Basic Information | |
---|---|
Family ID | F086417 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 39 residues |
Representative Sequence | VHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTD |
Number of Associated Samples | 69 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 77.27 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 98.18 % |
Associated GOLD sequencing projects | 69 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (99.091 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (45.454 % of family members) |
Environment Ontology (ENVO) | Unclassified (83.636 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (80.909 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 39.71% Coil/Unstructured: 60.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 99.09 % |
All Organisms | root | All Organisms | 0.91 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 45.45% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 38.18% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.09% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.73% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017691 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028057 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028139 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028141 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028256 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028467 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028469 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028523 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028525 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300032464 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070690_1017106772 | 3300005330 | Switchgrass Rhizosphere | MHPILIFTMGQVRQQNGVKPPETRVLEVKYVVRNQRDVVEH |
Ga0070666_104867551 | 3300005335 | Switchgrass Rhizosphere | HLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVLEH* |
Ga0068859_1025514931 | 3300005617 | Switchgrass Rhizosphere | VHLMHPILIFTMGQVGQRNGVKPPETRVLDVKYVVRNQTDI |
Ga0068864_1019805271 | 3300005618 | Switchgrass Rhizosphere | MYLMHPILNFRMGQVRQRNGVKPLETRVLDIKYVVRNQTDVLEH |
Ga0068864_1023837162 | 3300005618 | Switchgrass Rhizosphere | MHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRN |
Ga0068863_1017217092 | 3300005841 | Switchgrass Rhizosphere | LHLMHPILNFRMGQVRQRNGVKPPETRVLDIKYVVRN |
Ga0068863_1019046062 | 3300005841 | Switchgrass Rhizosphere | VHMMHPILIFTMGQVRQRNGVKPPETRVLDVKYMV |
Ga0068863_1023267831 | 3300005841 | Switchgrass Rhizosphere | VHLMHSILIFTMGQVRQRNGVKPPETRVLDIKYVV |
Ga0068858_1023101511 | 3300005842 | Switchgrass Rhizosphere | VHLMHPILNFTMGQVRQRNGVKPPETRVLDIKYVVRNQ |
Ga0068860_1019028212 | 3300005843 | Switchgrass Rhizosphere | VHLMHPILIFTMGQVQQRNGVKPPETRVLDVKYVVRNQ |
Ga0068860_1023655182 | 3300005843 | Switchgrass Rhizosphere | VHLMHPILIFTMGQVRQRNGMKPPETRVLDIKYVVRNQPD |
Ga0068860_1024337611 | 3300005843 | Switchgrass Rhizosphere | VHSMHPILIFTMGQVWQRNGMKPPETRVLDVKYVVRNQTDI |
Ga0134125_127178501 | 3300010371 | Terrestrial Soil | VHLIYPILIFTMGQVQQRNGVKPPETRVLDVKYVV |
Ga0134127_113954071 | 3300010399 | Terrestrial Soil | HPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVLEH* |
Ga0163163_119931431 | 3300014325 | Switchgrass Rhizosphere | VHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTD |
Ga0182100_10816051 | 3300015280 | Switchgrass Phyllosphere | VHLMHPILIFTMGQVRQRNGVKPPKTRVFDLKLWIGH |
Ga0182101_10724241 | 3300015284 | Switchgrass Phyllosphere | VHLMHPILIFTMGQVRQRNGVKPHKTRVLNVKYVVRNQ |
Ga0182162_10717792 | 3300015310 | Switchgrass Phyllosphere | MHPILIFTMGHVRQRNGVKPPETRVLEVKYVVRNQRDVVEHRNGV |
Ga0182162_10967681 | 3300015310 | Switchgrass Phyllosphere | MHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVLEH |
Ga0182162_11025071 | 3300015310 | Switchgrass Phyllosphere | VHLMHPILIFTMGQVRQRNGVKPPETRVLEIKYVVRNQSD |
Ga0182162_11165871 | 3300015310 | Switchgrass Phyllosphere | VHLMYPILIFTMGQVWQRNGVKPPETRVLDVKYVVRNQTD |
Ga0182162_11208311 | 3300015310 | Switchgrass Phyllosphere | MHLMHPILNFRMGQVRQRNGVKPPETRVSDIKYVVRNQTD |
Ga0182182_10387122 | 3300015311 | Switchgrass Phyllosphere | RHKLVHLMHLILIFTMGQVRQRNGVKPPETRVLDVKYVMRNQTDV* |
Ga0182182_10874291 | 3300015311 | Switchgrass Phyllosphere | VHLMRPILIFTMGQVRQLNGVKPPETRVLDVKYVVRNQTD |
Ga0182182_11216861 | 3300015311 | Switchgrass Phyllosphere | VHLKHPILIFTMGQVRQRSGVKPLETRVLDVKYVVR |
Ga0182120_11078551 | 3300015315 | Switchgrass Phyllosphere | MHLMHPILNFTMGQVRQRNGVKPPETRVLDIKYVVRNQTDVV |
Ga0182121_11280472 | 3300015316 | Switchgrass Phyllosphere | VHLMHPILIFKMGQVRQRNGVKPPETRVLDIKYVVRN |
Ga0182136_10708332 | 3300015317 | Switchgrass Phyllosphere | MHPILIFTMGHVRQRNGVKPPETRVLEVKYVVRNQRDVVEHR |
Ga0182181_11005871 | 3300015318 | Switchgrass Phyllosphere | MHLMHPILIFTMGQVRQRNSVKPPETRDLDVKYVV |
Ga0182114_11317651 | 3300015327 | Switchgrass Phyllosphere | VHLMHSILIFTMGQVRQRNGVKPPETRVLEVKYAVRNQRNV |
Ga0182114_11370221 | 3300015327 | Switchgrass Phyllosphere | MYLMHPILNFRMGQVRQRNGVKPLETRVLDIKYVVRNQT |
Ga0182135_11268343 | 3300015329 | Switchgrass Phyllosphere | VHLMHPILIFTMGQVQQRNGMKPPETRVLDVKYVVRNQTDVLE |
Ga0182117_10071882 | 3300015332 | Switchgrass Phyllosphere | VHLMQPILIFTMAQVRQRNGMKLPETRVLDVKYVV* |
Ga0182117_11516001 | 3300015332 | Switchgrass Phyllosphere | VHLMHPILNFRMGQVRQRNGVKPPETRVLDIKYVVRNQTDV |
Ga0182132_10689492 | 3300015334 | Switchgrass Phyllosphere | MHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNH |
Ga0182132_11697882 | 3300015334 | Switchgrass Phyllosphere | VHLMHSILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVLE |
Ga0182150_11447421 | 3300015336 | Switchgrass Phyllosphere | VHSMHPILIFTMGQVWQRNGMKPPETRVLDVKYVVR |
Ga0182151_11391351 | 3300015337 | Switchgrass Phyllosphere | MHLMHPILNFTMGQVRQRNGVKPPETRVLDIKYVVRNQT |
Ga0182137_10774141 | 3300015338 | Switchgrass Phyllosphere | MHPILIFTMGQVRQRNGVKPPKTRILDVKYVVRNQTNVV |
Ga0182133_11319411 | 3300015340 | Switchgrass Phyllosphere | VHLMHPILIFTMGQVQQRNGVKPPETRVLDVKYVV |
Ga0182133_11760441 | 3300015340 | Switchgrass Phyllosphere | VHLMHPILNFTMGQVRQRNGVKPPETRVLDIKYVVRNQTDV |
Ga0182115_11954321 | 3300015348 | Switchgrass Phyllosphere | MHPILIFTMGQVRQRNGVKPPETRVLDIKYVVRNQPDVLEH* |
Ga0182115_12399251 | 3300015348 | Switchgrass Phyllosphere | IFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVLEH* |
Ga0182185_11991021 | 3300015349 | Switchgrass Phyllosphere | VHLMHPIFIFTMGQVRQRNGVKPPETRVIDVKYVVRNQTDVLEH |
Ga0182185_12311531 | 3300015349 | Switchgrass Phyllosphere | MRPILIFTMGQVRQRNGVKQPETRVLEVKYVVRNQRDVVEH |
Ga0182169_12047702 | 3300015352 | Switchgrass Phyllosphere | MHPMLIFTMGQVRQRNGVKPLETRVLDIKYVVQNQMDILE |
Ga0182179_11100512 | 3300015353 | Switchgrass Phyllosphere | MHLMHPILIFTMGQVRQRNGVKPPETRILDVNYVVRN |
Ga0182179_11992591 | 3300015353 | Switchgrass Phyllosphere | VHLMHPILIFTMGQVWQRNGVKPPETRVLDIKYVVRNQTDVLEHRN |
Ga0182179_13052111 | 3300015353 | Switchgrass Phyllosphere | MHLMHPILIFTMGQVRQRNGVKPPETRVLEVKYVVRNQRDV |
Ga0182167_13101471 | 3300015354 | Switchgrass Phyllosphere | VHLMHPILIFIMGQVWQRNGVKPPETRVLDIKYVVRNQTDVVEQ |
Ga0182167_13676791 | 3300015354 | Switchgrass Phyllosphere | MRLMHPILIFTMGQVRQRNGVKPPETRVLDVKYGVRNQM |
Ga0182195_11592381 | 3300017414 | Switchgrass Phyllosphere | VHLMHLILIFTMGQVRQRNGVKPPETRVLDVKYVV |
Ga0182201_10551011 | 3300017422 | Switchgrass Phyllosphere | MHPILIFTLGQVRQRNGVKPPETQVLDVKYVVRNQMNVV |
Ga0182194_10244561 | 3300017435 | Switchgrass Phyllosphere | VHLMHPILIFTMGHVRQRNGVKPPETRVLDIKYVVRNQPDVLEH |
Ga0182194_11072741 | 3300017435 | Switchgrass Phyllosphere | VHMMHPILIFTMGQVRQRNGVKPPETRVLDVKYMVRNQ |
Ga0182200_10785922 | 3300017439 | Switchgrass Phyllosphere | MHPILIFTKGQVRQXNGVKPPETRVLDVKYVVRNQTDILE |
Ga0182200_11444591 | 3300017439 | Switchgrass Phyllosphere | VHLMHPILIFTMGQVRQRNGVKPPKTRNLDVKYVVRNQTDIV |
Ga0182200_11566161 | 3300017439 | Switchgrass Phyllosphere | MYLMHPILNFRMGQVRQRNGVKPLETRVLDIKYVVR |
Ga0182212_10684231 | 3300017691 | Switchgrass Phyllosphere | HPILIFTMGQVRQRNGVKPPETRVLDIKYVVRNQPDVLEH |
Ga0182210_11375151 | 3300017692 | Switchgrass Phyllosphere | VHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDIL |
Ga0182216_11309461 | 3300017693 | Switchgrass Phyllosphere | MHLILIFTMGHVRQRNGVKPPKTRVLDVKYVVRNQTDILEHQ |
Ga0182211_10464721 | 3300017694 | Switchgrass Phyllosphere | RHKLVHLMNPILIFTMGQVWQRNGMKPPETRVFEVKYVVRNKTDHV |
Ga0207701_109943881 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VHLMHPILIFTMGQVRQRNGVKPPKTRVLDVKYVVRNQTDV |
Ga0207644_109011111 | 3300025931 | Switchgrass Rhizosphere | MHLMHPIQIFTMGQVRQRNDMKRPETRILDVKYVVRNQTDV |
Ga0268322_10088971 | 3300028049 | Phyllosphere | VHLMHPILIFTMGQVHQQNGMKPPETRVLDVKFVVRNQMGVLEH |
Ga0268322_10103442 | 3300028049 | Phyllosphere | IFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDILEH |
Ga0268306_10001941 | 3300028054 | Phyllosphere | VHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNHMDILE |
Ga0268306_10054441 | 3300028054 | Phyllosphere | VHLMHPILIFTMGQVRQRNGVKPPETRVLEVKYVVRNRRDVVE |
Ga0268306_10244441 | 3300028054 | Phyllosphere | MHLMHPILIFTMGQVRQRNGVKPPETRILDVNYVVRNQM |
Ga0268330_10177781 | 3300028056 | Phyllosphere | LMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVLEH |
Ga0268330_10292441 | 3300028056 | Phyllosphere | MHLMHPILIFTMGQVRQRNGVKPPKTRILDIKYVVRNQTDV |
Ga0268330_10376631 | 3300028056 | Phyllosphere | VHLMHPILIFTMGQVRQRNGVKPPETRVLDIKYVVRN |
Ga0268330_10381731 | 3300028056 | Phyllosphere | MHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVL |
Ga0268330_10423911 | 3300028056 | Phyllosphere | VHLMHPILIFTMGQVRQRNGVKPPETRVLEAKYVVRNQRD |
Ga0268330_10614251 | 3300028056 | Phyllosphere | VHLMHPILIFTMGQVHQQNGMKPPETRVLDVKFVVR |
Ga0268352_10410481 | 3300028057 | Phyllosphere | VHLMHPILIFTMGQVRQRNGVKPPETRVLDAKYVV |
Ga0268352_10416111 | 3300028057 | Phyllosphere | PILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVLEH |
Ga0268332_10503951 | 3300028058 | Phyllosphere | VHMMHPILIFTMGQVRQQNSVKPPETRVLEVKYVVRNQRDV |
Ga0268332_10631871 | 3300028058 | Phyllosphere | VHLIHPILIFTMGQVRQRNGVKPPETRVLDLKYVVQNQ |
Ga0268332_10722761 | 3300028058 | Phyllosphere | VHLMHPILIFTMGQVRQRNAVKPPETRVLDVKYVVRNQTDIV |
Ga0268340_10370661 | 3300028064 | Phyllosphere | VHLMRPILIFTMGQVRQLNGVKPPETRVLEVKYVVRNQRDV |
Ga0268355_10039911 | 3300028139 | Phyllosphere | MHPILIFTMGQVHQQNGMKPPETRVLDVKFVVRNQMDI |
Ga0268326_10085701 | 3300028141 | Phyllosphere | VHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDV |
Ga0268347_10193421 | 3300028142 | Phyllosphere | VHLMHPILIFTMGQVRQRNGVKPPETRVLDIKYVVQNQTD |
Ga0268347_10279331 | 3300028142 | Phyllosphere | MHLMHPILIFTMGQVRQRNGVKPPKTRILDVNYVV |
Ga0268347_10313571 | 3300028142 | Phyllosphere | VHLIHPILNFRMGQVRQRNGVKPPETRVLDIKYVVRN |
Ga0268348_10076861 | 3300028143 | Phyllosphere | MRLMHPILIFTMGQVRQRNGVKPPETRVLDIKYVVRNQTDVLEHR |
Ga0268308_10268561 | 3300028151 | Phyllosphere | PILIFTMGLVRQQNGVKPAETRILDVNYVVRNQTDIVEH |
Ga0268341_10079621 | 3300028154 | Phyllosphere | VHLMHPIFIFTMGQVRQRNGVKPPETRVLDVKYVVRNQT |
Ga0268316_10232401 | 3300028253 | Phyllosphere | MHLMHPILNFRMGQVRQRNGVKPPETRVSDIKYVVRNQTDIVE |
Ga0268304_10002046 | 3300028256 | Phyllosphere | VHLMHLILIFTMGQVRQRNGVKPPETRVLNIKYVVRNQP |
Ga0268304_10003432 | 3300028256 | Phyllosphere | VHLMHPLLIFTMGQVRQRNGVKPPETRVLDVKYVVRNQT |
Ga0268310_10084171 | 3300028262 | Phyllosphere | VHLMHPILIFTMGHVRQRNGVKQPETRILDVKYVLRNQTDV |
Ga0268310_10092271 | 3300028262 | Phyllosphere | VHLMHLILIFTMGQVWQRNGVKPPETRVLDVKYVVQNQTYVVE |
Ga0268310_10109042 | 3300028262 | Phyllosphere | VHLMHPILIFTMGQVRQRNGVKPHETRVLDVKYVVRNQTDILEH |
Ga0268310_10165221 | 3300028262 | Phyllosphere | VHLMHPILNFTMGQVRQRNGVKPPETRVLDIKYVVRNQTDVVDHR |
Ga0268266_109968101 | 3300028379 | Switchgrass Rhizosphere | MNPILIFTMGQVWQRNGMKPPETRVFEVKYVVRNKTDH |
Ga0268333_10101411 | 3300028467 | Phyllosphere | VHLMHPILIFTMGQVWQRNCVKPPETRVLDVKYVVRNQTDILEHRN |
Ga0268337_10105241 | 3300028469 | Phyllosphere | VHLMHLILIFTMGQVRQRNGVKPPETRVLDVKYVMRNQMDV |
Ga0268307_10098302 | 3300028470 | Phyllosphere | LMHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVLEH |
Ga0268307_10188692 | 3300028470 | Phyllosphere | VHLMHLILIFTMDQVRQRNGVKPPETRVLDIKYVVRNQ |
Ga0268315_10106112 | 3300028472 | Phyllosphere | MHLMHPILNFRMGQVRQGNGVKPSETRVLDIKYVVRNQ |
Ga0268313_10006172 | 3300028523 | Phyllosphere | VHLMHPILIFTMGQARQRNGVKPPETRVLDIKYVVRNQPDVLEH |
Ga0268305_1035661 | 3300028525 | Phyllosphere | MHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVR |
Ga0268339_10153631 | 3300028526 | Phyllosphere | VHLMHPILIFPMGQVRQRSDVKPPETQVLDVKYVV |
Ga0268335_10174501 | 3300028527 | Phyllosphere | MRLMHPILIFTMGQVRQRNGVKPPETRVLDVKYGVRNQMDVLE |
Ga0268311_10263401 | 3300028529 | Phyllosphere | VHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQT |
Ga0214492_10320261 | 3300032464 | Switchgrass Phyllosphere | VHLMHPILIFTMGHVRQRNGVKPPETRVLDIKYVVRN |
Ga0214497_11015011 | 3300032689 | Switchgrass Phyllosphere | VHLMHPILIFIMGQVRQRNGVKRPETRILDEKFVVR |
Ga0314760_11863561 | 3300033530 | Switchgrass Phyllosphere | VHLMHPILIFTMGQVRQRNGVKPPETRVLDIKYVVRNQP |
⦗Top⦘ |