Basic Information | |
---|---|
Family ID | F085892 |
Family Type | Metagenome |
Number of Sequences | 111 |
Average Sequence Length | 40 residues |
Representative Sequence | METLHLKLSKEDKQIIRDLAKSKRMSMNGYIRNELLNKE |
Number of Associated Samples | 84 |
Number of Associated Scaffolds | 111 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 17.12 % |
% of genes from short scaffolds (< 2000 bps) | 81.98 % |
Associated GOLD sequencing projects | 72 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (59.459 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (31.532 % of family members) |
Environment Ontology (ENVO) | Unclassified (79.279 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.288 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.33% β-sheet: 0.00% Coil/Unstructured: 65.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 111 Family Scaffolds |
---|---|---|
PF12728 | HTH_17 | 7.21 |
PF01844 | HNH | 3.60 |
PF00589 | Phage_integrase | 2.70 |
PF01402 | RHH_1 | 1.80 |
PF12631 | MnmE_helical | 1.80 |
PF13102 | Phage_int_SAM_5 | 0.90 |
PF12643 | MazG-like | 0.90 |
PF12844 | HTH_19 | 0.90 |
PF05766 | NinG | 0.90 |
PF03382 | DUF285 | 0.90 |
PF00037 | Fer4 | 0.90 |
PF00571 | CBS | 0.90 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 59.46 % |
All Organisms | root | All Organisms | 40.54 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000101|DelMOSum2010_c10030719 | All Organisms → cellular organisms → Bacteria | 2958 | Open in IMG/M |
3300000117|DelMOWin2010_c10011840 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia | 4882 | Open in IMG/M |
3300000117|DelMOWin2010_c10054121 | Not Available | 1743 | Open in IMG/M |
3300000117|DelMOWin2010_c10146185 | Not Available | 787 | Open in IMG/M |
3300001940|GOS2222_1021695 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1916 | Open in IMG/M |
3300004097|Ga0055584_100591894 | Not Available | 1158 | Open in IMG/M |
3300004097|Ga0055584_100762862 | Not Available | 1012 | Open in IMG/M |
3300004279|Ga0066605_10136792 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 983 | Open in IMG/M |
3300004461|Ga0066223_1060794 | Not Available | 801 | Open in IMG/M |
3300005239|Ga0073579_1025017 | Not Available | 1891 | Open in IMG/M |
3300005239|Ga0073579_1289427 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 958 | Open in IMG/M |
3300005510|Ga0066825_10141852 | Not Available | 882 | Open in IMG/M |
3300005837|Ga0078893_12493266 | Not Available | 1221 | Open in IMG/M |
3300006193|Ga0075445_10084024 | Not Available | 1207 | Open in IMG/M |
3300006752|Ga0098048_1004943 | All Organisms → cellular organisms → Bacteria | 5169 | Open in IMG/M |
3300006810|Ga0070754_10066441 | Not Available | 1855 | Open in IMG/M |
3300006900|Ga0066376_10130020 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
3300006916|Ga0070750_10050735 | Not Available | 2010 | Open in IMG/M |
3300006920|Ga0070748_1012505 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 3657 | Open in IMG/M |
3300006947|Ga0075444_10100410 | All Organisms → Viruses → Predicted Viral | 1267 | Open in IMG/M |
3300006947|Ga0075444_10199740 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 809 | Open in IMG/M |
3300007276|Ga0070747_1325738 | Not Available | 526 | Open in IMG/M |
3300009071|Ga0115566_10443975 | Not Available | 742 | Open in IMG/M |
3300009077|Ga0115552_1411574 | Not Available | 533 | Open in IMG/M |
3300009172|Ga0114995_10017752 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 4301 | Open in IMG/M |
3300009172|Ga0114995_10132193 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1396 | Open in IMG/M |
3300009172|Ga0114995_10293837 | Not Available | 895 | Open in IMG/M |
3300009409|Ga0114993_10887535 | Not Available | 639 | Open in IMG/M |
3300009420|Ga0114994_10195528 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
3300009422|Ga0114998_10091221 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1512 | Open in IMG/M |
3300009432|Ga0115005_10868136 | Not Available | 728 | Open in IMG/M |
3300009441|Ga0115007_10449216 | Not Available | 847 | Open in IMG/M |
3300009445|Ga0115553_1061874 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1677 | Open in IMG/M |
3300009445|Ga0115553_1117508 | Not Available | 1117 | Open in IMG/M |
3300009472|Ga0115554_1314289 | Not Available | 619 | Open in IMG/M |
3300009476|Ga0115555_1184983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 863 | Open in IMG/M |
3300009505|Ga0115564_10251644 | Not Available | 900 | Open in IMG/M |
3300009505|Ga0115564_10314280 | Not Available | 782 | Open in IMG/M |
3300009505|Ga0115564_10389151 | Not Available | 683 | Open in IMG/M |
3300009512|Ga0115003_10047459 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2731 | Open in IMG/M |
3300009512|Ga0115003_10090377 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1892 | Open in IMG/M |
3300009512|Ga0115003_10105361 | Not Available | 1733 | Open in IMG/M |
3300009512|Ga0115003_10147953 | Not Available | 1427 | Open in IMG/M |
3300009512|Ga0115003_10602538 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 641 | Open in IMG/M |
3300009526|Ga0115004_10134063 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 1504 | Open in IMG/M |
3300009526|Ga0115004_10623869 | Not Available | 639 | Open in IMG/M |
3300009705|Ga0115000_10788820 | Not Available | 584 | Open in IMG/M |
3300009785|Ga0115001_10498182 | Not Available | 752 | Open in IMG/M |
3300010883|Ga0133547_10355995 | Not Available | 3010 | Open in IMG/M |
3300010883|Ga0133547_10946344 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
3300010883|Ga0133547_11296147 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
3300010883|Ga0133547_11298715 | Not Available | 1381 | Open in IMG/M |
3300010883|Ga0133547_11444497 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1295 | Open in IMG/M |
3300011253|Ga0151671_1130500 | Not Available | 662 | Open in IMG/M |
3300017740|Ga0181418_1043698 | Not Available | 1125 | Open in IMG/M |
3300017769|Ga0187221_1136950 | Not Available | 731 | Open in IMG/M |
3300017824|Ga0181552_10199395 | Not Available | 1034 | Open in IMG/M |
3300017950|Ga0181607_10083177 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2060 | Open in IMG/M |
3300019742|Ga0193965_1034882 | Not Available | 885 | Open in IMG/M |
3300020165|Ga0206125_10024648 | Not Available | 3463 | Open in IMG/M |
3300020165|Ga0206125_10075932 | Not Available | 1501 | Open in IMG/M |
3300020165|Ga0206125_10089109 | Not Available | 1337 | Open in IMG/M |
3300020182|Ga0206129_10224671 | Not Available | 810 | Open in IMG/M |
3300020185|Ga0206131_10148660 | Not Available | 1233 | Open in IMG/M |
3300020187|Ga0206130_10149153 | Not Available | 1227 | Open in IMG/M |
3300020335|Ga0211690_1079233 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 718 | Open in IMG/M |
3300020358|Ga0211689_1185518 | Not Available | 569 | Open in IMG/M |
3300020376|Ga0211682_10188738 | Not Available | 803 | Open in IMG/M |
3300020463|Ga0211676_10085670 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2113 | Open in IMG/M |
3300020472|Ga0211579_10006893 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 7970 | Open in IMG/M |
3300021085|Ga0206677_10115979 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1241 | Open in IMG/M |
3300021089|Ga0206679_10400054 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 730 | Open in IMG/M |
3300021365|Ga0206123_10113900 | Not Available | 1274 | Open in IMG/M |
3300021365|Ga0206123_10164875 | Not Available | 1006 | Open in IMG/M |
3300021389|Ga0213868_10169557 | Not Available | 1334 | Open in IMG/M |
3300021957|Ga0222717_10021703 | All Organisms → Viruses → Predicted Viral | 4305 | Open in IMG/M |
3300021957|Ga0222717_10386470 | Not Available | 777 | Open in IMG/M |
3300022187|Ga0196899_1006066 | Not Available | 5077 | Open in IMG/M |
(restricted) 3300023109|Ga0233432_10105897 | Not Available | 1570 | Open in IMG/M |
(restricted) 3300024255|Ga0233438_10208445 | Not Available | 798 | Open in IMG/M |
3300024262|Ga0210003_1089371 | Not Available | 1428 | Open in IMG/M |
(restricted) 3300024264|Ga0233444_10127804 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Halomarinibacterium → Halomarinibacterium sedimenti | 1272 | Open in IMG/M |
3300025083|Ga0208791_1002733 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 5697 | Open in IMG/M |
3300025645|Ga0208643_1029344 | Not Available | 1833 | Open in IMG/M |
3300025696|Ga0209532_1161129 | Not Available | 682 | Open in IMG/M |
3300025853|Ga0208645_1012904 | Not Available | 4988 | Open in IMG/M |
3300025853|Ga0208645_1158847 | Not Available | 850 | Open in IMG/M |
3300025876|Ga0209223_10200671 | Not Available | 974 | Open in IMG/M |
3300025880|Ga0209534_10207412 | Not Available | 974 | Open in IMG/M |
3300025890|Ga0209631_10154084 | Not Available | 1235 | Open in IMG/M |
3300025894|Ga0209335_10320386 | Not Available | 652 | Open in IMG/M |
3300025897|Ga0209425_10077952 | Not Available | 2049 | Open in IMG/M |
3300025897|Ga0209425_10311744 | Not Available | 784 | Open in IMG/M |
3300026253|Ga0208879_1127732 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1055 | Open in IMG/M |
3300027672|Ga0209383_1041727 | All Organisms → Viruses → Predicted Viral | 1777 | Open in IMG/M |
3300027687|Ga0209710_1011388 | Not Available | 5041 | Open in IMG/M |
3300027752|Ga0209192_10244488 | Not Available | 665 | Open in IMG/M |
3300027780|Ga0209502_10277791 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 731 | Open in IMG/M |
3300027780|Ga0209502_10389246 | Not Available | 574 | Open in IMG/M |
3300027788|Ga0209711_10066727 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
3300027791|Ga0209830_10054638 | All Organisms → Viruses → Predicted Viral | 2104 | Open in IMG/M |
3300027813|Ga0209090_10292930 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 810 | Open in IMG/M |
3300028196|Ga0257114_1229592 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 671 | Open in IMG/M |
3300031598|Ga0308019_10329105 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 563 | Open in IMG/M |
3300031629|Ga0307985_10004599 | All Organisms → cellular organisms → Bacteria | 7468 | Open in IMG/M |
3300031637|Ga0302138_10260864 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 564 | Open in IMG/M |
3300031696|Ga0307995_1067538 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1451 | Open in IMG/M |
3300031757|Ga0315328_10773188 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 539 | Open in IMG/M |
3300031851|Ga0315320_10281377 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1193 | Open in IMG/M |
3300031851|Ga0315320_10821924 | Not Available | 581 | Open in IMG/M |
3300034375|Ga0348336_106804 | Not Available | 932 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 31.53% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.01% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.11% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 8.11% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 8.11% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 7.21% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 4.50% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.60% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.70% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.70% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.80% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.80% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.80% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.80% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat | 0.90% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.90% |
Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.90% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.90% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.90% |
Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.90% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.90% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.90% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300001940 | Marine microbial communities from Bay of Fundy, Nova Scotia, Canada - GS006 | Environmental | Open in IMG/M |
3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
3300005510 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 | Environmental | Open in IMG/M |
3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019742 | Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_8_MG | Environmental | Open in IMG/M |
3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
3300020335 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035) | Environmental | Open in IMG/M |
3300020358 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009) | Environmental | Open in IMG/M |
3300020376 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121) | Environmental | Open in IMG/M |
3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
3300021089 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 | Environmental | Open in IMG/M |
3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
3300026253 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A (SPAdes) | Environmental | Open in IMG/M |
3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
3300031629 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80 | Environmental | Open in IMG/M |
3300031637 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_32.1 | Environmental | Open in IMG/M |
3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2010_100307192 | 3300000101 | Marine | MKETIHLKVSKEDKQTIRDFAKSKRMSMTGYIRNEILNK* |
DelMOWin2010_100118405 | 3300000117 | Marine | MKETIHLKVSKEDKQTIRDLAKSKRMTMNSYIRNEILNK* |
DelMOWin2010_100541214 | 3300000117 | Marine | MEQLHLKLSKEDKEIIRDLAKQKRMTMSGYIKNEVLNKEK* |
DelMOWin2010_101461853 | 3300000117 | Marine | METLHLKLSKEDKQIIREKAKAKRLTMNGYIRNELLNKQD* |
GOS2222_10216952 | 3300001940 | Marine | MKETIHLKVSKEDKQTIKDLAKSKRMTMNSYIRNEILNK* |
Ga0055584_1005918941 | 3300004097 | Pelagic Marine | METLHLKLSKEDKQIIRDLAKSKRLTMNGYIRNELLNKQD* |
Ga0055584_1007628622 | 3300004097 | Pelagic Marine | MEQLHLKLSKEDKEIIRGLAKQKRMSMSGYIKNEVLNKK* |
Ga0066605_101367922 | 3300004279 | Marine | MEQLHLKLSKEDKEIIRGLAKQKRMSMTGYIRNEILNKE* |
Ga0066223_10607942 | 3300004461 | Marine | MKETIHLKVSKEDKQLIQKLAKSRRLTMCGYIRNEILNKKVNELIK* |
Ga0073579_10250172 | 3300005239 | Marine | MKETIHLKVSKEDKQFIQKLAKSRRLTMCGYIRNEILNKKVNELIK* |
Ga0073579_12894273 | 3300005239 | Marine | MNNEKAILLRLSKEDKQTIKDLAKSKRMSMTGYIRNEILNK* |
Ga0066825_101418522 | 3300005510 | Marine | METLHLKLSKEDKQIIRDLAKAKRLTMNGYIRNELLNKKD* |
Ga0078893_124932664 | 3300005837 | Marine Surface Water | TMEQLHLKLSKEDKEIIRDLAKSKRMSMTGYIRNEILNKE* |
Ga0075445_100840242 | 3300006193 | Marine | METLHLKLSKEDKQTIKDLAKSKRMSMTGYIRNEILNK* |
Ga0098048_10049434 | 3300006752 | Marine | MEQLHLKLSKEDKEIIRDLAKQKRMTMSGYIRNEILNNKIL* |
Ga0070754_100664412 | 3300006810 | Aqueous | METLHLKLSKEDKQIIRDKAKAKRLTMNGYIRNELLNKQD* |
Ga0066376_101300202 | 3300006900 | Marine | METLHLKLTKEDKQIIRDLAKSKRLSMNGYIRNELLNKIL* |
Ga0070750_100507353 | 3300006916 | Aqueous | METLHLKLSKEDKQIIRELAKSKRLTMNGYIRNELLNKQD* |
Ga0070748_10125051 | 3300006920 | Aqueous | METLHLKLSKEDKQIIRELAKSKRLTMNGYIRNELLNKQN* |
Ga0075444_101004102 | 3300006947 | Marine | MKETIHLKVSKEDKQTIKDLAKSKRMSMTGYIRNELLNKE* |
Ga0075444_101997402 | 3300006947 | Marine | METLHLKLSKEDKQTIKDLAKSKRMSMTGYIRNELLNK* |
Ga0070747_13257382 | 3300007276 | Aqueous | METLHLKLSKEDKQIIRDLAKSKRLTMNGYIRNELLNKLD* |
Ga0115566_104439753 | 3300009071 | Pelagic Marine | MEQLHLKLSKEDKEIIRDLAKQKRMTMSGYIKNEVLNKEN* |
Ga0115552_14115742 | 3300009077 | Pelagic Marine | MEQLHLKLSKEDKKIIRDLAKQKRMTMSGYIKNEILN |
Ga0114995_100177522 | 3300009172 | Marine | METLHLKLSKEDKQIIKDLAKSKRMSMTGYIRNELLNKE* |
Ga0114995_101321934 | 3300009172 | Marine | METLHLKLSKEDKQIIRDLAKSKRMSMNGYIRNELLNKE* |
Ga0114995_102938372 | 3300009172 | Marine | METLHLKLSKEDKQTIKDLAKSKRMSMTGYIRNELLNKE* |
Ga0114993_108875351 | 3300009409 | Marine | METLHLKLSKEDKQTIKDLAKSKRMSMTGYIRNEILNKE* |
Ga0114994_101955282 | 3300009420 | Marine | METLHLKLSKDDKQIIKDLAKSKRMSMTGYIRNEILNKE* |
Ga0114998_100912211 | 3300009422 | Marine | METLHLKLSKDDKQTIRDLAKSKRMSMTGYIRNEILNKE* |
Ga0115005_108681361 | 3300009432 | Marine | METLHLKLSKDDKQIIRDLAKSKRMSMTGYIRNEILNKE* |
Ga0115007_104492162 | 3300009441 | Marine | METLHLKLSKKDKQIIKDLAKSKRMSMTGYIRNEILNKE* |
Ga0115553_10618744 | 3300009445 | Pelagic Marine | MKETIHLKVSKEDKQTIKDLAKSKRMTMNSYIRNEILNKE* |
Ga0115553_11175081 | 3300009445 | Pelagic Marine | NTETLHLKLSKEDKQIIRDLAKSKRLTMNGYIRNELLNK* |
Ga0115554_13142892 | 3300009472 | Pelagic Marine | MKETIHLKVSKEDKETIRDLAKSKRMTMNSYIRNEILNKE* |
Ga0115555_11849831 | 3300009476 | Pelagic Marine | LHLKLSKEDKQIIRDLAKSKRLTMNGYIRNELLNKQD* |
Ga0115564_102516441 | 3300009505 | Pelagic Marine | NMKETIHLKVSKEDKQIIKDLAKSKRMTMNSYIRNEILNK* |
Ga0115564_103142801 | 3300009505 | Pelagic Marine | MKETLHLKLSKEDKQTIKDLAKSKRMSMTGYIRNELLNK* |
Ga0115564_103891511 | 3300009505 | Pelagic Marine | MKETIHLKVSKEDKQTIKDLAKSKRMSMTGYIRNEILNK* |
Ga0115003_100474593 | 3300009512 | Marine | METIHLKLSKEDKQTIRDLAKSKRMSMTGYIRNEILNNKIL* |
Ga0115003_100903773 | 3300009512 | Marine | MKETIHLKVSKEDKQTIRDLAKSKRMTMNGYIRNEILNKE* |
Ga0115003_101053613 | 3300009512 | Marine | MYQEKVVLKLSKEDKQTIKDLAKSKRMSMTGYIRNEILNKE* |
Ga0115003_101479534 | 3300009512 | Marine | METLHLKLSKEDKQIIKDLAKSKRLTMNGYIRNELLNKLD* |
Ga0115003_106025381 | 3300009512 | Marine | METLHLKLSKEDKQIIRDLAKSKRLTMNGYIRNELLNKE* |
Ga0115004_101340635 | 3300009526 | Marine | METLHLKLSKDDKQTIKDLAKSKRMSMTGYIRNEILNK* |
Ga0115004_106238692 | 3300009526 | Marine | MKETIHLKVSKEDKQFIQKLAKSRRLTMCGYIRNEILNKKVNKLIK* |
Ga0115000_107888201 | 3300009705 | Marine | TLHLKLSKEDKQTIKDLAKSKRMSMTGYIRNELLNKQD* |
Ga0115001_104981822 | 3300009785 | Marine | MKETIHLKVSKEDKQFIQKLAKSRRLTMCGYIRNEILNKKVNELVDVTD* |
Ga0133547_103559952 | 3300010883 | Marine | MNNEKAILLRLSKEDKQTIKDLAKSKRLTMNGYIRNELLNKE* |
Ga0133547_109463441 | 3300010883 | Marine | METLHLKLSKKDKQTIKDLAKSKRMSMTGYIRNEILNKE* |
Ga0133547_112961472 | 3300010883 | Marine | MKNDNAILLRLSKEDKQTIRDLAKSKRMSMTGYIRNEILNKK* |
Ga0133547_112987152 | 3300010883 | Marine | METLHLKLSKDDKQTIKDLAKSKRMSMTGYIRNEILNKE* |
Ga0133547_114444973 | 3300010883 | Marine | METLHLKLSKEDKQIIKDLAKSKRMTMNGYIRNELLNKE* |
Ga0151671_11305001 | 3300011253 | Marine | MEQLHLKLSKEDKEIIRGLAKQKRMSMSGYIKNEVLNKED* |
Ga0181418_10436982 | 3300017740 | Seawater | MKETIHLKVSKEDKQFIQKLAKSRRLTMCGYIRNEILNKKVNELIK |
Ga0187221_11369503 | 3300017769 | Seawater | METIHLKLSKEDKQTIRDLAKSKRMSMAGYIRNEILN |
Ga0181552_101993952 | 3300017824 | Salt Marsh | MEQLHLKLSKEDKEIIRDLAKQKRMTMSGYIKNEVLNKQK |
Ga0181607_100831773 | 3300017950 | Salt Marsh | MEQLHLKLSKKDKEIIRGLAKQKRMTMSGYIRNELLNKE |
Ga0193965_10348822 | 3300019742 | Freshwater Microbial Mat | METLHLKLSKEDKQIIREKAKAKRLTMNGYIRNELLNKQD |
Ga0206125_100246483 | 3300020165 | Seawater | MKETIHLKVSKEDKQTIRDLAKSKRMTMNSYIRNEILNK |
Ga0206125_100759322 | 3300020165 | Seawater | MEQLHLKLSKEDKEIIRDLAKQKRMTMSGYIKNEILNK |
Ga0206125_100891094 | 3300020165 | Seawater | METLHLKLSKEDKQIIRELAKSKRLTMNGYIRNELLNKQN |
Ga0206129_102246711 | 3300020182 | Seawater | METLHLKLSKEDKQIIRELAKSKRLTMNGYIRNELLNKQD |
Ga0206131_101486602 | 3300020185 | Seawater | MEQLHLKLSKEDKEIIRDLAKQKRMTMSGYIKNEVLNKEN |
Ga0206130_101491532 | 3300020187 | Seawater | METLHLKLSKEDKQTIKDLAKSKRMSMTGYIRNELLNK |
Ga0211690_10792331 | 3300020335 | Marine | METIHLKLSKEDKQTIKDLAKSKRMSMTGYIRNEILNKE |
Ga0211689_11855182 | 3300020358 | Marine | MKETIHLKVSKEDKQTIKDLAKSKRMSMTGYIRNEILNK |
Ga0211682_101887381 | 3300020376 | Marine | METLHLKLSKEDKQTIKDLAKSKRMSMTGYIKNEILNKE |
Ga0211676_100856705 | 3300020463 | Marine | MTETIHLRVSKEDKEIIKDLAKSKRLSVNGYIRDAILNKQSPTQC |
Ga0211579_100068938 | 3300020472 | Marine | METIHLKLSKEDKQTIRDLAKSKRMSMTGYIRNEILNNKIL |
Ga0206677_101159791 | 3300021085 | Seawater | MKETIHLKVSKEDKQTIKDLAKSKRMTMNSYIRNEI |
Ga0206679_104000541 | 3300021089 | Seawater | METIHLKLSKEDKQTIRDLAKSKRMSMTGYIRNEILNKE |
Ga0206123_101139002 | 3300021365 | Seawater | METLHLKLSKEDKQIIRDLAKQKRMTMSGYIKNEILNK |
Ga0206123_101648751 | 3300021365 | Seawater | FLLNMETLHLKLSKEDKQIIRDLAKSKRLTMNGYIRNELLNK |
Ga0213868_101695573 | 3300021389 | Seawater | MNNEKAILLRLSKEDKQTIKDLAKSKRMSMTGYIRNELLNKE |
Ga0222717_100217033 | 3300021957 | Estuarine Water | METLHLKLSKEDKQIIKDLAKSKRLTMNGYIRNELLNKLD |
Ga0222717_103864703 | 3300021957 | Estuarine Water | METLHLKLSKEDKQIIRDLAKSKRLTMNGYIRNELLNKQD |
Ga0196899_100606612 | 3300022187 | Aqueous | LKLSKEDKQIIREKAKAKRLTMNGYIRNELLNKQD |
(restricted) Ga0233432_101058976 | 3300023109 | Seawater | MEQLHLKLSKEDKEIIRGLAKQKRMSMSGYIKNEVLNKED |
(restricted) Ga0233438_102084452 | 3300024255 | Seawater | METLHLKLSKEDKQIIRDLAKSKRLTMNGYIRNELLNKQN |
Ga0210003_10893713 | 3300024262 | Deep Subsurface | METLHLKLTKQDKEIIRDLAKSKRMTMNAYIRNEILNKKFL |
(restricted) Ga0233444_101278042 | 3300024264 | Seawater | MKNEKAILLRLSKEDKQTIKDLAKQKRMSMSGYIKNEILNKE |
Ga0208791_10027334 | 3300025083 | Marine | MEQLHLKLSKEDKEIIRDLAKQKRMTMSGYIRNEILNNKIL |
Ga0208643_10293442 | 3300025645 | Aqueous | METLHLKLSKEDKQIIRELAKSKRLTMNGYIRNELLNKLD |
Ga0209532_11611293 | 3300025696 | Pelagic Marine | MKETIHLKVSKEDKQTIKDLAKSKRMSMTGYIRNELLNK |
Ga0208645_10129043 | 3300025853 | Aqueous | METLHLKLSKEDKQIIRDKAKAKRLTMNGYIRNELLNKQD |
Ga0208645_11588473 | 3300025853 | Aqueous | MEQLHLKLSKEDKEIIRDLAKQKRMTMSGYIKNEVLNKEK |
Ga0209223_102006712 | 3300025876 | Pelagic Marine | METLHLKLTKEDKEIIRDLAKSKRLTMNGYIRNELLNKQN |
Ga0209534_102074122 | 3300025880 | Pelagic Marine | METLHLKLTKEDKEIIRDLAKSKRLTMNGYIRNELLNNKIL |
Ga0209631_101540842 | 3300025890 | Pelagic Marine | METLHLKLSKEDKQIIRDLAKSKRLTMNGYIRNELLNK |
Ga0209335_103203863 | 3300025894 | Pelagic Marine | KETIHLKVSKEDKQTIRDLAKSKRMTMNSYIRNEILNK |
Ga0209425_100779522 | 3300025897 | Pelagic Marine | MNNEKAILLRLSKEDKQTIKDLAKSKRMSMTGYIRNEILNKE |
Ga0209425_103117443 | 3300025897 | Pelagic Marine | MKETIHLKVSKEDKETIRDLAKSKRMTMNSYIRNEILNKE |
Ga0208879_11277323 | 3300026253 | Marine | METLHLKLTKEDKQIIRDLAKSKRLSMNGYIRNELLNKIL |
Ga0209383_10417273 | 3300027672 | Marine | METLHLKLSKEDKQTIKDLAKSKRMSMTGYIRNEILNK |
Ga0209710_10113882 | 3300027687 | Marine | METLHLKLSKEDKQIIKDLAKSKRMSMTGYIRNELLNKE |
Ga0209192_102444882 | 3300027752 | Marine | METLHLKLSKEDKQIIRDLAKSKRMSMNGYIRNELLNKE |
Ga0209502_102777912 | 3300027780 | Marine | METLHLKLSKDDKQTIKDLAKSKRMSMTGYIRNEILNK |
Ga0209502_103892461 | 3300027780 | Marine | MKETIHLKVSKEDKQFIQKLAKSRRLTMCGYIRNEIL |
Ga0209711_100667273 | 3300027788 | Marine | MKETIHLKVSKEDKQTIRDLAKSKRMTMNGYIRNEILNKE |
Ga0209830_100546383 | 3300027791 | Marine | METLHLKLSKEDKQIIKDLAKSKRMSMTGYIRNELLNK |
Ga0209090_102929302 | 3300027813 | Marine | METLHLKLSKDDKQIIKDLAKSKRMSMTGYIRNEILNKE |
Ga0257114_12295922 | 3300028196 | Marine | MKETIHLKVSKEDKQTIKDLAKSKRMTMNSYIRNEILNKK |
Ga0308019_103291051 | 3300031598 | Marine | METLHLKLSKEDKQTIKDLAKSKRMSMTGYIRNEILNKE |
Ga0307985_100045993 | 3300031629 | Marine | MKETIHLKLSKEDKEIIRDLAKSKRLSMNGYIRNELLNKKE |
Ga0302138_102608643 | 3300031637 | Marine | IITFINMETIHLKLSKEDKQTIRDLAKSKRMSMTGYIRNEILNNKIL |
Ga0307995_10675383 | 3300031696 | Marine | METLHLKLSKEDKQTIKDLAKSKRLSMNGYIRNELLNKKE |
Ga0315328_107731881 | 3300031757 | Seawater | METIHLKLSKEDKQTIRDLAKSKRMSMTGYIRNEILNN |
Ga0315320_102813771 | 3300031851 | Seawater | MKETIHLKVSKEDKQTIRDLAKSKRMTMNSYIRNEIL |
Ga0315320_108219242 | 3300031851 | Seawater | METIHLKLSKEDKQTIRDLAKSKRMSMAGYIRNEILNNKIL |
Ga0348336_106804_821_931 | 3300034375 | Aqueous | HLKLSKEDKEIIRDLAKQKRMTMSGYIKNEVLNKEK |
⦗Top⦘ |