NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F086305

Metagenome / Metatranscriptome Family F086305

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086305
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 64 residues
Representative Sequence MDKVLNYIFIGFAFTFILDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFIYVFLKEYFK
Number of Associated Samples 85
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 81.98 %
% of genes near scaffold ends (potentially truncated) 26.13 %
% of genes from short scaffolds (< 2000 bps) 78.38 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (35.135 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(28.829 % of family members)
Environment Ontology (ENVO) Unclassified
(90.090 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(98.198 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 56.38%    β-sheet: 0.00%    Coil/Unstructured: 43.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF00118Cpn60_TCP1 38.74
PF030614HBT 35.14
PF00004AAA 16.22
PF05496RuvB_N 4.50
PF00166Cpn10 2.70
PF01165Ribosomal_S21 0.90
PF01050MannoseP_isomer 0.90
PF01503PRA-PH 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 38.74
COG2255Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvBReplication, recombination and repair [L] 4.50
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 2.70
COG0828Ribosomal protein S21Translation, ribosomal structure and biogenesis [J] 0.90


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.86 %
UnclassifiedrootN/A35.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000949|BBAY94_10223986All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300001450|JGI24006J15134_10006846Not Available5827Open in IMG/M
3300004448|Ga0065861_1055520All Organisms → Viruses → environmental samples → uncultured virus790Open in IMG/M
3300005239|Ga0073579_1671731All Organisms → Viruses2301Open in IMG/M
3300005738|Ga0076926_105800Not Available1633Open in IMG/M
3300006026|Ga0075478_10199744All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage611Open in IMG/M
3300006752|Ga0098048_1024150Not Available2015Open in IMG/M
3300006752|Ga0098048_1052604All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300006793|Ga0098055_1355431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300006802|Ga0070749_10198106All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300006802|Ga0070749_10512333All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage653Open in IMG/M
3300006919|Ga0070746_10244546All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage840Open in IMG/M
3300006919|Ga0070746_10458845Not Available565Open in IMG/M
3300006919|Ga0070746_10484861All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage545Open in IMG/M
3300006920|Ga0070748_1209933All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage709Open in IMG/M
3300006924|Ga0098051_1172433All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage569Open in IMG/M
3300006925|Ga0098050_1013793All Organisms → cellular organisms → Bacteria2315Open in IMG/M
3300006990|Ga0098046_1001453Not Available8206Open in IMG/M
3300007542|Ga0099846_1145139All Organisms → Viruses → environmental samples → uncultured virus856Open in IMG/M
3300007640|Ga0070751_1094006All Organisms → cellular organisms → Bacteria1247Open in IMG/M
3300007960|Ga0099850_1191312All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage808Open in IMG/M
3300008050|Ga0098052_1001809Not Available13129Open in IMG/M
3300009193|Ga0115551_1424155All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300009433|Ga0115545_1058002All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1470Open in IMG/M
3300009436|Ga0115008_11620477All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300010148|Ga0098043_1029083All Organisms → Viruses → environmental samples → uncultured virus1743Open in IMG/M
3300012920|Ga0160423_10069507Not Available2521Open in IMG/M
3300012920|Ga0160423_10327227Not Available1052Open in IMG/M
3300012954|Ga0163111_10726330Not Available939Open in IMG/M
3300017706|Ga0181377_1028611All Organisms → Viruses1166Open in IMG/M
3300017706|Ga0181377_1041206All Organisms → Viruses → environmental samples → uncultured virus914Open in IMG/M
3300017706|Ga0181377_1083237Not Available567Open in IMG/M
3300017708|Ga0181369_1027376All Organisms → Viruses → environmental samples → uncultured virus1358Open in IMG/M
3300017709|Ga0181387_1091089All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage621Open in IMG/M
3300017717|Ga0181404_1150866Not Available561Open in IMG/M
3300017719|Ga0181390_1060784Not Available1084Open in IMG/M
3300017725|Ga0181398_1051701All Organisms → Viruses → environmental samples → uncultured virus993Open in IMG/M
3300017726|Ga0181381_1033775Not Available1143Open in IMG/M
3300017726|Ga0181381_1058108Not Available841Open in IMG/M
3300017727|Ga0181401_1024999All Organisms → Viruses1753Open in IMG/M
3300017728|Ga0181419_1078245All Organisms → Viruses → environmental samples → uncultured virus830Open in IMG/M
3300017731|Ga0181416_1088771All Organisms → Viruses → environmental samples → uncultured virus735Open in IMG/M
3300017732|Ga0181415_1054464All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage908Open in IMG/M
3300017734|Ga0187222_1102870Not Available646Open in IMG/M
3300017737|Ga0187218_1102080All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage688Open in IMG/M
3300017738|Ga0181428_1160795Not Available524Open in IMG/M
3300017739|Ga0181433_1059146All Organisms → Viruses → environmental samples → uncultured virus965Open in IMG/M
3300017739|Ga0181433_1063584All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300017739|Ga0181433_1118730Not Available634Open in IMG/M
3300017746|Ga0181389_1030183All Organisms → Viruses1653Open in IMG/M
3300017746|Ga0181389_1064970All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300017748|Ga0181393_1054123Not Available1090Open in IMG/M
3300017749|Ga0181392_1146055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage693Open in IMG/M
3300017750|Ga0181405_1015480All Organisms → cellular organisms → Bacteria2153Open in IMG/M
3300017751|Ga0187219_1151609All Organisms → Viruses → environmental samples → uncultured virus667Open in IMG/M
3300017753|Ga0181407_1035626Not Available1332Open in IMG/M
3300017759|Ga0181414_1026076All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1591Open in IMG/M
3300017763|Ga0181410_1158440Not Available634Open in IMG/M
3300017764|Ga0181385_1085741Not Available967Open in IMG/M
3300017764|Ga0181385_1180515Not Available638Open in IMG/M
3300017764|Ga0181385_1232258All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage554Open in IMG/M
3300017765|Ga0181413_1018730All Organisms → cellular organisms → Bacteria2170Open in IMG/M
3300017767|Ga0181406_1174837All Organisms → cellular organisms → Bacteria → Proteobacteria642Open in IMG/M
3300017768|Ga0187220_1177870All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage642Open in IMG/M
3300017773|Ga0181386_1211338All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage580Open in IMG/M
3300017956|Ga0181580_10534108Not Available763Open in IMG/M
3300017985|Ga0181576_10670095Not Available622Open in IMG/M
3300019098|Ga0188859_1000954All Organisms → Viruses → environmental samples → uncultured virus1326Open in IMG/M
3300019098|Ga0188859_1005799All Organisms → Viruses → environmental samples → uncultured virus683Open in IMG/M
3300020165|Ga0206125_10043703All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2253Open in IMG/M
3300020165|Ga0206125_10091310All Organisms → Viruses → environmental samples → uncultured virus1314Open in IMG/M
3300020165|Ga0206125_10252628All Organisms → Viruses → environmental samples → uncultured virus671Open in IMG/M
3300020347|Ga0211504_1011181All Organisms → cellular organisms → Bacteria2673Open in IMG/M
3300020388|Ga0211678_10048626All Organisms → Viruses → environmental samples → uncultured virus2006Open in IMG/M
3300020388|Ga0211678_10074831All Organisms → Viruses → environmental samples → uncultured virus1536Open in IMG/M
3300020403|Ga0211532_10201901All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage793Open in IMG/M
3300020437|Ga0211539_10160290All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage918Open in IMG/M
3300020437|Ga0211539_10167604Not Available898Open in IMG/M
3300020438|Ga0211576_10314288All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage812Open in IMG/M
3300020439|Ga0211558_10184041Not Available1000Open in IMG/M
3300020442|Ga0211559_10176870Not Available1012Open in IMG/M
3300020446|Ga0211574_10328123Not Available661Open in IMG/M
3300021356|Ga0213858_10032179All Organisms → Viruses2525Open in IMG/M
3300021364|Ga0213859_10544012Not Available501Open in IMG/M
3300021373|Ga0213865_10004721Not Available8125Open in IMG/M
3300021425|Ga0213866_10010656All Organisms → Viruses5642Open in IMG/M
3300021425|Ga0213866_10274183All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage852Open in IMG/M
3300022053|Ga0212030_1009516All Organisms → Viruses1188Open in IMG/M
3300025070|Ga0208667_1035999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage859Open in IMG/M
3300025084|Ga0208298_1102075All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300025085|Ga0208792_1099718All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300025098|Ga0208434_1042188All Organisms → Viruses → environmental samples → uncultured virus1027Open in IMG/M
3300025098|Ga0208434_1101476Not Available562Open in IMG/M
3300025120|Ga0209535_1000695Not Available23523Open in IMG/M
3300025127|Ga0209348_1008631Not Available4163Open in IMG/M
3300025127|Ga0209348_1059367All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1265Open in IMG/M
3300025138|Ga0209634_1014903All Organisms → Viruses4511Open in IMG/M
3300025138|Ga0209634_1165790All Organisms → Viruses883Open in IMG/M
3300025543|Ga0208303_1003909Not Available5322Open in IMG/M
3300025769|Ga0208767_1008283Not Available6705Open in IMG/M
3300025769|Ga0208767_1210272All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage645Open in IMG/M
3300025818|Ga0208542_1020340All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2239Open in IMG/M
3300025889|Ga0208644_1374313All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300025892|Ga0209630_10264286Not Available800Open in IMG/M
3300029302|Ga0135227_1007448Not Available814Open in IMG/M
3300029308|Ga0135226_1001869Not Available1090Open in IMG/M
3300029319|Ga0183748_1019324All Organisms → Viruses2462Open in IMG/M
3300029319|Ga0183748_1022729All Organisms → Viruses2181Open in IMG/M
3300029319|Ga0183748_1031909All Organisms → Viruses1688Open in IMG/M
3300029319|Ga0183748_1072966Not Available874Open in IMG/M
3300034418|Ga0348337_019555All Organisms → Viruses3464Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater28.83%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine21.62%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous15.32%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine12.61%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.50%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.70%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater2.70%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.80%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.80%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.80%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor1.80%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.90%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.90%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.90%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.90%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005738Seawater microbial communities from Vineyard Sound, MA, USA - sterilised with crude oil T0EnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019098Metatranscriptome of marine microbial communities from Baltic Sea - GS684_0p1EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020437Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020446Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300029302Marine harbor viral communities from the Indian Ocean - SRB3EnvironmentalOpen in IMG/M
3300029308Marine harbor viral communities from the Indian Ocean - SRB2EnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
BBAY94_1022398623300000949Macroalgal SurfaceMDIVLNYIFIGFACTFLLDFASDKYADHDAFKNVPDWNWGARIMFILFWPLGTILFIYTFLKEYFR*
JGI24006J15134_1000684643300001450MarineMDKFLNYIFIGFAFSFILDFISYKYTDHPSFQNVPEWSWGARIMLILFWPLGAAMFIHVYLKEYFK*
Ga0065861_105552023300004448MarineMGIFLNYIFIGFICTFLLDYASEKFADHDAFQNVPDWNWGARIAFALFWPLGLILFIYTFIKEYFG*
Ga0073579_167173123300005239MarineMDIVLNYIFIGFACTFLLDFASDKYADHPSFENVPEWNWGARIMFILFWPLGTALFIYTFIKEYFN*
Ga0076926_10580013300005738MarineMDIVLNYIFIGFACTFLLDFASDKYADHPSFENVPEWNWGARIMFILFWPLGTALFIYTFIKEY
Ga0075478_1019974413300006026AqueousGNVMDIVLNYIFIGFACTFLLDFASDKYADHPSFENVPEWNWGARIMFILFWPLGTALFIYTFIKEYFN*
Ga0098048_102415043300006752MarineMDKILNYIFIGFAFTFVLDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTALFIYTFIKERFK*
Ga0098048_105260423300006752MarineMDKVLNYIFIGFAFTFILDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFIYVFLKEYFK*
Ga0098055_135543123300006793MarineFIGFAFSFILDYLSDKYADHQSFQNVPEWGWGARIMLILFWPLGAAIFVYVFL*
Ga0070749_1019810623300006802AqueousMDIVLNYIFIGFTCTFLLDFASDKYADHDAFENVPDWNWGARIMFILFWPLGTALFIYTFVKEYFK*
Ga0070749_1051233323300006802AqueousMDIVLNYIFIGFACTFLLDFISDKYADHDAFENVPDWNWGARIMFILFWPLGTILFIYTFLKEYFR*
Ga0070746_1024454643300006919AqueousMDKILNYIFIGFAFTFILDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFAYVFLKEYFK*
Ga0070746_1045884513300006919AqueousMDIVLNYIFIGFTCTFLLDFASDKYADHDAFENVPDWNWGARIMFILFWPLGTALF
Ga0070746_1048486123300006919AqueousMDKILNYIFIGFAFTFLIDFIADKYADHPAFKDVPDWGWGARIALILFWPLGAAIFIYTFLKSYFK*
Ga0070748_120993313300006920AqueousDIVLNYLIIGFAFTFILDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFAYVFLKEYFK*
Ga0098051_117243313300006924MarineMDKVLNYIFIGFAFTFVLDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTALFIYTFIKERFK*
Ga0098050_101379323300006925MarineMDIVLNYIFIGFACTFLLDFASDKYADHPSFENVPEWNWGARIMFILFWPLGTALFIYVFLKEYCI*
Ga0098046_100145393300006990MarineMDKILNYIFIGFAFTFILDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFIYVFLKEYFK*
Ga0099846_114513913300007542AqueousFACTFLLDFISDKYADHPSFENVPEWNWGARIMFILFWPLGTALFIYTFIKEYFN*
Ga0070751_109400623300007640AqueousMDIVLNYIFIGFTCTFLLDFASDKYADHDAFENVPDWNWGARIMFILFWPLGTALFIYTFIKEYFN*
Ga0099850_119131213300007960AqueousIFIGFACTFLLDFISDKYADHPSFENVPEWNWGARIMFILFWPLGTALFIYTFIKEYFN*
Ga0098052_1001809183300008050MarineMDKFLNYIFIGFAFSFILDFISDKYADHPSYQNVPEWSWGARIMLILFWPLGAAMFIYVYLKEYFK*
Ga0115551_142415523300009193Pelagic MarineMDMILNYIFIGFAITFLLDYISEKYKNHQAFQEVPEWNWGARIMFALFWPLGTTLFLYIFIREYFFNK*
Ga0115545_105800233300009433Pelagic MarineILNYIFIGFAITFLLDYISEKYKNHQAFQEVPEWNWGARIMFALFWPLGTTLFLYIFIREYFFNK*
Ga0115008_1162047723300009436MarineFSFILDYLSDKYADHPSFQNVPEWSWGARIMLILFWPLGATIFVYVFLKERFK*
Ga0098043_102908323300010148MarineMDMVLNYIFIGFVITFLLDYMSEKFKNHVGWENVPEWTWGARIMFILFWPLGTALFIYTFIKIYFFDK*
Ga0160423_1006950733300012920Surface SeawaterMDKILNYLIIGFAFTFILDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFIYVFLKEYFK*
Ga0160423_1032722733300012920Surface SeawaterMDMVLNYIFIGFAFTFLLDYISDKYADHPAFKDVPDWGWGARIALILFWPFGAAIFIYTFLKSYFN*
Ga0163111_1072633013300012954Surface SeawaterMDMVLNYIFIGFAITFLLDYMVYKFKDHPAWQNVPDWSWGARIMFALFWPLGATLFIYT
Ga0181377_102861133300017706MarineMDIVLNYIFIGFACTFLLDFASDKYADHDAFENVPDWNWGARIMFILFWPLGTALFIYTFVKEYFK
Ga0181377_104120623300017706MarineMDIVLNYIFIGFACTFLLDFASDKYADHPSFENVPEWNWGARIMFILFWPLGTTLFIYTFIKEYFK
Ga0181377_108323723300017706MarineMDKILNYIFIGFTFSFILDYLSDKYADHPSFQNVPEWSWGARIMLILFWPLGAAMFIYVYLKEYFK
Ga0181369_102737623300017708MarineMDMVLNYIFIGFAITFLLDYMSEKFKTHEGWENVPEWNWGARIMFALFWPLGTTVFIFIFIKEYFFNK
Ga0181387_109108913300017709SeawaterMDKILNYIFIGFTFTFLLDYISDKYADHPAFKDVPDWGWGARIALILFWPLGAAIFIYVFLKSYFE
Ga0181404_115086623300017717SeawaterMDMVLNYIFIGFAITFLLDYISEKYKNHQAFQEIPEWNWGARIMFALFWPLGTTLFLYIFIREYFFNK
Ga0181390_106078423300017719SeawaterMDIVLNYIFIGFAFSFILDYLSDKYADHQSFQNVPEWGWGARIMFILFWPLGATIFIYIFLKEYFK
Ga0181398_105170133300017725SeawaterMDKILNYIFIGFAFTFILDYLSDKFADHPSFKDVPEWSWGARIMLILFWPLGAAIFIYIFLKEYFK
Ga0181381_103377523300017726SeawaterMDKILNYIFIGFTFTFLLDYISDKYADHPAFKDVPDWGWGARMILILFWPLGATIFVY
Ga0181381_105810833300017726SeawaterMDIVLNYLIIGFAFTFILDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFIYVFLKEYFK
Ga0181401_102499933300017727SeawaterMDIFLNYIFIGFACTFLLDFASDKYADHDAFKNVPDWNWGARIMFILFWPLGTALFIYTFVKEYFK
Ga0181419_107824533300017728SeawaterFIGFACTFLLDFASDKYADHDAFKNVPDWNWGARIMFILFWPLGTALFIYTFVKEYFK
Ga0181416_108877133300017731SeawaterSNVNDGDVMDKILNYIFVGFAFTFILDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFIYVFLKEYFK
Ga0181415_105446423300017732SeawaterMDKVLNYIFIGFAFTFLLDYLSDKYADHPAFKDVPEWGWGARMMLILFWPLGILIFTYTFLKSYFK
Ga0187222_110287023300017734SeawaterMDKILNYIFIGFTFTFLLDYISDKYADHPAFKDVPDWGWGARMILILFWPLGATIFVYTFIKERFK
Ga0187218_110208033300017737SeawaterAFSFILDYLSDKYADHQSFQNVPEWGWGARIMLILFWPLGTAIFIYVFLKEYFK
Ga0181428_116079523300017738SeawaterMDMVLNYIFIGFVITFLLDYISEKYKNHQAFQEIPEWNWGARIMFALFWPLGTTLFLYIFIREFFKQ
Ga0181433_105914613300017739SeawaterMDKILNYIFVGFVFTFILDYLSDKYADHSAFKDVPDWGWGARIMLILFWPFGAAIFIYTFLKSYFD
Ga0181433_106358423300017739SeawaterMDMILNYIFIGFVITFLLDYISEKYKNHQAFQEIPEWNWGARIMFALFWPLGTTLFLYIFIREYFFNK
Ga0181433_111873013300017739SeawaterMDKVLNYIFIGFAFTFLLDYLSDKYADHPAFKDVPDWSWGARIILILFWPFGAAIFIYTFLKSYFN
Ga0181389_103018333300017746SeawaterMDKILNYIFIGFTFTFLLDYISDKYADHPAFKDVPDWGWGARMILILFWPLGAAIFVYTFIKERFK
Ga0181389_106497023300017746SeawaterMDKILNYIFIGFAFTFILDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGAAIFIYIFLKEYFK
Ga0181393_105412313300017748SeawaterGFAFTFILDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFIYVFLKEYFK
Ga0181392_114605533300017749SeawaterYIFIGFAFTFILDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGAAIFIYIFLKEYFK
Ga0181405_101548023300017750SeawaterMDIVLNYIFIGFTCTFLLDFASDKYADHDAFENVPDWNWGARIMFILFWPLGTALFIYTFVKEYFR
Ga0187219_115160913300017751SeawaterIGFAFTFILDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFIYVFLKEYFK
Ga0181407_103562623300017753SeawaterMDMVLNYIFIGFVITFLLDYISEKYKNHQAFQEIPEWNWGARIMFALFWPLGTTLFLYIFIREFFKQXN
Ga0181414_102607623300017759SeawaterMDILLNYFFIGFAFTFLLDYISDKYADHPAFKDVPEWGWGARMMLILFWPLGILIFTYTFLKSYFK
Ga0181410_115844023300017763SeawaterMDIFLNYIFIGFACTFLLDFASDKYADHDAFKNVPDWNWGARIMFILFWPLGTALFIYTFVKEYFKYP
Ga0181385_108574123300017764SeawaterMDILLNYFFIGFAFTFLLDYISDKYADHPAFKDVPEWGWGARMMLILFWPLGILIFTYTFLKSYF
Ga0181385_118051523300017764SeawaterMDKILNYIFIGFTFSFILDYLSDKYADHPSFQNVPEWSWGARIMLILFWPLGAAIFIYIFLKEYFK
Ga0181385_123225823300017764SeawaterMDKILNYIFIGFAFTFLIDFIADKYADHPAFKDVPDWGWGARMILILFWPLGAAIFVYTFIKERFK
Ga0181413_101873023300017765SeawaterMDMVLNYIFIGFVITFLLDYISEKYKNHQAFQEIPEWNWGARIMFALFWPLGTTLFLYIFIREYFFNK
Ga0181406_117483723300017767SeawaterMDMILNYIFIGFAITFLLDYISEKYKNHQAFQEIPEWNWGARIMFALFWPLGTTLFLYIFIREYFFNK
Ga0187220_117787033300017768SeawaterGFAFTFLIDFIADKYADHPAFKDVPDWGWGARMILILFWPLGILIFTYTFLKSYFK
Ga0181386_121133823300017773SeawaterMDIVLNYIFIGFAFSFILDYLSDKYADHQSFQNVPEWGWGARIMLILFWPLGTAIFIYVFLKEYFK
Ga0181580_1053410823300017956Salt MarshMDKVLNYIFIGFAFTFLIDFIADKYADHPAFKDVPDWGWGARMILILFWPLGAFIFIYTFIKERFK
Ga0181576_1067009523300017985Salt MarshMDKVLNYIFIGFAFTFLIDFIADKYADHPAFKDVPDWGWGARIALILFWPLGAAIFIYTFLKSYFK
Ga0188859_100095423300019098Freshwater LakeMGIFLNYIFIGFICTFLLDYASEKFADHDAFQNVPDWNWGARIAFALFWPLGLILFIYTFIKEYFG
Ga0188859_100579923300019098Freshwater LakeMDIVLNYIFIGFACTFLLDFASDKYADHPSFENVPEWNWGARIMFILFWPLGTALFIYTFIKEYFN
Ga0206125_1004370333300020165SeawaterMDMILNYIFIGFAITFLLDYISEKYKNHQAFQEVPEWNWGARIMFALFWPLGTTLFLYIFIREYFFNK
Ga0206125_1009131013300020165SeawaterMDKILNYIFIGFAFTFILDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFIYVFLKEYFK
Ga0206125_1025262823300020165SeawaterMDKFLNYIFIGFAFSFILDFISDKYADHPSFQNVPEWSWGARIMLILFWPLGAAMFIYVYLKEYFK
Ga0211504_101118163300020347MarineMDIVLNYIFIGFAFSFILDYLSDKYADHQSFQNVPEWGWGARIMLILFWPLGAAIFVYVFLKERFK
Ga0211678_1004862623300020388MarineMDKILNYIFIGFIFSFILDYLSDRYADHPSFQNVPEWSWGARIMLILFWPLGAAMFIYVYLKEYFK
Ga0211678_1007483123300020388MarineMDKILNYLIIGFAFTFVLDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFIYIFLKEYFKWN
Ga0211532_1020190143300020403MarineIGFTFTFLLDYMSDKYADHPAFKDVPDWGWGSRIMLILFWPLGIIVFVYTFLKSYFN
Ga0211539_1016029033300020437MarineMEKFLNYIFIGFTFTFLLDYISNKYVDHPAFKDVPEWDWGARIMFVLFWPLGAIVFIYTFLKTYFK
Ga0211539_1016760423300020437MarineMDKILNYILIGFIFTFLLDYISDKYINHPAFKDVPDWGWGSRIMLILFWPLGVIIFIYTFLKSYFK
Ga0211576_1031428833300020438MarineMDIVLNYIFIGFAFSFILDYLSDKYADHQSFQNVPEWGWGARIMLILFWPLGAAIFIYIFLKEYFK
Ga0211558_1018404123300020439MarineMDKVLNYIFIGFAFTFILDYLSDKYADHPAFKDVPDWGWGARIMLILFWPLGAAIFIYFFLKSYFN
Ga0211559_1017687013300020442MarineMDKILNYIFIGFTFTFLLDYISDKYADHPAFKDVPDWGWGARIMLILFWPLGTA
Ga0211574_1032812323300020446MarineMDMVLNYIFIGFAITFLLDYMVYKFKDHPAWQNVPDWSWGARIMFALFWPLGATLFIYTFIKNYFFKK
Ga0213858_1003217933300021356SeawaterMDKVLNYIFIGFAFTFLLDYISDKYADHPAFKDVPDWGWGARIALILFWPLGAVIFIYTFLKEYFK
Ga0213859_1054401223300021364SeawaterMDKVLNYIFIGFTFTFLLDYISDKYADHPAFKDVPDWGWGARIALILFWPLGAVIFIYTFLK
Ga0213865_1000472183300021373SeawaterMDKILNYIFIGFAFTFVLDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTALFIYTFIKERFK
Ga0213866_1001065673300021425SeawaterMDIVLNYIFIGFACTFLLDFASDKYADHPSFENVPEWNWGARIMFILFWPLGTALFIYTFIKEYFS
Ga0213866_1027418323300021425SeawaterMDIVLNYIFIGFTFTFLLDYISDKYADHPAFKDVPDWGWGARIALILFWPLGAVIFIYTFLKEYFN
Ga0212030_100951633300022053AqueousMDIVLNYIFIGFACTFLLDFISDKYADHDAFENVPDWNWGARIMFILFWPLGTILFIYTFLKEYFR
Ga0208667_103599913300025070MarineMDKVLNYIFIGFAFTFILDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFIYVFLKEYFK
Ga0208298_110207523300025084MarineIGFAFTFVLDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFIYVFLKEYFK
Ga0208792_109971823300025085MarineMDKILNYIFIGFAFTFILDYLSDKFVDHPSFKDVPEWGWGARIMLILFWPLGAAIFVYVFLKERFK
Ga0208434_104218833300025098MarineDKVLNYIFIGFAFTFILDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFIYVFLKEYFK
Ga0208434_110147623300025098MarineMDKILNYIFIGFAFTFVLDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFIY
Ga0209535_1000695213300025120MarineMDKFLNYIFIGFAFSFILDFISYKYTDHPSFQNVPEWSWGARIMLILFWPLGAAMFIHVYLKEYFK
Ga0209348_100863123300025127MarineMDKVLNYIFIGFTFTFLLDYISDKYADHPAFKDVPDWGWGARIMLILFWPLGVIIFVYTFLKSYF
Ga0209348_105936723300025127MarineMDKVLNYIFIGFAFTFLLDYISDKYADHPAFKDVPDWGWGARIALILFWPLGATIFIYVFLKEYFK
Ga0209634_101490323300025138MarineMGIFLNYIFIGFVCTFLLDYASEKFADHDAFQNVPDWNWGARIAFSLFWPLGLILFIYTFIKEYFG
Ga0209634_116579023300025138MarineMGIFLNYIFIGFICTFLLDYASEKFADHDAFQNVPDWNWGARIAFALFWPLGLILFIYVLIKEYFG
Ga0208303_100390993300025543AqueousMDIVLNYIFIGFACTFLLDFISDKYADHPSFENVPEWNWGARIMFILFWPLGTALFIYTFIKEYFN
Ga0208767_100828313300025769AqueousMDIVLNYIFIGFACTFLLDFASDKYADHPSFENVPEWNWGARIMFILFWPLGTALFIYTFIKEYFG
Ga0208767_121027213300025769AqueousIIGFAFTFILDYLSDKFADHPSFKDVPEWGWGARIMLILFWPLGTAIFAYVFLKEYFK
Ga0208542_102034033300025818AqueousMDIVLNYIFIGFACTFLLDFASDKYADHPSFENVPEWNWGARIMFILFWPLGTALFIYTFVKEYFK
Ga0208644_137431313300025889AqueousNDGNVMDIVLNYIFIGFACTFLLDFISDKYADHDAFENVPDWNWGARIMFILFWPLGTILFIYTFLKEYFR
Ga0209630_1026428623300025892Pelagic MarineMDIVLNYIFIGFTCTFLLDFASDKYADHDAFENVPDWNWGARIMFILFWPLGTALFIYTFVKEYFK
Ga0135227_100744813300029302Marine HarborMDRILNYIFIGFAFTFTIDYIADKYSDHSAFKDVPDWGWGSRIKLILFWPLGIAVFIYTFLKERFR
Ga0135226_100186923300029308Marine HarborMDRILNYIFIGFAFTFTIDYIADKYSDHSAFKDVPDWGWGSRIMLILFWPLGIAVFIYTFLKERFR
Ga0183748_101932453300029319MarineMDMILNYIFIGFAFTFILDYISDKYADHPAFKDVPDWDWGARMMLILFWPLGVLIFTYTFLKSYFK
Ga0183748_102272923300029319MarineMDKILNYIFIGFTFTFLLDYISDKYADHPAFKDVPDWGWGARIMLILFWPLGIIVFIYTFLKSYFN
Ga0183748_103190933300029319MarineMDKVLNYIFIGFTITFLLDYISEKYKNHQAFKDVPEWDWGARIMFALFWPLGTIIFIYVFLKEYFK
Ga0183748_107296623300029319MarineMDMVLNYIFIGFAITFLLDYMSEKFKNHTGWENVPEWNWGARIMFALFWPLGITIFIFIFIKEYFS
Ga0348337_019555_2855_30553300034418AqueousMDIVLNYIFIGFTCTFLLDFASDKYADHDAFENVPDWNWGARIMFILFWPLGTALFIYTFIKEYFN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.