Metagenome Family F085911

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F085911
Family Type	Metagenome
Number of Sequences	111
Average Sequence Length	38 residues
Representative Sequence	MWASGHNGDIKRAAHGYEATREAAMAAFAKSWRRE
Number of Associated Samples	61
Number of Associated Scaffolds	111

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	42.45 %
% of genes near scaffold ends (potentially truncated)	45.95 %
% of genes from short scaffolds (< 2000 bps)	86.49 %
Associated GOLD sequencing projects	58
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (54.054 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (22.523 % of family members)
Environment Ontology (ENVO)	Unclassified (33.333 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (45.045 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 46.03% β-sheet: 0.00% Coil/Unstructured: 53.97%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 111 Family Scaffolds
PF04392	ABC_sub_bind	2.70
PF14279	HNH_5	1.80
PF11185	DUF2971	1.80
PF03401	TctC	0.90
PF04120	Iron_permease	0.90
PF06411	HdeA	0.90
PF12787	EcsC	0.90
PF14232	DUF4334	0.90
PF00027	cNMP_binding	0.90
PF00111	Fer2	0.90
PF01300	Sua5_yciO_yrdC	0.90
PF00589	Phage_integrase	0.90
PF02265	S1-P1_nuclease	0.90
PF13414	TPR_11	0.90
PF00313	CSD	0.90
PF01381	HTH_3	0.90
PF01594	AI-2E_transport	0.90
PF13192	Thioredoxin_3	0.90
PF03869	Arc	0.90
PF13751	DDE_Tnp_1_6	0.90
PF05036	SPOR	0.90
PF01266	DAO	0.90
PF13557	Phenol_MetA_deg	0.90
PF07396	Porin_O_P	0.90
PF03466	LysR_substrate	0.90
PF06114	Peptidase_M78	0.90
PF12244	DUF3606	0.90

COG ID	Name	Functional Category	% Frequency in 111 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	2.70
COG0628	Predicted PurR-regulated permease PerM	General function prediction only [R]	0.90
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.90
COG3746	Phosphate-selective porin	Inorganic ion transport and metabolism [P]	0.90

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
All Organisms	root	All Organisms	45.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
cellular organisms	root	All Organisms → cellular organisms	45.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	45.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	33.33 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	29.73 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	11.71 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	9.01 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.90 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	8.11 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	6.31 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	1.80 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.90 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.90 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	8.11 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4.50 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	1.80 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.90 %
Roseicella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseicella	0.90 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	8.11 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	1.80 %
Roseicella frigidaeris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseicella → Roseicella frigidaeris	0.90 %
Mesorhizobium erdmanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium erdmanii	0.90 %
unclassified Planctomycetaceae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae	0.90 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	8.11 %
Bradyrhizobium sp. CCBAU 15635	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 15635	1.80 %
Planctomycetaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	0.90 %
Roseicella frigidaeris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseicella → Roseicella frigidaeris	0.90 %
Mesorhizobium erdmanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium erdmanii	0.90 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.90 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2035918004\|FACENC_F56XM5W01EUEEG	Not Available	517	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_100460863	Not Available	537	Open in IMG/M
3300000955\|JGI1027J12803_104961284	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1792	Open in IMG/M
3300002568\|C688J35102_120863317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1881	Open in IMG/M
3300005093\|Ga0062594_101626467	Not Available	670	Open in IMG/M
3300005332\|Ga0066388_103600825	Not Available	791	Open in IMG/M
3300005332\|Ga0066388_103820881	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	768	Open in IMG/M
3300005544\|Ga0070686_100448392	Not Available	991	Open in IMG/M
3300005713\|Ga0066905_100079858	All Organisms → cellular organisms → Bacteria → Proteobacteria	2145	Open in IMG/M
3300005713\|Ga0066905_100294148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1271	Open in IMG/M
3300005713\|Ga0066905_100576864	All Organisms → cellular organisms → Bacteria → Proteobacteria	948	Open in IMG/M
3300005713\|Ga0066905_100633395	Not Available	909	Open in IMG/M
3300005713\|Ga0066905_100713918	All Organisms → cellular organisms → Bacteria	862	Open in IMG/M
3300005713\|Ga0066905_100817453	Not Available	809	Open in IMG/M
3300005713\|Ga0066905_101695920	Not Available	580	Open in IMG/M
3300005713\|Ga0066905_101978964	Not Available	540	Open in IMG/M
3300005764\|Ga0066903_100137937	All Organisms → cellular organisms → Bacteria	3457	Open in IMG/M
3300005764\|Ga0066903_102112649	All Organisms → cellular organisms → Bacteria	1084	Open in IMG/M
3300005764\|Ga0066903_102195906	Not Available	1064	Open in IMG/M
3300005764\|Ga0066903_102472686	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1005	Open in IMG/M
3300005764\|Ga0066903_108514436	Not Available	523	Open in IMG/M
3300005764\|Ga0066903_108751021	Not Available	514	Open in IMG/M
3300005764\|Ga0066903_108863689	Not Available	510	Open in IMG/M
3300005937\|Ga0081455_10003645	All Organisms → cellular organisms → Bacteria	17644	Open in IMG/M
3300005937\|Ga0081455_10018692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6582	Open in IMG/M
3300005937\|Ga0081455_10077784	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2728	Open in IMG/M
3300005937\|Ga0081455_10477852	Not Available	844	Open in IMG/M
3300005937\|Ga0081455_10625877	Not Available	697	Open in IMG/M
3300005937\|Ga0081455_10746606	Not Available	619	Open in IMG/M
3300006038\|Ga0075365_10405123	Not Available	963	Open in IMG/M
3300006051\|Ga0075364_10096056	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1971	Open in IMG/M
3300006051\|Ga0075364_10303055	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1088	Open in IMG/M
3300006177\|Ga0075362_10171479	Not Available	1048	Open in IMG/M
3300006844\|Ga0075428_100833262	All Organisms → cellular organisms → Bacteria	980	Open in IMG/M
3300006844\|Ga0075428_100876097	Not Available	953	Open in IMG/M
3300006844\|Ga0075428_102085509	Not Available	587	Open in IMG/M
3300006844\|Ga0075428_102254291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	561	Open in IMG/M
3300006845\|Ga0075421_100939264	Not Available	984	Open in IMG/M
3300006845\|Ga0075421_101952357	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	627	Open in IMG/M
3300006845\|Ga0075421_101962140	Not Available	625	Open in IMG/M
3300006846\|Ga0075430_100948254	Not Available	709	Open in IMG/M
3300006846\|Ga0075430_101521576	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseicella → Roseicella frigidaeris	550	Open in IMG/M
3300006846\|Ga0075430_101646345	Not Available	527	Open in IMG/M
3300006847\|Ga0075431_100457834	Not Available	1271	Open in IMG/M
3300006847\|Ga0075431_100702692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	989	Open in IMG/M
3300006847\|Ga0075431_101196731	Not Available	723	Open in IMG/M
3300006847\|Ga0075431_101519604	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	628	Open in IMG/M
3300006853\|Ga0075420_100512895	Not Available	1036	Open in IMG/M
3300006880\|Ga0075429_100763625	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	847	Open in IMG/M
3300006880\|Ga0075429_101427689	All Organisms → cellular organisms → Bacteria	603	Open in IMG/M
3300009100\|Ga0075418_10813934	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1009	Open in IMG/M
3300009147\|Ga0114129_10980875	All Organisms → cellular organisms → Bacteria	1065	Open in IMG/M
3300009147\|Ga0114129_11032675	Not Available	1033	Open in IMG/M
3300009147\|Ga0114129_13411442	Not Available	511	Open in IMG/M
3300009156\|Ga0111538_10320551	Not Available	1962	Open in IMG/M
3300009162\|Ga0075423_12300047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	586	Open in IMG/M
3300009792\|Ga0126374_10812561	Not Available	716	Open in IMG/M
3300010043\|Ga0126380_11544433	Not Available	590	Open in IMG/M
3300010046\|Ga0126384_10651241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium erdmanii	928	Open in IMG/M
3300010046\|Ga0126384_11270944	Not Available	681	Open in IMG/M
3300010047\|Ga0126382_10683711	Not Available	858	Open in IMG/M
3300010047\|Ga0126382_11941511	Not Available	558	Open in IMG/M
3300010362\|Ga0126377_13409589	Not Available	514	Open in IMG/M
3300010366\|Ga0126379_10556301	Not Available	1227	Open in IMG/M
3300010366\|Ga0126379_13534891	Not Available	523	Open in IMG/M
3300010398\|Ga0126383_10941871	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	951	Open in IMG/M
3300010398\|Ga0126383_12790869	Not Available	570	Open in IMG/M
3300012204\|Ga0137374_10106772	All Organisms → cellular organisms → Bacteria → Proteobacteria	2620	Open in IMG/M
3300012209\|Ga0137379_10225350	All Organisms → cellular organisms → Bacteria	1789	Open in IMG/M
3300012356\|Ga0137371_10777838	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	730	Open in IMG/M
3300012948\|Ga0126375_11471957	Not Available	581	Open in IMG/M
3300012948\|Ga0126375_11661452	Not Available	552	Open in IMG/M
3300014969\|Ga0157376_11167046	Not Available	797	Open in IMG/M
3300015371\|Ga0132258_11522439	Not Available	1689	Open in IMG/M
3300015371\|Ga0132258_11547295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1675	Open in IMG/M
3300015372\|Ga0132256_101154984	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	888	Open in IMG/M
3300015372\|Ga0132256_103794749	Not Available	508	Open in IMG/M
3300015373\|Ga0132257_101279879	Not Available	930	Open in IMG/M
3300015373\|Ga0132257_101789982	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	789	Open in IMG/M
3300015373\|Ga0132257_101957235	All Organisms → cellular organisms → Bacteria	755	Open in IMG/M
3300015374\|Ga0132255_103535268	Not Available	665	Open in IMG/M
3300015374\|Ga0132255_103717527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	648	Open in IMG/M
3300015374\|Ga0132255_105596466	Not Available	532	Open in IMG/M
3300016294\|Ga0182041_10714004	All Organisms → cellular organisms → Bacteria	890	Open in IMG/M
3300016404\|Ga0182037_10296742	All Organisms → cellular organisms → Bacteria	1297	Open in IMG/M
3300021510\|Ga0222621_1110393	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300027646\|Ga0209466_1098763	Not Available	591	Open in IMG/M
3300027748\|Ga0209689_1030976	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3183	Open in IMG/M
3300027909\|Ga0209382_11120037	Not Available	811	Open in IMG/M
3300027909\|Ga0209382_11222146	Not Available	767	Open in IMG/M
3300028784\|Ga0307282_10325882	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 15635	741	Open in IMG/M
3300028796\|Ga0307287_10274034	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 15635	638	Open in IMG/M
3300028814\|Ga0307302_10171274	Not Available	1055	Open in IMG/M
3300028814\|Ga0307302_10191164	Not Available	998	Open in IMG/M
3300031184\|Ga0307499_10217581	Not Available	595	Open in IMG/M
3300031573\|Ga0310915_10062074	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2440	Open in IMG/M
3300031573\|Ga0310915_10077300	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	2206	Open in IMG/M
3300031573\|Ga0310915_10375199	Not Available	1009	Open in IMG/M
3300031679\|Ga0318561_10739056	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	541	Open in IMG/M
3300031747\|Ga0318502_11035301	Not Available	501	Open in IMG/M
3300031748\|Ga0318492_10357509	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	765	Open in IMG/M
3300031765\|Ga0318554_10332197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	864	Open in IMG/M
3300031910\|Ga0306923_10125167	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2920	Open in IMG/M
3300031941\|Ga0310912_10257078	All Organisms → cellular organisms → Bacteria	1345	Open in IMG/M
3300031942\|Ga0310916_10391749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1182	Open in IMG/M
3300031959\|Ga0318530_10471209	All Organisms → cellular organisms → Bacteria → Proteobacteria	521	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	58.56%
Host-Associated	Host-Associated	41.44%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	57.66%
Plants	Host-Associated → Plants	41.44%
Aquatic	Environmental → Aquatic	0.90%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	57.66%
Rhizosphere	Host-Associated → Plants → Rhizosphere	25.23%
Rhizoplane	Host-Associated → Plants → Rhizoplane	12.61%
Roots	Host-Associated → Plants → Roots	3.60%
Sediment	Environmental → Aquatic → Sediment	0.90%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	37.84%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	23.42%
Loam	Environmental → Terrestrial → Soil → Loam	19.82%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	7.21%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.41%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	3.60%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.80%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.90%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	23.42%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	20.72%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	18.02%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	13.51%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	7.21%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.41%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	3.60%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.70%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.80%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.90%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.90%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.90%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.90%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	22.52%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	18.02%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	11.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	10.81%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	7.21%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.41%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	5.41%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	3.60%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.70%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.70%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.70%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.80%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.90%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.90%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.90%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.90%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.90%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.90%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2035918004	Soil microbial communities from sample at FACE Site 2 North Carolina CO2-	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006051	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Host-Associated	Open in IMG/M
3300006177	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300021510	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex	Environmental	Open in IMG/M
3300027646	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027748	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028796	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300031152	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S	Environmental	Open in IMG/M
3300031184	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031679	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23	Environmental	Open in IMG/M
3300031713	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22	Environmental	Open in IMG/M
3300031747	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22	Environmental	Open in IMG/M
3300031748	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22	Environmental	Open in IMG/M
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031959	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FACENCA_2759600	2035918004	Soil	MMWASGHNGEIKRAAHGYEPTREAAMAAFAKSWRRELKA
INPhiseqgaiiFebDRAFT_1004608632	3300000364	Soil	MWASGHNADIKRAAHGYEATREAGTAAFAKXWRRG*
JGI1027J12803_1049612848	3300000955	Soil	WMWASGHNGDIRRAAHGYEATREQAMAAFKRSWHREG*
C688J35102_1208633173	3300002568	Soil	MWASGHSADSIKRAAHGYEPTREAAMAVFAKSWRRCQPPIE*
Ga0062594_1016264672	3300005093	Soil	ASGHSADSIKRAAHGYEPTREAAMAVFAKSWRRCQPPIE*
Ga0066388_1036008252	3300005332	Tropical Forest Soil	PEGRPWMWASGHGGHHIERAAHGYEATREAAMTAFAKSWGRQ*
Ga0066388_1038208812	3300005332	Tropical Forest Soil	SDRPWMWASGHNGDFRRVAHGYESTCEAAMEAFARSWQRD*
Ga0070686_1004483921	3300005544	Switchgrass Rhizosphere	MWASGHSADSIKRATHGYEPTREQAMAAFAKSWRRCQPPIE*
Ga0066905_1000798585	3300005713	Tropical Forest Soil	MWASGHSADSVKRAAHGYEATREAAMAAFAKSWRRE*
Ga0066905_1002941482	3300005713	Tropical Forest Soil	LDVASGHNGDIKRAAYGYEPTREDAMAAFAKSWRRE*
Ga0066905_1005768643	3300005713	Tropical Forest Soil	MWASGHNGEIRRAAHGNESTREAAMKAFAKSWRRE*
Ga0066905_1006333953	3300005713	Tropical Forest Soil	MMRGLDVGGGHGGHIKRAAHGYEATREAAMAAFAKSWRRR*
Ga0066905_1007139181	3300005713	Tropical Forest Soil	WMWASGHNGDIKRAACGYEETREVAMAAFAKSWRREI*
Ga0066905_1008174532	3300005713	Tropical Forest Soil	MWASGHSADSVKRAAHGYEATREAAMAAFAKSWRRD*
Ga0066905_1016959201	3300005713	Tropical Forest Soil	MWASGHGGHHIERAAHGYEATREAAMAAFAKSWPRE*
Ga0066905_1019789641	3300005713	Tropical Forest Soil	WASGHGGHIKRAAHGYEPTREAAMEAFAKSWRCERPKERSPV*
Ga0066903_1001379373	3300005764	Tropical Forest Soil	MWASGHSADSIERAAHGYEATREAAIAAFAKSYSPR*
Ga0066903_1021126495	3300005764	Tropical Forest Soil	MWASGHNGDFSRVAHGHAPTREDALAAFAKSWRRV*
Ga0066903_1021959062	3300005764	Tropical Forest Soil	MWASGHDGDIKRAAYGYEATREAAMAAFAKSWHGS*
Ga0066903_1024726863	3300005764	Tropical Forest Soil	MWASGHGGHIERAAHGYEATREAGMAAFAKSWRRKPG
Ga0066903_1042768111	3300005764	Tropical Forest Soil	MWASGHGGHVKRAAHGYEPTREAAMAAFARAGGRS
Ga0066903_1046219621	3300005764	Tropical Forest Soil	ARGVGEHNGHGDIKRAAHGYEATREAAMAAFANSWRRE*
Ga0066903_1085144362	3300005764	Tropical Forest Soil	MWASGHSAATIKRAAHGYEPKREAAMAAFAKSWRRQLQD*
Ga0066903_1087510212	3300005764	Tropical Forest Soil	MWASGHNGDIKRAARGYEPTREAAMAAFAKSWRRGGALG*
Ga0066903_1088636892	3300005764	Tropical Forest Soil	LEWASGHNGDIKRAAHGYETREAATAAFAKSWRRGGALG*
Ga0081455_1000364533	3300005937	Tabebuia Heterophylla Rhizosphere	MWASGHNGQIARAHGYEPTREAAMAAFAKSWRGWELAKAGR*
Ga0081455_100186928	3300005937	Tabebuia Heterophylla Rhizosphere	MWASGHNGDIKRAAHGYEPTREAAMAAFAKSWRK*
Ga0081455_100777842	3300005937	Tabebuia Heterophylla Rhizosphere	MWASGHDGQIRRAAHGYEPTRAAAMAAFAKSWRGK*
Ga0081455_104778523	3300005937	Tabebuia Heterophylla Rhizosphere	MRASGHNGDIKRAAHGYEATREAAMAAFAKSWRRS*
Ga0081455_106258772	3300005937	Tabebuia Heterophylla Rhizosphere	MDFRNSELRRAAHGYEATREAAMAAFAKSWRRGYG*
Ga0081455_107466062	3300005937	Tabebuia Heterophylla Rhizosphere	MWASGHSAATVKRAAHGYEATREAAMAAFAESWRRS
Ga0075365_104051232	3300006038	Populus Endosphere	MLWASGHNGDIRRTAHGYEPTREAAMAAFAKNWRRQ*
Ga0075364_100960561	3300006051	Populus Endosphere	MWASGHSAATVKRAAHGYERTREAAMAAFAKSWRRS*
Ga0075364_103030553	3300006051	Populus Endosphere	PQERARMWASGHNGDIPCAALGDEPTREAAMAAFAKSRRRE*
Ga0075362_101714792	3300006177	Populus Endosphere	MRASGHSADSVSRAAHGYEPTREAAMAAFAKSWRRA*
Ga0075428_1008332622	3300006844	Populus Rhizosphere	PQDRHWMWASGHNGQIRGAAHGYEATREAAMAAFAKSWRME*
Ga0075428_1008760972	3300006844	Populus Rhizosphere	MWASGHSAATVKRAAHGYEPTREAAMAAFAKSWRR
Ga0075428_1020855091	3300006844	Populus Rhizosphere	MDVGDGHSAATVERAAHGYEPTREAAMAAFAKSWR
Ga0075428_1022542912	3300006844	Populus Rhizosphere	GRSWKWASGHNGDYRRAAHGYEPTRESAMAAFAKSWRRSTP*
Ga0075421_1009392641	3300006845	Populus Rhizosphere	MTEGGQVWASGHSAAMVKRAAHGYEPTREAVMAAFAKSRRRE
Ga0075421_1019523571	3300006845	Populus Rhizosphere	RPWMWASGHSAATVKRAAHGYEATREAAMAAFAKSWRGE*
Ga0075421_1019621401	3300006845	Populus Rhizosphere	MWSSGHSGEIRRAAHGYETTREAAMAAFAKSWRRE*
Ga0075430_1009482542	3300006846	Populus Rhizosphere	MWASGHNGDIKRAAYGYEPTREAAMAAFAKSWRRQ*
Ga0075430_1015215761	3300006846	Populus Rhizosphere	MWASGHNGDIKRAAHGYEPTREAAMAAFAKSWRC*
Ga0075430_1016463451	3300006846	Populus Rhizosphere	MWASGHSAATVKRAAHGYEATREEAMAAFAKSWHGQR*
Ga0075431_1004578344	3300006847	Populus Rhizosphere	MWASGHNGDIRRAAHGYEATREAAMAAFAKSWRRQ*
Ga0075431_1007026921	3300006847	Populus Rhizosphere	WMWASGHSAATVKRAVHGYEPTREAAMAAFKKSWRRE*
Ga0075431_1011967313	3300006847	Populus Rhizosphere	GRPWMWASGHSAATVKRAAHGYEATREAAMAAFAKSWRRQ*
Ga0075431_1015196041	3300006847	Populus Rhizosphere	WMWASGHSAATIKRAAHGYETTREAAMAAFAKSWRVDSR*
Ga0075420_1005128952	3300006853	Populus Rhizosphere	MDVGDGHSAATVERAAHGYEPTREAAMAAFAKSWRRE*
Ga0075429_1007636252	3300006880	Populus Rhizosphere	QERPWMWASGHNGDIRRAAFGYEPTREAAMAAFAKSWRRE*
Ga0075429_1014276891	3300006880	Populus Rhizosphere	MWASGHNGDYRRAAHRYEPTREAAMQAFAKSWRGARELP
Ga0075418_108139342	3300009100	Populus Rhizosphere	MGWGSGHSAAVKRAAHGYEPTREAAMAAFAKSWRRR*
Ga0114129_109808753	3300009147	Populus Rhizosphere	MWASGHNGDIRRAAHGYEPTREAAMAAFGKSWRRE*
Ga0114129_110326752	3300009147	Populus Rhizosphere	WGWASGHSAATIRRAAHGYETTREAAVAAFAKSWRRQ*
Ga0114129_134114422	3300009147	Populus Rhizosphere	MWTSGHNGPVRRAAHGCEAAREDAMKAFAKSWRRRS*
Ga0111538_103205514	3300009156	Populus Rhizosphere	GPALDVASRHNGDIKRAAHGYEATREAAMAAFAKSWRPE*
Ga0075423_123000471	3300009162	Populus Rhizosphere	MWASGHNGAIERAAHGYEPTREAALAAFAKSWRRE*
Ga0126374_108125611	3300009792	Tropical Forest Soil	PWMWASGHNGDIKRAAHGYEPTREAAMAAFAKSWRQQ*
Ga0126380_115444331	3300010043	Tropical Forest Soil	WASGHNGDIKRAAHGYEPTREAAMAAFAKSWRRE*
Ga0126384_106512411	3300010046	Tropical Forest Soil	MWASGHNGDINRGAHGYKPTREAAMAAFTKSWRRK*
Ga0126384_112709441	3300010046	Tropical Forest Soil	RPWMWASGHSADSINRAAHGYEPTREAAMAAFAKSWRRE*
Ga0126382_106837111	3300010047	Tropical Forest Soil	MWASGHNRDIRCAAHGYEPTREAAMASFAKSWRRQ*
Ga0126382_119415112	3300010047	Tropical Forest Soil	WMWASGHGGHHIERAAHGYEATREAAMAAFAKSWRRE*
Ga0126377_134095892	3300010362	Tropical Forest Soil	MWASGHDGQIKRAALGYEPTREAAMAAFAKSWRRDC*
Ga0126379_105563012	3300010366	Tropical Forest Soil	MWASGHNGDIKRAAHGYEPTREAAMAAFAKSWRRGGALG*
Ga0126379_135348912	3300010366	Tropical Forest Soil	PWMWASGYNGEIKRAAHGYAATREEAMSAFAKSWRGEW*
Ga0126383_109418711	3300010398	Tropical Forest Soil	MRASGHNGDIRRALHGYEPPREAAMAAFAKSWRRE*
Ga0126383_127908692	3300010398	Tropical Forest Soil	SGHSADSVKRAAHGYEATREAAMAAFAKSWRPES*
Ga0137374_101067723	3300012204	Vadose Zone Soil	MWASGHNGQIRRAAHGYEATREAAMAAFAKSWRREHQ*
Ga0137379_102253502	3300012209	Vadose Zone Soil	MWASGHNRDIRRAAHGYEATRKAAMAAFSKSWRRE*
Ga0137371_107778383	3300012356	Vadose Zone Soil	LDVGSGHNGYIRRAAHGYEPTREAAMAAFAKSWRRE*
Ga0126375_114719571	3300012948	Tropical Forest Soil	VGSGHNGDIKRAAHGYEPTREAAMAAFAKSWRRR*
Ga0126375_116614522	3300012948	Tropical Forest Soil	MWASGHNGDIKRAAHGYEATREAAMAAFAKSWRRE*
Ga0157376_111670461	3300014969	Miscanthus Rhizosphere	HSADSIKRAAHGYEPTREAAMAVFAKSWRRCQPPIE*
Ga0132258_115224391	3300015371	Arabidopsis Rhizosphere	QGRPWMWASGHSAAPVKRAAHGYEATREAAMAAFAKSWRR*
Ga0132258_115472952	3300015371	Arabidopsis Rhizosphere	MWTSGHNGDIRRAAHGYEQTREAAMEALANSWRCEGTAN*
Ga0132256_1011549842	3300015372	Arabidopsis Rhizosphere	MWTSGHNGDIKRAAYGYEPTREAAMAAFAKSWKR*
Ga0132256_1037947491	3300015372	Arabidopsis Rhizosphere	MWASGHSADSISRAAHGYEATREAAMTAFAKSWRRD*
Ga0132257_1012798792	3300015373	Arabidopsis Rhizosphere	MWASGHNGEIRRAAYGYEPTREAAMAAFAKSWQQE*
Ga0132257_1017899821	3300015373	Arabidopsis Rhizosphere	LPLLIAVKTGSPHNGDLRRAAHGYEQTREAAMAAFAKSWRRE*
Ga0132257_1019572351	3300015373	Arabidopsis Rhizosphere	MWASGHGGRRIRDAAHGYEATREAAMAAFAKSWRRKEA*
Ga0132255_1035352681	3300015374	Arabidopsis Rhizosphere	EGRPWMWASGHGGHIERAAHGYEATREAAMAAFAKSWRRQ*
Ga0132255_1037175273	3300015374	Arabidopsis Rhizosphere	PQDRPWMWAGGHNGDIRRAAHGYEATREAAMAAFAKSWRRR*
Ga0132255_1055964661	3300015374	Arabidopsis Rhizosphere	MWASGHGGRIERTAHGYEATREAAMAAFAKSWRQDMAKQI*
Ga0182041_107140042	3300016294	Soil	APWMWASGHNGDIKRAAYGYEATREAAMAAFSKSWRREL
Ga0182037_102967423	3300016404	Soil	VRRVWANGHNSDTIRRAAHGYEATREAAMAAFAKGWRQE
Ga0222621_11103931	3300021510	Groundwater Sediment	PQDRQWMWSSGHDGDIRRAAHGYEATREAAMAAFAKSWQNE
Ga0209466_10987632	3300027646	Tropical Forest Soil	VKTGSPHNGDIKRAAHGYEPTREAAMAAFAKSWRRE
Ga0209689_10309763	3300027748	Soil	MWAIGHKGHIRRAAHGYEPTREAAMAAFAKTWRRE
Ga0209382_111200371	3300027909	Populus Rhizosphere	RASGHNGEICRAAHGYEPTREAAMAAFAKSWRRES
Ga0209382_112221462	3300027909	Populus Rhizosphere	VNHLMWASGHSAATVKRAAHGYEPTREAAMAAFAKDLA
Ga0307282_103258822	3300028784	Soil	APPDRSWGWASGHNGDYRRAAYGYEATREAAMAAFAKSWRRE
Ga0307287_102740341	3300028796	Soil	RSWGWASGHNGDYRRAAYGYEATREAAMAAFAKSWRRE
Ga0307302_101712743	3300028814	Soil	PQDRHWMWASGHNGYSHAAHGYEATREAAMAAFAESWRRES
Ga0307302_101911642	3300028814	Soil	MWVSGHNGGIRRAAHGYEPTREDAMAAFAKSWRRD
Ga0307501_102153681	3300031152	Soil	MPSVPLRRHWMWANGHIRRAAHGYEPRREAAMAAFGK
Ga0307499_102175811	3300031184	Soil	MWASGHSADSIKRAAHGYEPTREAAMAVFAKSWRRCQPPIE
Ga0318541_102064364	3300031545	Soil	MWASGHNGHIRRAVHGYEPTREPAMTAFAKSNGDAVTS
Ga0310915_100620745	3300031573	Soil	MWASGHSADTIHRAAKGYEPTREAAMAAFAKNRRRLSVSRKIDL
Ga0310915_100773003	3300031573	Soil	VRRVWANGHNSDTIRRAAHGYEATREAAMAAFAKSWRRESF
Ga0310915_103751992	3300031573	Soil	MWASGHNGDICRAAHGYEPTREAAMAAFAKSWRRE
Ga0318561_107390562	3300031679	Soil	RRIAPWMWASSHNGDTRRAAHGYGPTREAAMAAFAKSRCRE
Ga0318496_100877611	3300031713	Soil	DRPWMWASGHNGHTRRAVHGYETTRETAMAAFAKSWRRE
Ga0318502_110353011	3300031747	Soil	TRSGRRIAPWMWASSHNGDTRRAAHGYGPTREAAMAAFAKSRCRE
Ga0318492_103575094	3300031748	Soil	PWMWASGHNGQISRAAHGYEPTREAAMSAFAKSWRGQR
Ga0318554_103321972	3300031765	Soil	PWMWASGHNRAIERAAHGYEPTREAALAAFAKSWRRE
Ga0306923_101251674	3300031910	Soil	MKERPWMWASGHSADTIHRAAKGYEPTREAAMAAFAKNRRRLSVSRKIDL
Ga0310912_102570781	3300031941	Soil	MWASGHSADTIHRAAKGYEPTREAAMAAFAKNRRRLSV
Ga0310916_103917494	3300031942	Soil	QRGMRASGHNGQISRAAHGYEPTLEAAMSAFAISWRGQR
Ga0318530_104712092	3300031959	Soil	MWASGHSADTIHRAAKGYEPTREAAMAAFAKNRRRLSVSRK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F085911

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences