Basic Information | |
---|---|
Family ID | F086710 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 44 residues |
Representative Sequence | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMRFTTSI |
Number of Associated Samples | 60 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 30.00 % |
% of genes from short scaffolds (< 2000 bps) | 22.73 % |
Associated GOLD sequencing projects | 56 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (72.727 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater (23.636 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.545 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (52.727 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.61% β-sheet: 0.00% Coil/Unstructured: 76.39% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF00041 | fn3 | 3.64 |
PF00534 | Glycos_transf_1 | 3.64 |
PF13469 | Sulfotransfer_3 | 2.73 |
PF00589 | Phage_integrase | 2.73 |
PF02467 | Whib | 0.91 |
PF13884 | Peptidase_S74 | 0.91 |
PF09723 | Zn-ribbon_8 | 0.91 |
PF00685 | Sulfotransfer_1 | 0.91 |
PF03406 | Phage_fiber_2 | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 72.73 % |
All Organisms | root | All Organisms | 27.27 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002200|metazooDRAFT_1270484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300002476|metazooDRAFT_10841034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 686 | Open in IMG/M |
3300005528|Ga0068872_10123734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1525 | Open in IMG/M |
3300006917|Ga0075472_10011405 | All Organisms → cellular organisms → Bacteria | 3870 | Open in IMG/M |
3300006917|Ga0075472_10165688 | All Organisms → Viruses → Predicted Viral | 1086 | Open in IMG/M |
3300008107|Ga0114340_1176525 | Not Available | 752 | Open in IMG/M |
3300008120|Ga0114355_1059546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2689 | Open in IMG/M |
3300008266|Ga0114363_1040399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1909 | Open in IMG/M |
3300008266|Ga0114363_1066652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3059 | Open in IMG/M |
3300008266|Ga0114363_1096461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1659 | Open in IMG/M |
3300008339|Ga0114878_1233206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 588 | Open in IMG/M |
3300010354|Ga0129333_10419877 | All Organisms → Viruses → Predicted Viral | 1181 | Open in IMG/M |
3300010354|Ga0129333_11095585 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300010370|Ga0129336_10061268 | Not Available | 2238 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10859315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300017777|Ga0181357_1047483 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
3300017785|Ga0181355_1310778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300020570|Ga0208465_1000054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 39378 | Open in IMG/M |
3300020570|Ga0208465_1028384 | Not Available | 725 | Open in IMG/M |
3300021962|Ga0222713_10722068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300022752|Ga0214917_10296573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
3300024564|Ga0255237_1072518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300027494|Ga0255094_1067363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300027578|Ga0255075_1061181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300027793|Ga0209972_10445361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 541 | Open in IMG/M |
3300027816|Ga0209990_10312161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 702 | Open in IMG/M |
3300031758|Ga0315907_10021012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6054 | Open in IMG/M |
3300031758|Ga0315907_10470621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1000 | Open in IMG/M |
3300031787|Ga0315900_10097627 | All Organisms → Viruses → Predicted Viral | 2872 | Open in IMG/M |
3300031787|Ga0315900_10285391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1380 | Open in IMG/M |
3300031857|Ga0315909_10174899 | All Organisms → Viruses → Predicted Viral | 1733 | Open in IMG/M |
3300031951|Ga0315904_10143585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2429 | Open in IMG/M |
3300034116|Ga0335068_0235033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 23.64% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.73% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 11.82% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 11.82% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.91% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.36% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.45% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.55% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.73% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.73% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.82% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.82% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.82% |
Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.91% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002200 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - APR 2013 | Environmental | Open in IMG/M |
3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008510 | Microbial Communities in Water bodies, Singapore - Site RA | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300024564 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026993 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027337 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d | Environmental | Open in IMG/M |
3300027494 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d | Environmental | Open in IMG/M |
3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
metazooDRAFT_12704841 | 3300002200 | Lake | MIGPKETVALAWCDNGSVDGKFAEGLMNATITGAANGMPIHTSI |
metazooDRAFT_108410342 | 3300002476 | Lake | MIGKNDTVAIGWCDNGTTDGKFVEGLTTALVAGPTNDMIINTSIRVQGNQIGR |
Ga0068872_101237344 | 3300005528 | Freshwater Lake | MIGKTDTVAIGWCDNGTTDGKFTEGLATALVAGGANGMPIHTTIRVQGNQIGR |
Ga0049080_101257104 | 3300005582 | Freshwater Lentic | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPN |
Ga0049080_101454451 | 3300005582 | Freshwater Lentic | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMRFTTSIRVQGNQI |
Ga0075470_1000151612 | 3300006030 | Aqueous | MIGKNDTVAIGWCDNGTTDGKFTEGLMTAVLAGPANGMPIHTSIR |
Ga0075473_100690573 | 3300006875 | Aqueous | MIGKNDTVAIGWCDNGTTDGKFTEGLMTAVLAGPANGMPIHTSI |
Ga0075472_100114058 | 3300006917 | Aqueous | MIGKNDTVAIGWCDNGTTDGKFTEGLMTAVLAGPANGMPIHTSIRVQGNQIGRQR |
Ga0075472_101656884 | 3300006917 | Aqueous | MIGKSDTVAIGWCDNGTTDGKFTEGLMTAVLAGPANGMPIHTSIRVQGNQIGRQR |
Ga0075458_102827951 | 3300007363 | Aqueous | MIGKSDTVAIGWCDNGTTDGKFTEGLMTAVLAGPA |
Ga0114340_10317658 | 3300008107 | Freshwater, Plankton | MIGTKDTVSLGWCDNGTTDGKFTEGLMTAALAGPANGV |
Ga0114340_11765252 | 3300008107 | Freshwater, Plankton | MIQKNETVAIGWCDNGTTDGKFTEGLMTAVIAGGANGMPIHTSIRVQGNQIGR |
Ga0114346_10691575 | 3300008113 | Freshwater, Plankton | MIQKNETVAIGWCDNGTTDGKFTEGLMTAVIAGGANGMPI |
Ga0114350_11631081 | 3300008116 | Freshwater, Plankton | MIQKQETVAIGWCDNGTTDGKFTKGLMTAVIAGPNNGMRF |
Ga0114351_10823581 | 3300008117 | Freshwater, Plankton | MIGKTDTVAIGWCDNGTTDGKFTEGLLAVTLAAPANGMKIDK |
Ga0114351_13051181 | 3300008117 | Freshwater, Plankton | MIGKTDTVAIGWCDNGTTDGKFTEGLMTAVIAGGANGMPIHTSIR |
Ga0114351_14005743 | 3300008117 | Freshwater, Plankton | MIGKTDTVAIGWCDNGNTDGKFTEGLLAVTLAAPANGMKID |
Ga0114355_10595461 | 3300008120 | Freshwater, Plankton | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMRFTTSIRVQGNQIGRQR |
Ga0114363_10175615 | 3300008266 | Freshwater, Plankton | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNNG |
Ga0114363_10403991 | 3300008266 | Freshwater, Plankton | MIGKTDTVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMRFTTSIRVQGNQIGRQR |
Ga0114363_10666521 | 3300008266 | Freshwater, Plankton | MIQKQETVAIGWCDNGTTDGKFTEGLATALVAGGANGMPIHTTIRVQGNQI |
Ga0114363_10964611 | 3300008266 | Freshwater, Plankton | MIGKTDTVAIGWCDNGTTDGKFTEGLATALVAGGANGMPIHTTIRVQGN |
Ga0114363_11845261 | 3300008266 | Freshwater, Plankton | MIGKTDTVAIGWCDNGTTDGKFTEGLLAVTLAAPANGMKIDKTVR |
Ga0114878_12332061 | 3300008339 | Freshwater Lake | MIGKTDTVAIGWCDNGTTDGKFTEGLATALVAGGANGMPIHTTIRVQGNQI |
Ga0114880_10687161 | 3300008450 | Freshwater Lake | MIQKQETVAIGWCDNGLTDGKFTEGLMTAVIAGPGNGMPIHTS |
Ga0110928_11815223 | 3300008510 | Water Bodies | MIGKNDTVALGWCDNGTTDGKFTEGLTTAIIAGPSN |
Ga0104242_10696403 | 3300008962 | Freshwater | MIGKSDTVAIGWCDNGTTDGKFTEGLMTAVLAGPANGMPIHT |
Ga0129333_100544087 | 3300010354 | Freshwater To Marine Saline Gradient | MIQKQETVAVGWCDNGTTDGKFTEGLMTAVLAGPANGMPIHT |
Ga0129333_102771864 | 3300010354 | Freshwater To Marine Saline Gradient | MIGKTDTVAIGWCDNGTTDGKFTEGLMTAVLAGPA |
Ga0129333_103246544 | 3300010354 | Freshwater To Marine Saline Gradient | MIQKNETVAIGWCDNGTTDGKFTEGLLAVTLAAPA |
Ga0129333_104198773 | 3300010354 | Freshwater To Marine Saline Gradient | MIGKNDTVALGWCDNGTTDGKFTEGLMTAFIAGANNDMFINTSIRVQGNQIGRQRQ |
Ga0129333_105166493 | 3300010354 | Freshwater To Marine Saline Gradient | MIGKNDTVAIGWCDNGTTDGKFTEGLMTAFIAGANNDMFIN |
Ga0129333_107675261 | 3300010354 | Freshwater To Marine Saline Gradient | MIRPNETVAIGWCDNGTTDGKFTEGLMTAALAGPANGVGLSS |
Ga0129333_110955853 | 3300010354 | Freshwater To Marine Saline Gradient | MIGKNDTVALGWCDNGTTDGKFTEGLMTAFIAGANNDMFINTSIRVQGNQIG |
Ga0129333_116755641 | 3300010354 | Freshwater To Marine Saline Gradient | MIGKNDTVALGWCDNGLTDGKFTEGLMTAFIAGANNGMFINTSIR |
Ga0129336_100612685 | 3300010370 | Freshwater To Marine Saline Gradient | MIGKSDTVAIGWCDNGTTDGKFTEGLMTAVLAGPANGMPIHTSIRVQGNQIG |
Ga0129336_103999053 | 3300010370 | Freshwater To Marine Saline Gradient | MIGKNDTVAIGWCDNGTTDGKFTEGLMTAVLAGPANGMPI |
Ga0129336_105682522 | 3300010370 | Freshwater To Marine Saline Gradient | MISKSDTVAIGWCDNGTTDGKFTEGLMTAVLAGPA |
Ga0129336_105882211 | 3300010370 | Freshwater To Marine Saline Gradient | MIQKNETVAIGWCDNGTTDGKFTEGLMTAVIAGGANGMPIHTSIRVQG |
Ga0129336_105890933 | 3300010370 | Freshwater To Marine Saline Gradient | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGGANGMPIHTSIRVQG |
(restricted) Ga0172367_106112162 | 3300013126 | Freshwater | MIGKNDTVAIGWCDNGLVDGKFTEGLLGAVLSASPAVKITSSIRVS |
(restricted) Ga0172373_108593151 | 3300013131 | Freshwater | MIGKNDTVALGWCDNGTTDGKFTEGLTTALVAGPGN |
(restricted) Ga0172373_108624911 | 3300013131 | Freshwater | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNNGMRFTTSIRVQ |
(restricted) Ga0172372_104765603 | 3300013132 | Freshwater | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPN |
(restricted) Ga0172372_106101091 | 3300013132 | Freshwater | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNNGMRFTTSIRVQGNQI |
(restricted) Ga0172372_108045743 | 3300013132 | Freshwater | MIGKTDTVAIGWCDNGTTDGKFTEGLTTAILTGPVN |
(restricted) Ga0172376_100752445 | 3300014720 | Freshwater | MINKNDTVAIGWCDNGLVDGKFTEGLLGAVLSASPAVKITSSI |
(restricted) Ga0172376_102010641 | 3300014720 | Freshwater | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNNGMRFTTSIRVQGN |
Ga0181365_10074345 | 3300017736 | Freshwater Lake | MIQKQETVAIGWCDNGTTDGKFTEGLMTSVIAGPNNCMRFTTS |
Ga0181357_10474834 | 3300017777 | Freshwater Lake | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMTFSTSIRVQG |
Ga0181349_13112391 | 3300017778 | Freshwater Lake | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMT |
Ga0181355_13107781 | 3300017785 | Freshwater Lake | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMTFSTSIRVQGNQ |
Ga0211729_113049703 | 3300020172 | Freshwater | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMRFTT |
Ga0208465_100005462 | 3300020570 | Freshwater | MIGKSDTVAIGWCDNGTTDGKFTEGLMTAAIAGPGNGTPIASS |
Ga0208465_10283841 | 3300020570 | Freshwater | MIGKTDTVALGWCDNGTTDGKFTEGLATALVAGGANGMPIH |
Ga0194133_101885331 | 3300021091 | Freshwater Lake | MIKKNETVSVGWCDNGTTDGKFTEGLTSILLAGPNNG |
Ga0222714_103651091 | 3300021961 | Estuarine Water | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMRFSTSIRVQ |
Ga0222713_107220681 | 3300021962 | Estuarine Water | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNNGMRFTTSI |
Ga0222712_102472811 | 3300021963 | Estuarine Water | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNN |
Ga0181354_12205663 | 3300022190 | Freshwater Lake | MVGPKETVAIGWCDNGLVDGKFTEGLMTAVIAGGANKMPISTSIRVQ |
Ga0214917_102965733 | 3300022752 | Freshwater | MIGKSDTVAIGWCDNGTTDGKFTEGLMTAVLAGPANGMPIHTSIRVQGNQIGRQ |
Ga0255237_10725181 | 3300024564 | Freshwater | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMRFTTSI |
Ga0255237_11259691 | 3300024564 | Freshwater | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMRFTTSIRV |
Ga0208546_10027659 | 3300025585 | Aqueous | MIGKNDTVAIGWCDNGTTDGKFTEGLMTAVLAGPANGMPIHTSIRVQ |
Ga0208784_12551441 | 3300025732 | Aqueous | MIGKNDTVAIGWCDNGTTDGKFTEGLMTAVLAGPANGMP |
Ga0209975_10064001 | 3300026993 | Freshwater Lake | MIQKNETVAIGWCDNGLTDGKFTEGLMAAVIAGPGN |
Ga0255087_10389091 | 3300027337 | Freshwater | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMR |
Ga0255094_10673631 | 3300027494 | Freshwater | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMRFTTSIRVQGNQIGRQ |
Ga0255075_10611811 | 3300027578 | Freshwater | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMRFTTSIRVQGNQIGR |
Ga0208974_10683503 | 3300027608 | Freshwater Lentic | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNNGMRFTTSIRV |
Ga0208974_11708882 | 3300027608 | Freshwater Lentic | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMRFTSS |
Ga0208975_10121835 | 3300027659 | Freshwater Lentic | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMRFT |
Ga0208975_11420153 | 3300027659 | Freshwater Lentic | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNNGMRFTTSIRVQGNQ |
Ga0209355_12461013 | 3300027744 | Freshwater Lake | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNN |
Ga0209246_100147786 | 3300027785 | Freshwater Lake | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMRFTTSIRVQG |
Ga0209972_104453612 | 3300027793 | Freshwater Lake | MIGKTDTVALGWCDNGTTDGKFTEGLATALVAGGANGMPIHTTIRVQG |
Ga0209990_100141931 | 3300027816 | Freshwater Lake | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNNGMRFTTSIRVQG |
Ga0209990_100182671 | 3300027816 | Freshwater Lake | MIGKTDTVAIGWCDNGNTDGKFTEGLLAVTLAAPANGMKIDKTVRVS |
Ga0209990_101756944 | 3300027816 | Freshwater Lake | MIQKNETVAIGWCDNGTTDGKFTEGLMTAVIAGGANGM |
Ga0209990_103121611 | 3300027816 | Freshwater Lake | MIQKNETVAIGWCDNGTTDGKFTEGLMTAVIAGGANGMPIHTSIRVQGNQIG |
(restricted) Ga0247834_10641214 | 3300027977 | Freshwater | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMRFTTS |
Ga0315907_1002101212 | 3300031758 | Freshwater | MIQKNETVAIGWCDNGLTDGKFTEGLMTAIVAGPGNGINIHTSIRVQGNQ |
Ga0315907_100289511 | 3300031758 | Freshwater | MIQKNETVAIGWCDNGTTDGKFTEGLMTAVIAGGANGMPIHTSIRVQGN |
Ga0315907_100636821 | 3300031758 | Freshwater | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNNGM |
Ga0315907_104706213 | 3300031758 | Freshwater | MIGKTDTVAIGWCDNGTTDGKFTEGLATALVAGGANGMPIHTTIRVQGNQIGRQR |
Ga0315907_106835241 | 3300031758 | Freshwater | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGM |
Ga0315907_109796493 | 3300031758 | Freshwater | MIGKTDTVAIGWCDNGTTDGKFTEGLMTAVIAGGANGMPIHTSIRV |
Ga0315907_112267691 | 3300031758 | Freshwater | MIQKNETVAIGWCDNGTTDGKFTEGLMTAVIAGGANGMP |
Ga0315900_100976271 | 3300031787 | Freshwater | MIGKTDTVAIGWCDNGTTDGKFTEGLATALVAGGANGMPIHTTIRVQG |
Ga0315900_101471736 | 3300031787 | Freshwater | MIQKNETVAIGWCDNGTTDGKFTEGLMTAVIAGGA |
Ga0315900_102853914 | 3300031787 | Freshwater | MIQKNETVAIGWCDNGTTDGKFTEGLMTAVIAGGANGMPIHTSIRVQGNQI |
Ga0315909_100553946 | 3300031857 | Freshwater | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNNGMRFT |
Ga0315909_101012871 | 3300031857 | Freshwater | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNNGMSFTTSIR |
Ga0315909_101748991 | 3300031857 | Freshwater | MIGKTDTVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMRFTTSIRVQGN |
Ga0315909_102627014 | 3300031857 | Freshwater | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNNGMRFTTSIR |
Ga0315904_101435851 | 3300031951 | Freshwater | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNNGMRFTTSIRVQGNQIGRQR |
Ga0315904_104357984 | 3300031951 | Freshwater | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNG |
Ga0315904_112213843 | 3300031951 | Freshwater | MIGKTDTVAIGWCDNGTTDGKFTEGLATALVAGGANGVPIHTTI |
Ga0315901_108120541 | 3300031963 | Freshwater | MIGKTDTVAIGWCDNGTTDGKFTEGLMTAVIAGGA |
Ga0315901_108842291 | 3300031963 | Freshwater | MIQKNETVAIGWCDGGLTDGKFTEGLMTAVIAGPGNGMP |
Ga0315906_103379721 | 3300032050 | Freshwater | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNNGMR |
Ga0315902_105696581 | 3300032093 | Freshwater | MIGKSDTVAIGWCDNGTTDGKFTEGLMTAVLAGPANGMPIHTSIR |
Ga0315902_105796861 | 3300032093 | Freshwater | MIQKNETVAIGWCDGGLTDGKFTEGLMTAVIAGPGNG |
Ga0315903_101112486 | 3300032116 | Freshwater | MIQKNETVAIGWCDNGTTDGKFTEGLMTAVIAGGANG |
Ga0315903_101146274 | 3300032116 | Freshwater | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNNGMRFTTSIRVQGNQIG |
Ga0315903_101211161 | 3300032116 | Freshwater | MIQKQETVAIGWCDNGNTDGKFTEGLMTAVIAGPNNGMRFTT |
Ga0315903_107163361 | 3300032116 | Freshwater | MIGKTDTVAIGWCDNGTTDGKFTEGLATALVAGGANGMP |
Ga0310130_0028637_3_140 | 3300034073 | Fracking Water | MIGKNDTVALGWCDNGTTDGKFTEGLTTALVAGPGNGMPIHTTIRV |
Ga0335068_0035419_2845_2988 | 3300034116 | Freshwater | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMKISTNDTATT |
Ga0335068_0235033_788_943 | 3300034116 | Freshwater | MIQKQETVAIGWCDNGTTDGKFTEGLMTAVIAGPNNGMRFTTSIRVQGNQIG |
⦗Top⦘ |