099954_1268926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus729Open in IMG/M
3300006350|Ga0099954_1275857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → unclassified Prochlorococcus → Prochlorococcus sp.1538Open in IMG/M
3300006350|Ga0099954_1363776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus568Open in IMG/M
3300006350|Ga0099954_1402734Not Available581Open in IMG/M
3300006351|Ga0099953_1084513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1164Open in IMG/M
3300006351|Ga0099953_1200831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus905Open in IMG/M
3300006351|Ga0099953_1210029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → unclassified Prochlorococcus → Prochlorococcus sp.1040Open in IMG/M
3300006351|Ga0099953_1218976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus832Open in IMG/M
3300006351|Ga0099953_1230213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus957Open in IMG/M
3300006351|Ga0099953_1284014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus978Open in IMG/M
3300006351|Ga0099953_1350882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus834Open in IMG/M
3300006351|Ga0099953_1401739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus537Open in IMG/M
3300006413|Ga0099963_1093895Not Available1214Open in IMG/M
3300006413|Ga0099963_1103736Not Available1471Open in IMG/M
3300006413|Ga0099963_1112647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus3099Open in IMG/M
3300006413|Ga0099963_1222111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1834Open in IMG/M
3300006413|Ga0099963_1332166Not Available846Open in IMG/M
3300006478|Ga0100224_1200405All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300006480|Ga0100226_1018382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1781Open in IMG/M
3300006480|Ga0100226_1028694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1327Open in IMG/M
3300006480|Ga0100226_1140362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus2295Open in IMG/M
3300006480|Ga0100226_1158953Not Available1325Open in IMG/M
3300006480|Ga0100226_1190224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1918Open in IMG/M
3300006480|Ga0100226_1193903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1701Open in IMG/M
3300006480|Ga0100226_1260557All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300006480|Ga0100226_1282982Not Available840Open in IMG/M
3300006480|Ga0100226_1328582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1039Open in IMG/M
3300006480|Ga0100226_1561667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus836Open in IMG/M
3300006481|Ga0100229_1024804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus2235Open in IMG/M
3300006481|Ga0100229_1246669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1348Open in IMG/M
3300006481|Ga0100229_1254465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1481Open in IMG/M
3300006481|Ga0100229_1266175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1297Open in IMG/M
3300006481|Ga0100229_1309839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus568Open in IMG/M
3300006481|Ga0100229_1430603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus727Open in IMG/M
3300006481|Ga0100229_1439749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus799Open in IMG/M
3300006843|Ga0068496_152752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → unclassified Prochlorococcus → Prochlorococcus sp.5678Open in IMG/M
3300012919|Ga0160422_10364585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus896Open in IMG/M
3300012919|Ga0160422_10517825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus751Open in IMG/M
3300012928|Ga0163110_11053741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus649Open in IMG/M
3300012936|Ga0163109_10423686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus975Open in IMG/M
3300012936|Ga0163109_10698550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus742Open in IMG/M
3300020281|Ga0211483_10141380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus798Open in IMG/M
3300020281|Ga0211483_10215089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus639Open in IMG/M
3300020289|Ga0211621_1052601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus562Open in IMG/M
3300020395|Ga0211705_10158932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus827Open in IMG/M
3300020404|Ga0211659_10384574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus610Open in IMG/M
3300020409|Ga0211472_10004840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus5417Open in IMG/M
3300020420|Ga0211580_10051985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1745Open in IMG/M
3300020424|Ga0211620_10291895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus695Open in IMG/M
3300020424|Ga0211620_10350364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus628Open in IMG/M
3300020432|Ga0211556_10043237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus2264Open in IMG/M
3300020433|Ga0211565_10076949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1429Open in IMG/M
3300020433|Ga0211565_10456018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus557Open in IMG/M
3300020448|Ga0211638_10143318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1082Open in IMG/M
3300020448|Ga0211638_10285499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus766Open in IMG/M
3300026136|Ga0208763_1012001Not Available1361Open in IMG/M
3300031785|Ga0310343_10041677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus2739Open in IMG/M
3300031785|Ga0310343_10108564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1793Open in IMG/M
3300031785|Ga0310343_10229361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1284Open in IMG/M
3300031785|Ga0310343_10314152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1113Open in IMG/M
3300031785|Ga0310343_10403035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus991Open in IMG/M
3300031785|Ga0310343_10483245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus909Open in IMG/M
3300031785|Ga0310343_10588277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus826Open in IMG/M
3300031785|Ga0310343_11050698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus615Open in IMG/M
3300031785|Ga0310343_11066607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus611Open in IMG/M
3300031785|Ga0310343_11418530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus524Open in IMG/M
3300031785|Ga0310343_11452453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus518Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine63.06%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine14.41%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater9.91%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine7.21%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.70%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater1.80%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001962Marine microbial communities from Cocos Island, Costa Rica - GS023EnvironmentalOpen in IMG/M
3300005523Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265EnvironmentalOpen in IMG/M
3300005606Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84EnvironmentalOpen in IMG/M
3300005946Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_DCM_ad_71m_LV_AEnvironmentalOpen in IMG/M
3300005960Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_AEnvironmentalOpen in IMG/M
3300005971Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_AEnvironmentalOpen in IMG/M
3300006305Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025mEnvironmentalOpen in IMG/M
3300006316Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_1000mEnvironmentalOpen in IMG/M
3300006334Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025mEnvironmentalOpen in IMG/M
3300006337Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0025mEnvironmentalOpen in IMG/M
3300006345Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075mEnvironmentalOpen in IMG/M
3300006350Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075mEnvironmentalOpen in IMG/M
3300006351Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0045mEnvironmentalOpen in IMG/M
3300006413Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0025mEnvironmentalOpen in IMG/M
3300006478Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0125mEnvironmentalOpen in IMG/M
3300006480Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0075mEnvironmentalOpen in IMG/M
3300006481Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0025mEnvironmentalOpen in IMG/M
3300006843Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_1_0075mEnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300020281Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116)EnvironmentalOpen in IMG/M
3300020289Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556122-ERR599019)EnvironmentalOpen in IMG/M
3300020395Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020409Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106)EnvironmentalOpen in IMG/M
3300020420Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142)EnvironmentalOpen in IMG/M
3300020424Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138)EnvironmentalOpen in IMG/M
3300020432Marine microbial communities from Tara Oceans - TARA_B100002052 (ERX556103-ERR599100)EnvironmentalOpen in IMG/M
3300020433Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030)EnvironmentalOpen in IMG/M
3300020448Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954)EnvironmentalOpen in IMG/M
3300026136Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes)EnvironmentalOpen in IMG/M
3300031785Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MGEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GOS2239_103492323300001962MarineFAYKSAFLKIIVNIEISFPNSPLYIGTKQRYQSI*
Ga0066865_1032496613300005523MarineKKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGTKQRYRSI*
Ga0066835_1012648323300005606MarineNSYPQHMKKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSLINIGT*
Ga0066835_1019931823300005606MarineLNIRKKNNTVYKSYIFFAYKSAFLKIIVNIEISFSNSPINIGT*
Ga0066378_1026759913300005946MarineTNNSYPQHMKKNNTVYKNYIFFAYKSAFRKIIVNIEICFLGSPINIGTKQRL*
Ga0066364_1014938123300005960MarineTKKNNTVYKTYIFFAYKSAFLKIIVNIEICFPDSLLNIGTKQRFNSI*
Ga0066364_1022387913300005960MarinePSTYEKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGTKQRYRSI*
Ga0066370_1030503523300005971MarineIFFAYKSAFLKIIVNIEISFPNSTLNIGTKQRYQSI*
Ga0066370_1036746723300005971MarineNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGTKQGYRSI*
Ga0068468_107951233300006305MarineNSVYKTYIFFAYKSAFLKIIVNIEISFPNSPLNIGTKQRYQSI*
Ga0068468_109031133300006305MarineFAYKSAFLKIIVNIEISFPNSLLNIGTKQRYQSI*
Ga0068468_111851993300006305MarineMKKNNTVYKNYIFFAYKSAFRKIIVNIEICFPGLLINIGTKQRFKSI*
Ga0068468_113834663300006305MarineHIFQKNNNVYKSYIFFAYKSAFLKIIVNIEICFPNSFINIGTKKRY*
Ga0068468_113862213300006305MarineKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGT*
Ga0068473_172841313300006316MarineMKKNNTVYKNYIFFAYKSAFRKIIVNIEICFPGSTINIGTKQRFKS
Ga0099675_115101033300006334MarineWTSTNNSYPQHMKKNNTVYKNYIFFAYKSAFRKIIVNIEICFYGSPISIGTK*
Ga0099675_118155333300006334MarineTWTSTNNSYPQHMKKNNTVYKNYIFFAYKSAFRKIIVNIEICFQGSTINIGTKQRFKSN*
Ga0099675_120759533300006334MarineKKNNTVYKTYIFFAYKSAFLKIIVNIEISFPNSPLNIGTKQRYRSI*
Ga0099675_123223953300006334MarineVYKNYIFFAYKSAFRKIIVNIEICFPSSPINIGTKQGFKSI*
Ga0099675_131070823300006334MarineNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGTKQRYRSI*
Ga0099675_140641613300006334MarineKKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSFLNIGTKQKYRSI*
Ga0099675_144680023300006334MarineFAYKSAFLKIIVNIEISFPNSPLNIGTKQRYQSI*
Ga0099675_150000023300006334MarineQLPSTYEKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGTK*
Ga0068495_121811363300006337MarineMKKKNTEYKKYIFFAYKSAFRKIIVNIEICFLGSPINIGTKQRFKSN*
Ga0068495_122672153300006337MarineYAYKSAFLKKIVNIEISFPNSHLNIGTKQRYRSI*
Ga0068495_128351713300006337MarineMKKNNTVYKNYIFFAYKSAFRKIIVNIEICFPGSP
Ga0068495_130562213300006337MarineSIIPKKNNTEYKSYIFFAYKSAFLKIIVNIEISFPNSLLNIGTKHRYRSF*
Ga0068495_130874333300006337MarineKNNTVYKKYIFFAYKSAFLKIIVNIEISFPNSLINIGTKQRYRSI*
Ga0068495_131333013300006337MarineKKKNTVYKNYTFFAYKSAFRKIIVNIEICFPGSHINIGTKQRFKSN*
Ga0068495_159283333300006337MarineFFAYKSAFLKIIVNIEISFPNSPLKIGTKQRYQSI*
Ga0099693_102516813300006345MarineKNNTVYKNYIFFAYKGAFLKIIVNIEISFPNSLLKYWN*
Ga0099693_102516913300006345MarineTWTSTNNSYPQHMKKNNTVYKNYIFFAYKGAFLKIIVNIEISFPNTPLNIGTK*
Ga0099693_112059023300006345MarineKNNTVYKNYIFFANKSAFRKIIVNIEICFPGSPINIGTK*
Ga0099693_112248413300006345MarineFFAYKSAFRKIIVNIEICFSGSSINIGTKQRFKSI*
Ga0099693_112344223300006345MarineTLYKSYIFFAYKSAFLKKIVYIEISFPNSLLNIGT*
Ga0099693_113939423300006345MarineYKSYNLFANKSAFRKIIVNIEICFPGSPINIGTKQRFKSN*
Ga0099693_115858013300006345MarineYPQHMKKNNTVYKNYIFFANKSAFLKIIVNIEISFPNSLLNIGTKKRYRSI*
Ga0099693_120203823300006345MarineTVYKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGTKQRYRSI*
Ga0099693_140254523300006345MarineYPQHMKKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGTKQRYRSI*
Ga0099954_109238953300006350MarineKNNTVYKNYIFFAYKSAFLKKIVNIEISFPNSLLNIGTKQ*
Ga0099954_109481733300006350MarineMKKNNTVYKNYIFFAYKSAFRKIIVNIEICFPGSTINIGTKQRFKSN*
Ga0099954_115064413300006350MarineVYNIEKKNNTVYKSYIFFAYKSAFLKIIVNIEICFPNSYLNIGTK*
Ga0099954_115644833300006350MarineMKKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSPMTKEE
Ga0099954_115792423300006350MarineMKKNNTVYKNYIFFAYKSAFRKIIVNIEICFPGSPINIGTKQRFKPN*
Ga0099954_126892613300006350MarineKNNSVYKNYIFFAYKSAFRKIIVNIEICFLGSPINIGTKQGFKSI*
Ga0099954_127585733300006350MarineKNYTVYKNYIFFAYKSAFLKIIVNIEISFPNTLLNIGTKQRYRSI*
Ga0099954_136377623300006350MarineKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSILNIGTKQRYRSI*
Ga0099954_140273413300006350MarineKNNTVYKTYIFFAYKSAFLKIIVNIEISFPNTPLNIGTKQRYRSI*
Ga0099953_108451313300006351MarineKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGTKKRYRSI*
Ga0099953_120083113300006351MarineVFKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGTKQRYRSI*
Ga0099953_121002933300006351MarineITVYKTYIFFAYKSAFLKIIVNIEICFPDSLLNIGTKQRFKSI*
Ga0099953_121897623300006351MarineKKNNTVYKNYIFFAYKSAFRKIIVNIEICFLGSPINIGTKQRFKSN*
Ga0099953_123021323300006351MarineLQHTKKNNTVYKNYIFFAYKSAFRKIIVNIEICFPGSLINIGTKQRFKSN*
Ga0099953_128401413300006351MarineMKKNNTVYKNYIFFAYKSAFLKIMVNIEISFPNSLINIGTKQRFKSD*
Ga0099953_135088223300006351MarineTNNSYPQHMKKNNTVYKNYNFFGYKSAFLKIIVNIEISFPNSLLNIGTKQRYRSI*
Ga0099953_140173923300006351MarineNNSYPQHMKKNNTVYKNYIFFACKSAFLKIIVNIEISFPNSLLNIGTKQRYRSI*
Ga0099963_109389523300006413MarineMKKNNTVYKNYIFFAYKGAFLKIIVNIEISFPNSLLNI
Ga0099963_110373623300006413MarineMKKNNTVYKNNIFFAYKSAFLKIIVNIEISFPNSLLNIGTKQRYR
Ga0099963_111264713300006413MarineSADNSYPQHIKKNNTVYKNYIFFGYKSAFLKIIVNIEISFPNSLLNIGT*
Ga0099963_122211133300006413MarineIFFAYKSAFLKKIVNIEICFPDSLLNIGTKQRFNSI*
Ga0099963_133216613300006413MarineMKKNNTVYKNYIFFAYKSAFRKIIVNIEICFPGSPINIG
Ga0100224_120040523300006478MarineNNSYPQHMKKNNTVYKNYIFFAYKSAFRKIIVNIEICFPNSPLNIGTKQRNKSI*
Ga0100226_101838233300006480MarineNNTVYKNYIFFAYKSAFRKIIVNIEICFQGSPINIGTKQRFKSN*
Ga0100226_102869413300006480MarineNSYPQHMKKNNTVYKNYIFFAYKSAFLKIIVNIEISFPN*
Ga0100226_114036213300006480MarineNTVYKNYIFFAYKSAFLKIIVNIEISFPNTLLNIGTKQRYRSI*
Ga0100226_115895323300006480MarineMKKNNTVYKSYIFFAYKSAFLKIIVNIEISFPNSPLNIGTKQRSKSI*
Ga0100226_119022433300006480MarineKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGTKQRYRSI*
Ga0100226_119390313300006480MarineFAYKSAFLKIIVNIEICFPGSFINIGTKQRFKSI*
Ga0100226_126055713300006480MarineKNNTVYKNYIFFAYKSAFRKLIVNIEICFPGSPNKYWNKTKI*
Ga0100226_128298213300006480MarineMKKNNTVYKNYIYFAYKSAFLKIIVNIEISFPNSLLNIGTKQR
Ga0100226_132858233300006480MarineFFAYKSAFLKIIVNIEICFPDSLLNIGTKQRFKSI*
Ga0100226_156166713300006480MarineYIFFAYKSAFLKIIVNIEISFPNTLLNIGTKQRYRSI*
Ga0100229_102480413300006481MarineNTVYKNYIFFAYKSAFRKIIVNIEICFPGSPINIGTKQRFKSN*
Ga0100229_124666933300006481MarineYPQHMKKNNTVYKNYIFFAYKSAFRKIIVNIEICFLGSPINIGTKQRFKSI*
Ga0100229_125446533300006481MarineMKKNNTVYKNYIFFAYKSAFRKIIVNIEICFPGSPINIGTKQRFKSI*
Ga0100229_126617533300006481MarineNNTVYKNYIFFAYKSAFLKIIVNIEISYPNSLLNIGTKQRYRSI*
Ga0100229_130983913300006481MarineNTEYKSYIFFAYKSAFLKIIVNIEICFPDSQINIGTIK*
Ga0100229_143060313300006481MarinePQHMKKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGTKQRF*
Ga0100229_143974923300006481MarineYKNYIFFAYKSAFLKIIVNIEISFPNSLLDIGTKKRYRSI*
Ga0068496_15275213300006843MarineMKKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGTKQRYRSI
Ga0160422_1036458513300012919SeawaterKTYIFFAYKSAFLKIIVNIEISFPNSPLNIGTKQKYQSI*
Ga0160422_1051782523300012919SeawaterPITATLNIRKKNNTVYKSYIFFAYKSAFLKIIVNIEIVFPKSIQNIGTRKRYKSI*
Ga0163110_1105374113300012928Surface SeawaterNNSYPQHTKKNNNVYKTYIFFAYKSAFLKIIVNIEICFPNSPLNIGTRKRY*
Ga0163109_1042368613300012936Surface SeawaterEPLGPPPITATLNIRKKNNTVYKTYIFFAYKGAFLKIIVNIEICFQDSS*
Ga0163109_1069855023300012936Surface SeawaterKKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSPLNIGT*
Ga0211483_1014138013300020281MarineVYKNYIFFAYKSAFRKIIVNIEICFPGLPINIGTKQGIKSI
Ga0211483_1021508923300020281MarineTVYKNYIFFAYKSAFLKIIVNIEISLPNSLLNIGTKQRYRSI
Ga0211621_105260113300020289MarineNNTVYKNYIFFAYKSAFRKIIVNIEICFLGSPLNIGTKQRFKSV
Ga0211705_1015893213300020395MarineYEKINTVYKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGTKQRYRSI
Ga0211659_1038457423300020404MarineINVYKSYIFFAYKSAFLKKIVNIEIVFSNSKQNIGTRKRF
Ga0211472_1000484083300020409MarineNTVYKNYIFFAYKSAFLKIIVNIEICFPNSPINIGTKQGYKSI
Ga0211580_1005198533300020420MarineWTSTNNSYPQHMKKNNTVYKNYIFLAYKSAFLKIIVNIEICFPNSILNIGTK
Ga0211620_1029189513300020424MarineNTVYKSYIFFAYKSAFLKIIVNIEISFPNSPLNIGTKQRYQSI
Ga0211620_1035036423300020424MarineNTVYKNYIFFAYKSAFLKIMVNIEICFQNSPLNIGTKQGFNSI
Ga0211556_1004323713300020432MarineKKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGTKQRYRSI
Ga0211565_1007694933300020433MarineIFFAYKSAFLKIIVNIEISFPNSPLNIGTKQRYQSI
Ga0211565_1045601823300020433MarineKKNNTVYKNYIFFAYKSAFRKIIVNIEICFLGSPINIGTKQRL
Ga0211638_1014331813300020448MarineKTVYKTYIFFAYKSAFLKIIVNIEITFPNSPLNIGTKQRYQSI
Ga0211638_1028549923300020448MarineSYPQHMKKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNSLLNIGTKQRYRSI
Ga0208763_101200113300026136MarineMKKNNTVYKNYIFFAYKSAFLKIMVNIEICLPNSANKYWNK
Ga0310343_1004167733300031785SeawaterSTDNSYPQHMKKINTVYKNYIFFAYKSAFLKIIVNIEISFPNSIQNIGTKQRY
Ga0310343_1010856433300031785SeawaterITATLNIRKNNSVYKSYIFFAYKSAFLKIMVNIEISFPNSTFNIGTK
Ga0310343_1022936133300031785SeawaterKKNNTVYKNYIFFAYKSAFLKIIVNIEISFPNTLLNIGTKQRYRSI
Ga0310343_1031415213300031785SeawaterNNNVYKTYIFFAYKSAFLKIIVNIEICFPDSLLNIGTKQRFKSI
Ga0310343_1040303523300031785SeawaterKNNTVYKTYIYFDDKSAFLKKIVNIEICFLDTSLNIGTKKRPISI
Ga0310343_1048324513300031785SeawaterKKNNTVYKTYIFFAYKSAFLKIIVNIEISFPNSPLNWN
Ga0310343_1058827723300031785SeawaterFFAYKSAFLKIIVNIEISFPNSPLNIGTKQRYQSI
Ga0310343_1105069823300031785SeawaterPQHMKKNNTVYKNYIFFAYKSAFLKIMVNIEISFPNTLLNIGTKQRYRSI
Ga0310343_1106660723300031785SeawaterNSYPQHMKKNNTVYKSYIFFAYKSAFLKIIVNIEICFPNPPLYIGTKQRSKSI
Ga0310343_1141853013300031785SeawaterYPQHMKKNNTLYKNYIFFAYKSAFLKIIVNIEISFPNSILNIGTKQRYRSI
Ga0310343_1145245313300031785SeawaterFFAYKSAFLKIIVNIEISFPNSLLNIGTKQRYRSI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.