NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F086060

Metagenome / Metatranscriptome Family F086060

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086060
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 46 residues
Representative Sequence MPNNYDNRVLGRRNARQLSAEEFQKILGQGKPQMTQLPSIPFHPDF
Number of Associated Samples 84
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.68 %
% of genes near scaffold ends (potentially truncated) 21.62 %
% of genes from short scaffolds (< 2000 bps) 77.48 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (62.162 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(18.919 % of family members)
Environment Ontology (ENVO) Unclassified
(26.126 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.550 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.51%    β-sheet: 0.00%    Coil/Unstructured: 86.49%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF00291PALP 9.91
PF01471PG_binding_1 3.60
PF00930DPPIV_N 2.70
PF00704Glyco_hydro_18 1.80
PF12680SnoaL_2 1.80
PF00107ADH_zinc_N 1.80
PF13589HATPase_c_3 1.80
PF11941DUF3459 1.80
PF00128Alpha-amylase 0.90
PF07969Amidohydro_3 0.90
PF03372Exo_endo_phos 0.90
PF13414TPR_11 0.90
PF01212Beta_elim_lyase 0.90
PF13460NAD_binding_10 0.90
PF00593TonB_dep_Rec 0.90
PF16491Peptidase_M48_N 0.90
PF03030H_PPase 0.90
PF05985EutC 0.90
PF04679DNA_ligase_A_C 0.90
PF01872RibD_C 0.90
PF01649Ribosomal_S20p 0.90
PF12704MacB_PCD 0.90
PF13147Obsolete Pfam Family 0.90
PF02810SEC-C 0.90
PF08240ADH_N 0.90
PF11185DUF2971 0.90
PF13503DUF4123 0.90
PF08335GlnD_UR_UTase 0.90
PF04390LptE 0.90
PF04255DUF433 0.90
PF05368NmrA 0.90
PF13857Ank_5 0.90
PF02384N6_Mtase 0.90
PF07228SpoIIE 0.90
PF04879Molybdop_Fe4S4 0.90
PF00155Aminotran_1_2 0.90
PF00578AhpC-TSA 0.90
PF13603tRNA-synt_1_2 0.90
PF13377Peripla_BP_3 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG0823Periplasmic component TolB of the Tol biopolymer transport systemIntracellular trafficking, secretion, and vesicular transport [U] 2.70
COG1506Dipeptidyl aminopeptidase/acylaminoacyl peptidaseAmino acid transport and metabolism [E] 2.70
COG1167DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domainTranscription [K] 1.80
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.90
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.90
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 0.90
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.90
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.90
COG0268Ribosomal protein S20Translation, ribosomal structure and biogenesis [J] 0.90
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 0.90
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 0.90
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.90
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.90
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.90
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.90
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 0.90
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.90
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 0.90
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.90
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.90
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.90
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.90
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.90
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 0.90
COG2844UTP:GlnB (protein PII) uridylyltransferaseSignal transduction mechanisms [T] 0.90
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.90
COG2980Outer membrane lipoprotein LptE/RlpB (LPS assembly)Cell wall/membrane/envelope biogenesis [M] 0.90
COG3033TryptophanaseAmino acid transport and metabolism [E] 0.90
COG3280Maltooligosyltrehalose synthaseCarbohydrate transport and metabolism [G] 0.90
COG3808Na+ or H+-translocating membrane pyrophosphataseEnergy production and conversion [C] 0.90
COG4302Ethanolamine ammonia-lyase, small subunitAmino acid transport and metabolism [E] 0.90
COG4992Acetylornithine/succinyldiaminopimelate/putrescine aminotransferaseAmino acid transport and metabolism [E] 0.90

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms62.16 %
UnclassifiedrootN/A37.84 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001305|C688J14111_10002909All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4624Open in IMG/M
3300001686|C688J18823_10000019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia124627Open in IMG/M
3300003321|soilH1_10267032All Organisms → cellular organisms → Bacteria1174Open in IMG/M
3300004479|Ga0062595_100749513Not Available794Open in IMG/M
3300004479|Ga0062595_100923936Not Available738Open in IMG/M
3300004800|Ga0058861_12044362Not Available692Open in IMG/M
3300004803|Ga0058862_10615774All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium591Open in IMG/M
3300004803|Ga0058862_12789090All Organisms → cellular organisms → Bacteria1171Open in IMG/M
3300005329|Ga0070683_100021952All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter5699Open in IMG/M
3300005332|Ga0066388_100184270All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2699Open in IMG/M
3300005332|Ga0066388_101876489All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300005336|Ga0070680_100478319All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300005336|Ga0070680_100889738Not Available768Open in IMG/M
3300005341|Ga0070691_10715359Not Available602Open in IMG/M
3300005345|Ga0070692_10551419Not Available755Open in IMG/M
3300005345|Ga0070692_10985238Not Available588Open in IMG/M
3300005434|Ga0070709_10236348All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa dinghuensis1310Open in IMG/M
3300005434|Ga0070709_10468855All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium951Open in IMG/M
3300005435|Ga0070714_100390438All Organisms → cellular organisms → Bacteria1314Open in IMG/M
3300005436|Ga0070713_100158977All Organisms → cellular organisms → Bacteria2016Open in IMG/M
3300005436|Ga0070713_100673567All Organisms → cellular organisms → Bacteria → Acidobacteria986Open in IMG/M
3300005436|Ga0070713_100988286Not Available812Open in IMG/M
3300005436|Ga0070713_101294271Not Available706Open in IMG/M
3300005437|Ga0070710_10770950All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300005439|Ga0070711_100002625All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter10288Open in IMG/M
3300005439|Ga0070711_100182654All Organisms → cellular organisms → Bacteria1606Open in IMG/M
3300005439|Ga0070711_100518753All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium984Open in IMG/M
3300005439|Ga0070711_100638193All Organisms → cellular organisms → Bacteria → Acidobacteria892Open in IMG/M
3300005458|Ga0070681_10543700All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300005458|Ga0070681_10785559Not Available869Open in IMG/M
3300005518|Ga0070699_100790564All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300005529|Ga0070741_10011720All Organisms → cellular organisms → Bacteria16094Open in IMG/M
3300005529|Ga0070741_10038403All Organisms → cellular organisms → Bacteria → Acidobacteria6281Open in IMG/M
3300005533|Ga0070734_10654544Not Available597Open in IMG/M
3300005534|Ga0070735_10000132All Organisms → cellular organisms → Bacteria94470Open in IMG/M
3300005537|Ga0070730_10032068All Organisms → cellular organisms → Bacteria3955Open in IMG/M
3300005537|Ga0070730_10535372Not Available751Open in IMG/M
3300005539|Ga0068853_100192759Not Available1852Open in IMG/M
3300005542|Ga0070732_10070137All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli2042Open in IMG/M
3300005542|Ga0070732_10249238All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1064Open in IMG/M
3300005557|Ga0066704_10772953Not Available599Open in IMG/M
3300005563|Ga0068855_101998669Not Available586Open in IMG/M
3300005563|Ga0068855_102438475Not Available521Open in IMG/M
3300005577|Ga0068857_100313810Not Available1447Open in IMG/M
3300005614|Ga0068856_100095458All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2961Open in IMG/M
3300005616|Ga0068852_100030981All Organisms → cellular organisms → Bacteria → Acidobacteria4408Open in IMG/M
3300005764|Ga0066903_100002497All Organisms → cellular organisms → Bacteria14467Open in IMG/M
3300005764|Ga0066903_102388557All Organisms → cellular organisms → Bacteria → Proteobacteria1022Open in IMG/M
3300005842|Ga0068858_102534708Not Available506Open in IMG/M
3300005891|Ga0075283_1000368All Organisms → cellular organisms → Bacteria4311Open in IMG/M
3300006041|Ga0075023_100304930Not Available657Open in IMG/M
3300006050|Ga0075028_100106702Not Available1436Open in IMG/M
3300006050|Ga0075028_100371516Not Available812Open in IMG/M
3300006173|Ga0070716_101225533Not Available604Open in IMG/M
3300006175|Ga0070712_100455604Not Available1066Open in IMG/M
3300006797|Ga0066659_10198186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1468Open in IMG/M
3300006914|Ga0075436_100830236Not Available689Open in IMG/M
3300006954|Ga0079219_10017923All Organisms → cellular organisms → Bacteria2556Open in IMG/M
3300009551|Ga0105238_11130818Not Available806Open in IMG/M
3300010043|Ga0126380_11255850Not Available642Open in IMG/M
3300010048|Ga0126373_12022206Not Available639Open in IMG/M
3300010359|Ga0126376_11933583All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300010360|Ga0126372_11028509All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300010362|Ga0126377_10136014All Organisms → cellular organisms → Bacteria2291Open in IMG/M
3300010371|Ga0134125_10007039All Organisms → cellular organisms → Bacteria12713Open in IMG/M
3300010371|Ga0134125_10493691All Organisms → cellular organisms → Bacteria1356Open in IMG/M
3300010373|Ga0134128_11866700All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300010373|Ga0134128_13194845Not Available503Open in IMG/M
3300010376|Ga0126381_100805775Not Available1348Open in IMG/M
3300010396|Ga0134126_10008460All Organisms → cellular organisms → Bacteria12954Open in IMG/M
3300010396|Ga0134126_10030989All Organisms → cellular organisms → Bacteria6770Open in IMG/M
3300010398|Ga0126383_11469243All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300012212|Ga0150985_117528726All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171201Open in IMG/M
3300012469|Ga0150984_100835459All Organisms → cellular organisms → Bacteria1846Open in IMG/M
3300012985|Ga0164308_10104945All Organisms → cellular organisms → Bacteria1996Open in IMG/M
3300012987|Ga0164307_10098697All Organisms → cellular organisms → Bacteria1822Open in IMG/M
3300013104|Ga0157370_10449118All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300013105|Ga0157369_11225748Not Available765Open in IMG/M
3300015053|Ga0137405_1201322All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2371Open in IMG/M
3300020069|Ga0197907_10494514All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium884Open in IMG/M
3300020070|Ga0206356_11111637All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300020070|Ga0206356_11457602Not Available599Open in IMG/M
3300020081|Ga0206354_10820291Not Available668Open in IMG/M
3300021560|Ga0126371_10354151All Organisms → cellular organisms → Bacteria1604Open in IMG/M
3300021560|Ga0126371_10865943All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300021560|Ga0126371_11272000Not Available870Open in IMG/M
3300025898|Ga0207692_11149541Not Available515Open in IMG/M
3300025911|Ga0207654_11299627Not Available530Open in IMG/M
3300025912|Ga0207707_10193775All Organisms → cellular organisms → Bacteria1773Open in IMG/M
3300025915|Ga0207693_10190705All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171613Open in IMG/M
3300025924|Ga0207694_10169405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Tepidamorphaceae → Lutibaculum1768Open in IMG/M
3300025928|Ga0207700_10015775All Organisms → cellular organisms → Bacteria → Acidobacteria4995Open in IMG/M
3300025928|Ga0207700_10899684All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans792Open in IMG/M
3300025934|Ga0207686_10065169All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172322Open in IMG/M
3300025994|Ga0208142_1003334All Organisms → cellular organisms → Bacteria1404Open in IMG/M
3300026041|Ga0207639_11380221Not Available661Open in IMG/M
3300026078|Ga0207702_10969460Not Available843Open in IMG/M
3300026142|Ga0207698_12459945Not Available531Open in IMG/M
3300027376|Ga0209004_1085524All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Alloacidobacterium → Alloacidobacterium dinghuense534Open in IMG/M
3300027857|Ga0209166_10008177All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6942Open in IMG/M
3300027986|Ga0209168_10000105All Organisms → cellular organisms → Bacteria94539Open in IMG/M
3300030844|Ga0075377_11396831All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17760Open in IMG/M
3300030846|Ga0075403_10943990Not Available507Open in IMG/M
3300031122|Ga0170822_14600463All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17600Open in IMG/M
3300031890|Ga0306925_11574705Not Available640Open in IMG/M
3300031939|Ga0308174_10154856All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1709Open in IMG/M
3300031954|Ga0306926_10394614All Organisms → cellular organisms → Bacteria → Acidobacteria1708Open in IMG/M
3300031954|Ga0306926_10535223All Organisms → cellular organisms → Bacteria → Acidobacteria1437Open in IMG/M
3300032074|Ga0308173_12001710Not Available546Open in IMG/M
3300032261|Ga0306920_102148243Not Available778Open in IMG/M
3300033412|Ga0310810_10718830All Organisms → cellular organisms → Bacteria924Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere18.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.01%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil9.01%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere8.11%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.41%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere5.41%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere3.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.60%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.70%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated2.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.80%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.80%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.80%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.90%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.90%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.90%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.90%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.90%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.90%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005891Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025994Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027376Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300030844Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030846Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J14111_1000290943300001305SoilMSDNNSNRVLCRRTARELSPEEFQKMLGGKPQMTQLPSIPFHPDF*
C688J18823_10000019543300001686SoilMKETKCGKEKRMSDNNSNRVLCRRTARELSPEEFQKMLGGKPQMTQLPSIPFHPDF*
soilH1_1026703213300003321Sugarcane Root And Bulk SoilDCMPNNFENRVLGRRHAHQLSAEEFQKILDKGNTQMTQLPSIPFHPDF*
Ga0062595_10074951313300004479SoilMPENNNDRVLVRANARQLTAEEFQKIMEEGKKQMTQLPSTPFHPDF*
Ga0062595_10092393623300004479SoilMPNNYENRVLVRRNARLLSAEEFQEIMEKGKTQMTQLPSIPFNPDF*
Ga0058861_1204436223300004800Host-AssociatedGECMPNNYENRVLSRRNARQLSAEEYQKILAEGKTQVTLLPSIPFHPDV*
Ga0058862_1061577423300004803Host-AssociatedENNNDRVLVRAKARQLTAEEFQKIMDEGSELMTLLPSTPFHPDF*
Ga0058862_1278909013300004803Host-AssociatedCMPENYNDRVLVRTNARQLSAEEFQEIMEKGKAQMTQLPSIPFNPDF*
Ga0070683_10002195223300005329Corn RhizosphereMPENNNDRVLVRANARQLTAEEFQKIMEEGKEQMTQLPSTPFHPDF*
Ga0066388_10018427023300005332Tropical Forest SoilMLNNYDNRVLGRRKARQLSPEEFDKIMQGTTQMTQLPSIPFHPDF*
Ga0066388_10187648923300005332Tropical Forest SoilMPNNYDNRVLVRRNARQLSAEEYETILEKGKTQMTQLPSIPFNPDF*
Ga0070680_10047831913300005336Corn RhizosphereMPNNYENRVLSRRNARQLSAEEYQKILAEGKTQVTLLPSIPFHPDV*
Ga0070680_10088973823300005336Corn RhizosphereMPENYNDRVLVRTNARQLSAEEFQEIMEKGKAQMTQLPSIPFNPDF*
Ga0070691_1071535923300005341Corn, Switchgrass And Miscanthus RhizosphereMNNFENRVLSRKNAHQLSAEEYQKILEQGKTQLTQLPSIPFNPDF*
Ga0070692_1055141913300005345Corn, Switchgrass And Miscanthus RhizosphereKKEKCMPENNNDRVLIRAKARQLTAEEFQKIMDEGSELMTLLPSTPFHPDF*
Ga0070692_1098523823300005345Corn, Switchgrass And Miscanthus RhizosphereMSDHNSNRVLCRRTAREISAEEFQKIMGQGKPQMTQLPSMPFNPDF*
Ga0070709_1023634823300005434Corn, Switchgrass And Miscanthus RhizosphereMPSDYANRVLCRTNARQLTAEEYTWIKEQGKTQMTQLPSMPFHPDF*
Ga0070709_1046885523300005434Corn, Switchgrass And Miscanthus RhizosphereMSDNNNNRVLGRTNARELSAEEFQKMMGGKPQMTQLPSIPFHPDF*
Ga0070714_10039043823300005435Agricultural SoilMSDNNNNRVLCRRTARELSAEEFQKMMGGKPQMTQLPSIPFHPDF*
Ga0070713_10015897723300005436Corn, Switchgrass And Miscanthus RhizosphereMQNNNNNRVLGRTNARELSAEEFQKMLGGKPQMTQLPSIPFHPDF*
Ga0070713_10067356723300005436Corn, Switchgrass And Miscanthus RhizosphereMSDHNSNRVLCRRTAREISAEEFQKIMGQGKPQMTQLPSIPFQPDF*
Ga0070713_10098828623300005436Corn, Switchgrass And Miscanthus RhizosphereMPKNESNRVLCRTNAREVSAEEYTKILGQGKPQMTQLPSIPFNPDF*
Ga0070713_10129427113300005436Corn, Switchgrass And Miscanthus RhizosphereMPIDYENRVLVRRNARLLSAEEFQEIMEKGKAQATQLPSMPFFPDF*
Ga0070710_1077095023300005437Corn, Switchgrass And Miscanthus RhizosphereMPDHNSNRVLCRRTARELSAEEFQKMLGGKPQMTQLPSIPFHPDF*
Ga0070711_10000262573300005439Corn, Switchgrass And Miscanthus RhizosphereMPNDYENRVLVRRNARLVSAEEFQEIMEKGKTQMTQLPSMPFHPDF*
Ga0070711_10018265423300005439Corn, Switchgrass And Miscanthus RhizosphereMQNNNNNRVLGRTNARELSAEEFQKMMGGKPQMTQLPSIPFHPDF*
Ga0070711_10051875313300005439Corn, Switchgrass And Miscanthus RhizosphereMSDNNNNRVLCRRTARELSAEEFQKMLGGKPQMTQLPSIPFHPDF*
Ga0070711_10063819323300005439Corn, Switchgrass And Miscanthus RhizosphereMQDDDKNNRVLGRTNARELSAEEFQKMLGGKPQMTQLPSIPFHPDF*
Ga0070681_1054370023300005458Corn RhizosphereMADNNSNRVLCRRTAREISAEEFQKIMGQGKPQMTQLPSMPFNPDF*
Ga0070681_1078555913300005458Corn RhizosphereMPNDFENRVLVRTNARQLSDEEFQEIMEKGKAQMTQLPSIPFNPDF*
Ga0070699_10079056413300005518Corn, Switchgrass And Miscanthus RhizosphereMPNNYENRVLVRTNARQVSAEEFQEIMEKGKAQMTQLPSMPFHPDF*
Ga0070741_1001172083300005529Surface SoilMPNNFENRVLVRTNARQLTPEEYATIMEKSKPQMTFIPSIPHNPDF*
Ga0070741_1003840383300005529Surface SoilMPNNFENRVLVRTNARQLSAEEFQWIMEKGNAQMTLLPSTPFHPDF*
Ga0070734_1065454413300005533Surface SoilMPNQNNNRVLGRINARHVSAEELHKILGKGNTQMTQLPSIPFHPDF*
Ga0070735_10000132143300005534Surface SoilMTNNNDNRVLGRRNARQLTAEELHKILGQGNTQMTQLPSMPFHPDF*
Ga0070730_1003206843300005537Surface SoilMSDNNSNRVLCRRTARELSAEEFQKMLGGKPQMTQLPSIPFHPDF*
Ga0070730_1053537213300005537Surface SoilMSDHNSNRVLCRRTAREISAEEFQKIMGQGKPQMTQLPSMPF
Ga0068853_10019275923300005539Corn RhizosphereMADINSNRVLCRRTAREISAEEFQKIMGQGKPQMTQLPSMPFNPDF*
Ga0070732_1007013713300005542Surface SoilMPENYNDRVLVRTNARLVSAEEFQEIMEKGTAQMTQLPSMPFFPDF*
Ga0070732_1024923823300005542Surface SoilMPKNTSNRVLCRTNAREVSAEEFEKIMGQGKPQMTQLPSMPFHPDF*
Ga0066704_1077295313300005557SoilMADNNSNRVLCRRTAREISAEEFQKILGQGKPQMTQLPSMPFNPDF*
Ga0068855_10199866913300005563Corn RhizosphereMPNNYENRVLSRRNARQLSAEEYQKILAEGKTQVTLLPS
Ga0068855_10243847523300005563Corn RhizosphereMPNYENRVLSRRHARQLSAEEYQKILAEGKTQVTLLPSIPFQPDV*
Ga0068857_10031381023300005577Corn RhizosphereMPENNNDRVLVRANARQLTAEEFQKIMEEGKEQMTKLPSTPFHPDF*
Ga0068856_10009545833300005614Corn RhizosphereMPENNNDRVLIRAKARQLTAEEFQKIMDEGSELMTLLPSTPFHPDF*
Ga0068852_10003098163300005616Corn RhizosphereMPENYNDRVLVRTNARKLTAEEFQKIMDEENELMTLLPSTPFHPDF*
Ga0066903_10000249713300005764Tropical Forest SoilMPNNYDNRVLGRRNARQLSAEEFQKILGQGKPQMTQLPSIPFHPDF*
Ga0066903_10238855713300005764Tropical Forest SoilMLNNSDNRVLGRRKARQLSPEEFDKIMQGTTQMTQLPSIPFHPDF*
Ga0068858_10253470813300005842Switchgrass RhizosphereKEKCMPENNNDRVLVRAKARQLTAEEFQKIMDEGSELMTLLPSTPFHPDF*
Ga0075283_100036823300005891Rice Paddy SoilMPNNYENRVLSRRNAHQLSAEEFQKILDQGKTQMTQLPSIPFNPDF*
Ga0075023_10030493013300006041WatershedsMPNNYENRVLVRRNARLLSAEEFTEIMEKGKSQMTQLPSMPFHPDF*
Ga0075028_10010670233300006050WatershedsMPNNYENRVLVRRNARLVSAEEFQEIMEKGKTQMTQLPSMPFHPDF*
Ga0075028_10037151623300006050WatershedsMPKNNSNRVLCRANAREVSAEEFQKILGEGKPQMTQLPSMPFHPDF*
Ga0070716_10122553333300006173Corn, Switchgrass And Miscanthus RhizosphereMPENNNDRVLVRAKARQLTAEEFQKIMDEGSELMTLLPSTPFHPDF*
Ga0070712_10045560413300006175Corn, Switchgrass And Miscanthus RhizosphereMSDNNNNRVLCRRTARELSTEEFQKMLGGKPQMTQLPSIPFHPDF*
Ga0066659_1019818623300006797SoilMANDNDNRILARRNAGHLSAEELNKILGNGNNQMTQLPSIPFHPDF*
Ga0075436_10083023623300006914Populus RhizosphereMADNNSNRVLCRRTAREISAEEFQKILGQGKPQMTQLPSIPFNPDF*
Ga0079219_1001792353300006954Agricultural SoilMPNNYENRVLVRRNARQLSAEEFQEIMEKGKDQMTQLPSIPFHPDF*
Ga0105238_1113081823300009551Corn RhizosphereMWKGECMPNNYENRVLSRRNARQLSAEEYQKILAEGKTQVTLLPSIPFHPDV*
Ga0126380_1125585023300010043Tropical Forest SoilMPNNYDNRVLVRTNARLLSAEEYQEIMENGKAQMTQLPSTPFHPDF*
Ga0126373_1202220623300010048Tropical Forest SoilMQNNYENRVLVRRNARLLTAEEYETILEKGKTQMTQLPSIPFFPDF*
Ga0126376_1193358323300010359Tropical Forest SoilMPNNYENRVLVRTNARLLSAEEFQEIMEKGKAQMTQLP
Ga0126372_1102850913300010360Tropical Forest SoilKCMTNNNDNRVLCRRNARHLSAEELEKILGKGNNQMTQLPSIPFYPDF*
Ga0126377_1013601423300010362Tropical Forest SoilMPNNSDNRVLGRKKARQLSPEEFDKIMQGTTQMTQLPSIPFHPDF*
Ga0134125_1000703963300010371Terrestrial SoilMPNNYENRVLGRRHAHQLSAEEFQKILDQGKTQMTQLPSIPFHPDF*
Ga0134125_1049369123300010371Terrestrial SoilKEKRMPENNNRVLVRTNARQLSAEEFQEIMEKGKAQMTQLPSIPFNPDF*
Ga0134128_1186670023300010373Terrestrial SoilMNDLENRVLSRRNARQLSAEEYSKIQTDGKTQMTLLPSIPFHPDV*
Ga0134128_1319484523300010373Terrestrial SoilMPNDKDNRVLGRRTARELKAEEFQKIMGEGKPQMTQLPSIPFHPDF*
Ga0126381_10080577523300010376Tropical Forest SoilMPNNHENRVLVRTNARQLTAEEYATIMEKSKPQMTFLPSIPHNPDF*
Ga0134126_1000846043300010396Terrestrial SoilMSDNNSNRVLCRRTAREISAEEFQKIMGQGKPQMTQLPSMPFNPDF*
Ga0134126_1003098923300010396Terrestrial SoilMPNNYENRVLVRTNARQLSAEEFQWIMEKGKAQMTQLPSTPFHPDF*
Ga0126383_1146924313300010398Tropical Forest SoilMPTNNDNRVLARRNARYLSAEELQKILGQGNTQMTQLPSIPF
Ga0150985_11752872633300012212Avena Fatua RhizospherePENNNDRVLVRANARQLTAEEFQKIMEEGKEQMTQLPSTPFHPDF*
Ga0150984_10083545943300012469Avena Fatua RhizosphereMPNKNSNRVLCRTNAREVSAEEFEKIMGQGKPQMTQLPSMPFHPDF*
Ga0164308_1010494523300012985SoilMQNNNNNRVLGRTNARELSAEEFQKMMGGKPQMTQLPSIPFHPHF*
Ga0164307_1009869723300012987SoilMQNDNNNRVLGRTNARELSAEEFQKMMGGKPQMTQLPSIPFHPDF*
Ga0157370_1044911823300013104Corn RhizosphereMPNYENRVLSRRHASQLSAEEYQKILAEGKTQVTLLPSIPFQPDV*
Ga0157369_1122574823300013105Corn RhizosphereMPENNSDRVLVRAKARQLTAEEFQKIMEGNELMTLLPSTPFHPDF*
Ga0137405_120132223300015053Vadose Zone SoilMPNNNNNRVLCRRTARELSAEEFQKMLGGKPQMTQLPSIPFHPDF*
Ga0197907_1049451423300020069Corn, Switchgrass And Miscanthus RhizosphereGKEKCMPNNYENRVLSRRNARQLSAEEYQKILAEGKTQVTLLPSIPFHPDV
Ga0206356_1111163723300020070Corn, Switchgrass And Miscanthus RhizosphereECMPNNYEHRVLSRRNARQLSAEEYQKILAEGKTQVTLLPSIPFHPDV
Ga0206356_1145760223300020070Corn, Switchgrass And Miscanthus RhizosphereMPNNYENRVLSRRNARQLSAEEYQKILAEGKTQVTLLPSIPFHPDV
Ga0206354_1082029113300020081Corn, Switchgrass And Miscanthus RhizosphereMNNFENRVLSRKNAHQLSAEEYQKILEQGKTQLTQLPSIPFNPDF
Ga0126371_1035415123300021560Tropical Forest SoilMHNNNDNRVLARRNAHQLSAEELATILGKGNTQMTQLPSIPFYPDF
Ga0126371_1086594313300021560Tropical Forest SoilMQNNYENRVLVRRNARLLTAEEYETILEKGKTQMTQLPSIPFFPDF
Ga0126371_1127200023300021560Tropical Forest SoilMPNNYENRVLVRTNARILSAEEFQWIMEKGKAQMTQLPSTPYHPDF
Ga0207692_1114954113300025898Corn, Switchgrass And Miscanthus RhizosphereSDYANRVLCRTNARQLTAEEYTWIKEQGKTQMTQLPSMPFHPDF
Ga0207654_1129962713300025911Corn RhizosphereMPENNNDRVLVRANARQLTAEEFQKIMEEGKEQMTQLPSTPFHPDF
Ga0207707_1019377523300025912Corn RhizosphereMPENYNDRVLVRTNARQLSAEEFQEIMEKGKAQMTQLPSIPFNPDF
Ga0207693_1019070543300025915Corn, Switchgrass And Miscanthus RhizosphereMPENNNDRVLVRAKARQLTAEEFQKIMDEGSELMTLLPSTPFHPDF
Ga0207694_1016940523300025924Corn RhizosphereMPENYNDRVLVRTNARQLSAEEFQEIMEKGKAQMTQLP
Ga0207700_1001577553300025928Corn, Switchgrass And Miscanthus RhizosphereMSDHNSNRVLCRRTAREISAEEFQKIMGQGKPQMTQLPSMPFQPDF
Ga0207700_1089968423300025928Corn, Switchgrass And Miscanthus RhizosphereMPKNESNRVLCRTNAREVSAEEYTKILGQGKPQMTQLPSIPFNPDF
Ga0207686_1006516933300025934Miscanthus RhizosphereMPNDFENRVLVRTNARQLSDEEFQEIMEKGKAQMTQLPSIPFNPDF
Ga0208142_100333433300025994Rice Paddy SoilMPNNYENRVLSRRNAHQLSAEEFQKILDQGKTQMTQLPSIPFNPDF
Ga0207639_1138022113300026041Corn RhizosphereKGECMPNNYENRVLSRRNARQLSAEEYQKILAEGKTQVTLLPSIPFHPDV
Ga0207702_1096946023300026078Corn RhizosphereMPENNNDRVLIRAKARQLTAEEFQKIMDEGSELMTLLPSTPFHPDF
Ga0207698_1245994523300026142Corn RhizosphereMPNNYENRVLSRRNARQLSAEEYQKILAEGKTQVTLLPSI
Ga0209004_108552423300027376Forest SoilMPANNNDRVLLRTNARLVSAGEFQEIMEKGKAQMTQLPSMPFFP
Ga0209166_1000817743300027857Surface SoilMSDNNSNRVLCRRTARELSAEEFQKMLGGKPQMTQLPSIPFHPDF
Ga0209168_10000105133300027986Surface SoilMTNNNDNRVLGRRNARQLTAEELHKILGQGNTQMTQLPSMPFHPDF
Ga0075377_1139683113300030844SoilMPNNYENRVLVRRNARLVSAEEFQEIMEKGKAQMTQLPSMPFHPDF
Ga0075403_1094399023300030846SoilLVRRNARLVSAEEFQEIMEKGKAQMTQLPSMPFHPDF
Ga0170822_1460046323300031122Forest SoilMKRRKCMPNNYENRVLVRRNARLVSAEEFQEIMEKGKAQMTQLPSMPFHPDF
Ga0306925_1157470523300031890SoilMPNNYENRVLVRRNARLLSAEEFQEIMEKGKAQMTQLPSMPFHP
Ga0308174_1015485623300031939SoilMNDLENRVLSRRNARQLSAEEYSKILADGKTQVTLLPSIPFHPDV
Ga0306926_1039461423300031954SoilMPNNYENRVLVRRNARLLSAEEFQEIMEKGKAQMTQLPSMPFHPDF
Ga0306926_1053522323300031954SoilMPNNFENRVLVRRNARLLSPEEYQEIMEKGKTQMTQLPSIPHFPDF
Ga0308173_1200171023300032074SoilMNDLENRVLSRRNARQLSAEEYSKILADGKTQVTLLPSIPF
Ga0306920_10214824323300032261SoilMSNNNDHRVLGRRGARQLSAETMQKILEAGKTHMTQLPSIPFHPDF
Ga0310810_1071883013300033412SoilMNNFENRVLSRKNAHQLSAEEYQKILEQGKTQLTQLPSIP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.