NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F086746

Metagenome Family F086746

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086746
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 44 residues
Representative Sequence MEAPSDAELRRAGKALALGFVLGLVLLAVARRAPGRRGEGAAPG
Number of Associated Samples 99
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 26.36 %
% of genes from short scaffolds (< 2000 bps) 80.00 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.091 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(18.182 % of family members)
Environment Ontology (ENVO) Unclassified
(24.545 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(30.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 37.50%    β-sheet: 0.00%    Coil/Unstructured: 62.50%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF01520Amidase_3 50.00
PF00296Bac_luciferase 32.73
PF02195ParBc 7.27
PF00085Thioredoxin 5.45
PF13193AMP-binding_C 1.82
PF01381HTH_3 0.91
PF00392GntR 0.91
PF02527GidB 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0860N-acetylmuramoyl-L-alanine amidaseCell wall/membrane/envelope biogenesis [M] 50.00
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 32.73
COG035716S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B)Translation, ribosomal structure and biogenesis [J] 0.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.09 %
UnclassifiedrootN/A0.91 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_10158372All Organisms → cellular organisms → Bacteria2389Open in IMG/M
3300000955|JGI1027J12803_102125661All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300004114|Ga0062593_102184894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300004157|Ga0062590_102980051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300004479|Ga0062595_102535590All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005294|Ga0065705_11145915All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005345|Ga0070692_10318277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium956Open in IMG/M
3300005347|Ga0070668_100769936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria853Open in IMG/M
3300005354|Ga0070675_100273596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1482Open in IMG/M
3300005438|Ga0070701_10315193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria966Open in IMG/M
3300005441|Ga0070700_100850417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria739Open in IMG/M
3300005444|Ga0070694_101570541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300005471|Ga0070698_100507822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1144Open in IMG/M
3300005471|Ga0070698_101849392All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005713|Ga0066905_100451451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1057Open in IMG/M
3300005844|Ga0068862_100229533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1683Open in IMG/M
3300006049|Ga0075417_10062194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1636Open in IMG/M
3300006058|Ga0075432_10000639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10710Open in IMG/M
3300006847|Ga0075431_101885133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300009094|Ga0111539_10169865All Organisms → cellular organisms → Bacteria2548Open in IMG/M
3300009148|Ga0105243_10023400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4704Open in IMG/M
3300009157|Ga0105092_10056545All Organisms → cellular organisms → Bacteria2111Open in IMG/M
3300009553|Ga0105249_13291023All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300009609|Ga0105347_1257474All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300009678|Ga0105252_10433294All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300009801|Ga0105056_1012915All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300009804|Ga0105063_1028004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria710Open in IMG/M
3300009811|Ga0105084_1000999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3021Open in IMG/M
3300009811|Ga0105084_1002002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2464Open in IMG/M
3300009818|Ga0105072_1072179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium672Open in IMG/M
3300009822|Ga0105066_1070448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium750Open in IMG/M
3300009823|Ga0105078_1017915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium804Open in IMG/M
3300009836|Ga0105068_1056759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium716Open in IMG/M
3300010038|Ga0126315_10008810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4693Open in IMG/M
3300010041|Ga0126312_10197845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1404Open in IMG/M
3300010041|Ga0126312_11017540All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300010400|Ga0134122_10350175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1286Open in IMG/M
3300010403|Ga0134123_10731954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300011412|Ga0137424_1001738All Organisms → cellular organisms → Bacteria2078Open in IMG/M
3300012204|Ga0137374_10664182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria787Open in IMG/M
3300012353|Ga0137367_10024836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4660Open in IMG/M
3300012355|Ga0137369_10725955All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300012358|Ga0137368_10244503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1244Open in IMG/M
3300012938|Ga0162651_100084255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300012985|Ga0164308_11467134All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300015371|Ga0132258_10764576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2434Open in IMG/M
3300015371|Ga0132258_11987727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1463Open in IMG/M
3300015373|Ga0132257_100896143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1112Open in IMG/M
3300017965|Ga0190266_10052760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1448Open in IMG/M
3300018028|Ga0184608_10014516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2754Open in IMG/M
3300018055|Ga0184616_10099453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1036Open in IMG/M
3300018076|Ga0184609_10020445All Organisms → cellular organisms → Bacteria2617Open in IMG/M
3300018076|Ga0184609_10145999All Organisms → cellular organisms → Bacteria1087Open in IMG/M
3300018081|Ga0184625_10027996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2740Open in IMG/M
3300018084|Ga0184629_10442084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria681Open in IMG/M
3300018465|Ga0190269_10022149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2860Open in IMG/M
3300018466|Ga0190268_10002062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3996Open in IMG/M
3300018469|Ga0190270_10131581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1992Open in IMG/M
3300019767|Ga0190267_10003729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3800Open in IMG/M
3300020016|Ga0193696_1029112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1481Open in IMG/M
3300021081|Ga0210379_10152929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium982Open in IMG/M
3300021344|Ga0193719_10108225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1209Open in IMG/M
3300021510|Ga0222621_1063468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium777Open in IMG/M
3300025735|Ga0207713_1059472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1466Open in IMG/M
3300025935|Ga0207709_10050549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2543Open in IMG/M
3300025938|Ga0207704_10360414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1135Open in IMG/M
3300027006|Ga0209896_1023911All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300027056|Ga0209879_1000105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8981Open in IMG/M
3300027056|Ga0209879_1001048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3584Open in IMG/M
3300027056|Ga0209879_1013713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1330Open in IMG/M
3300027163|Ga0209878_1004899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1946Open in IMG/M
3300027209|Ga0209875_1033698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium614Open in IMG/M
3300027577|Ga0209874_1085227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium769Open in IMG/M
3300027682|Ga0209971_1096241Not Available724Open in IMG/M
3300027695|Ga0209966_1053520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria862Open in IMG/M
3300027743|Ga0209593_10146391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria850Open in IMG/M
3300027952|Ga0209889_1100716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300027961|Ga0209853_1119230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300028587|Ga0247828_10340030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium843Open in IMG/M
3300028589|Ga0247818_10960233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300028592|Ga0247822_11305651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300028720|Ga0307317_10287750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300028722|Ga0307319_10071334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1100Open in IMG/M
3300028722|Ga0307319_10246891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium587Open in IMG/M
3300028755|Ga0307316_10029088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1797Open in IMG/M
3300028796|Ga0307287_10239489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300028803|Ga0307281_10163462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria786Open in IMG/M
3300028812|Ga0247825_10320384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1086Open in IMG/M
3300028812|Ga0247825_11385328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300028819|Ga0307296_10114748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1446Open in IMG/M
3300028876|Ga0307286_10052659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1382Open in IMG/M
3300030336|Ga0247826_10009041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3989Open in IMG/M
3300030336|Ga0247826_11203912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium607Open in IMG/M
3300031170|Ga0307498_10402829All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300031562|Ga0310886_10998173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300031824|Ga0307413_11200292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300031847|Ga0310907_10597103All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300031854|Ga0310904_10447253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium856Open in IMG/M
3300031858|Ga0310892_10099785All Organisms → cellular organisms → Bacteria1586Open in IMG/M
3300031908|Ga0310900_10595566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium873Open in IMG/M
3300031908|Ga0310900_10743505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria789Open in IMG/M
3300031913|Ga0310891_10214803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria652Open in IMG/M
3300031944|Ga0310884_10292052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria906Open in IMG/M
3300032012|Ga0310902_10022668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2779Open in IMG/M
3300032075|Ga0310890_10133234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1617Open in IMG/M
3300032122|Ga0310895_10610920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300033550|Ga0247829_10239087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1457Open in IMG/M
3300033551|Ga0247830_10480080All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300034115|Ga0364945_0107391All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300034150|Ga0364933_157162All Organisms → cellular organisms → Bacteria590Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil18.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.45%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand15.45%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.45%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.45%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.64%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.64%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.73%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.73%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.73%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.82%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.82%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.82%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.82%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.91%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.91%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.91%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009801Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30EnvironmentalOpen in IMG/M
3300009804Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40EnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300009823Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50EnvironmentalOpen in IMG/M
3300009836Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300025735Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027006Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027056Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027163Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027209Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027682Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027952Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027961Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1015837213300000891SoilMQAPSDAELRRAGKALALGFVLGLVLLLVARRARALAGGPDLR*
JGI1027J12803_10212566123300000955SoilMEAPSDAELRRAGKALALGFVLGLVLLAVARRAPG
Ga0062593_10218489423300004114SoilMQAPSDAELRRAGKALALGFVLGLVLLLMARRARALAGGPDLR*
Ga0062590_10298005123300004157SoilASGCSRATPPTYDTHPMGAPSDAELRRAGKALALGFALGLVLLLVARRASGRRVGGANPG
Ga0062595_10253559023300004479SoilMGAPSDAELRRAGKALALGFALGLVLLLVARRASGRRVGGANPG*
Ga0065705_1114591513300005294Switchgrass RhizosphereMEVPADAELRRAGKALALGFALGLVLLLVARRTSGRRVGGADPR*
Ga0070692_1031827723300005345Corn, Switchgrass And Miscanthus RhizosphereSHRRTIPVPMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRDEEGSG*
Ga0070668_10076993623300005347Switchgrass RhizosphereMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRDKEGSG*
Ga0070675_10027359623300005354Miscanthus RhizosphereMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRDEEGSG*
Ga0070701_1031519323300005438Corn, Switchgrass And Miscanthus RhizosphereMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGSG*
Ga0070700_10085041723300005441Corn, Switchgrass And Miscanthus RhizosphereMQAPSDAELRRAGKALALGFVLGLVLLLRLAAPGQLAGGPDLR*
Ga0070694_10157054123300005444Corn, Switchgrass And Miscanthus RhizosphereDAELRRAGKALALGFVLGLVLLLVARRAPRQLAGGPDPR*
Ga0070698_10050782213300005471Corn, Switchgrass And Miscanthus RhizosphereRATPPPYDTHPMDAPSDAELRRAGKALALGFVLGLVLLAVARRAPGRRAAPT*
Ga0070698_10184939223300005471Corn, Switchgrass And Miscanthus RhizosphereMEAPSDAELGRAGKALALGLALGLVLLLVARRPAGRRARGGANPGEGDALG*
Ga0066905_10045145123300005713Tropical Forest SoilLRRAGKALALGFALGLVLLALARRAPGGRGEEARSG*
Ga0068862_10022953323300005844Switchgrass RhizosphereMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGRSG*
Ga0075417_1006219423300006049Populus RhizosphereMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEASG*
Ga0075432_1000063953300006058Populus RhizosphereMKAPSDDELRRAGKAIALGFALGLVLLALARRAPGRRGEEGSG*
Ga0075431_10188513313300006847Populus RhizospherePIPMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGSG*
Ga0111539_1016986543300009094Populus RhizosphereMDAPTDAELRRAGKAFALGFALGLALLLVARRAPGRRVGGADPR*
Ga0105243_1002340033300009148Miscanthus RhizosphereMKAPSDDELRRAGRALALGFALGLVLLALARRAPGRRDEEGSG*
Ga0105092_1005654523300009157Freshwater SedimentMEAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEDARSG*
Ga0105249_1329102323300009553Switchgrass RhizosphereMEAPSDAELRLAGKALVLGFALGLVLLLVARRAQRQ
Ga0105347_125747423300009609SoilMEAPSDAELRRAGKALALGFALGIVLLLVARRAPGQRAGGGTPGSGDPVR*
Ga0105252_1043329423300009678SoilMEAPSDAELRRAGKALALGFALGLVLLLVARRAPGQRGGGANRG*
Ga0105056_101291523300009801Groundwater SandMEAPSDAELRRAGKALALGFVLGLVLLALARRAPGRRGEEAASG*
Ga0105063_102800423300009804Groundwater SandMEAPSDDELRRAGKALALGFVLGLVLLALASRAPGRRGEGATSG*
Ga0105084_100099943300009811Groundwater SandMEAPSDDELRRAGKALALGFVLGLVLLALARRAPGRRGEEAASG*
Ga0105084_100200233300009811Groundwater SandMKAPSDDELRSAGKALALGFALGLVLLALARRAPGRRGEEGSG*
Ga0105072_107217913300009818Groundwater SandDDELRRAGKALALGFALGLVLLALARRAPGRRGEERRSG*
Ga0105066_107044823300009822Groundwater SandPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGSG*
Ga0105078_101791513300009823Groundwater SandRTIPIPMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGRSG*
Ga0105068_105675913300009836Groundwater SandPYDTHPMEAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEDARSG*
Ga0126315_1000881053300010038Serpentine SoilMKAPRDDELRRAGKALGLGFVLGLVLLVLARRAPGRRGEESAPG*
Ga0126312_1019784523300010041Serpentine SoilMKAPPDEELRRAGKALGLGFVLGLVLLVLARRAPGRRGEGSAPG*
Ga0126312_1101754023300010041Serpentine SoilMEALSDDELRRAGKALSLGFVLGLVLLALARRATGRRGEGAASG*
Ga0134122_1035017523300010400Terrestrial SoilMEAPSEAELRRAGKALVLGFALGLVLLLVARRAPGQRAGGANPG*
Ga0134123_1073195423300010403Terrestrial SoilMEAPSDAELRRAGKALVLGFALGLVLLLVARRAQRQHAGGANPG*
Ga0137424_100173833300011412SoilMEAPSDAELRRAGKALALGFALGLVLLLVARRAPGQRAGGADRA*
Ga0137374_1066418223300012204Vadose Zone SoilMEAPSDDEVRRAGKALALGFVLGLVLLTLARRATGRRGEGAASG*
Ga0137367_1002483643300012353Vadose Zone SoilMEAPSDDEVRRAGKALALGFVLGLVLLALARRVPSRRGEGAASG*
Ga0137369_1072595523300012355Vadose Zone SoilMEAPSDAELRRAGKALALGFALGLLLLLVARRAPGQRAGGANPG*
Ga0137368_1024450323300012358Vadose Zone SoilMEAPSDDELRRAGKALGLGFVLGLVLLALARRAPGRRGEGAASG*
Ga0162651_10008425513300012938SoilPPPYDTHPMEAPSDAERRRAGKALALGFVLGLVLLAVARRAPGRRGQRAAPG*
Ga0164308_1146713423300012985SoilMEAPTDAELRRAGKALALGFALGLVLLLVARRASGRRVGGADPR*
Ga0132258_1076457623300015371Arabidopsis RhizosphereMKAPSDDELRRAGKALALGFALGLVLLALARRAPGPRGEEGSG*
Ga0132258_1198772723300015371Arabidopsis RhizosphereMGAPSDAELRRAGKALALGFALGLVLLLVARRAPGRRVGGANPG*
Ga0132257_10089614323300015373Arabidopsis RhizosphereMEVPADAELRRAGKALALGFALGLVLLLVARRAPGGRVGGANPG*
Ga0190266_1005276023300017965SoilMEAPSDAELRRAGKALALGFVLGLVLLAVARRAPGRRATPT
Ga0184608_1001451633300018028Groundwater SedimentMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGRSG
Ga0184616_1009945323300018055Groundwater SedimentMEVPSGAELRRAAKALVPGFALGLVLLLVARRAPGKYAGGANAG
Ga0184609_1002044523300018076Groundwater SedimentMEAPSDAELRRAGKALALGFVLGLVLLAVARRAPDRRGEGAAPG
Ga0184609_1014599923300018076Groundwater SedimentMKAPSDDELRRAGKALALGFALGLVVLALARRASGRRGEEGRSG
Ga0184625_1002799623300018081Groundwater SedimentMEAPSEAELRRAGKALALGFALGLVLLLVARRAPGLRAGGAKRG
Ga0184629_1044208423300018084Groundwater SedimentMEAPSDAELRRAGKALALGFALGLVLLLVARRAGRADPG
Ga0190269_1002214943300018465SoilMKTPSDAELLRAGKALALGFVLGLVLLAVARRAPGRRAAPT
Ga0190268_1000206243300018466SoilMDAPSDAELRRAGKALALGFVLGLVLLAVARRAPGRRAAPS
Ga0190270_1013158123300018469SoilMEAPSEAELRRAGKALALGFALGLVLLLVARRAPERRAGGADRG
Ga0190267_1000372943300019767SoilMEAPSDADLRRAGKALALGFVLGLVLLAVARRAPGRRAAPS
Ga0193696_102911223300020016SoilMEAPSDAELRRAGKALALGFALGLVLLLVARRSPGQRAGGANPG
Ga0210379_1015292923300021081Groundwater SedimentMEAPSDAELRRAGTALALGFALGLVLLLVARRASGQRAGGTNPG
Ga0193719_1010822523300021344SoilMGAPSDAELRRAGKALALGFALGLVLLLVGRRAPGRRVGGANPR
Ga0222621_106346823300021510Groundwater SedimentSHRRTIPIPMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGRSG
Ga0207713_105947223300025735Switchgrass RhizosphereMGAPSDAELRRAGKALALGFALGLVLLLVARRASGRRVGGANPG
Ga0207709_1005054933300025935Miscanthus RhizosphereMKAPSDDELRRAGRALALGFALGLVLLALARRAPGRRDEEGSG
Ga0207704_1036041423300025938Miscanthus RhizosphereMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRDEEGSG
Ga0209896_102391123300027006Groundwater SandMEAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGSG
Ga0209879_100010573300027056Groundwater SandMEAPSDDELRRAGKALALGFVLGLVLLALARRAPGRRGEEAASG
Ga0209879_100104833300027056Groundwater SandMKTPSDAELLRAGKALALGFVLGLVLLAVARRAPGRRGQRAAPS
Ga0209879_101371323300027056Groundwater SandMKAPSDDELRSAGKALALGFALGLVLLALARRAPGRRGEEGSG
Ga0209878_100489933300027163Groundwater SandMEAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEDARSG
Ga0209875_103369823300027209Groundwater SandPSDDELRRAGKALALGFVLGLVLLALARRAPGRRGEEAASG
Ga0209874_108522723300027577Groundwater SandMEASPDAELRRAGKALALGFVLGLVLLAIARRGRGRRGEEAASG
Ga0209971_109624123300027682Arabidopsis Thaliana RhizosphereAPSDAELRRAVKALALGFVLGLVLLAVARRAPGRRAAPS
Ga0209966_105352023300027695Arabidopsis Thaliana RhizosphereMKAPSDDELWRAGKALALGFALGLVLLALARRAPGRRGEDARSG
Ga0209593_1014639123300027743Freshwater SedimentMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGSG
Ga0209889_110071623300027952Groundwater SandAPSDDELRRAGKALALGFVLGLVLLALARRAPGRRGEEAASG
Ga0209853_111923023300027961Groundwater SandPIPMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGSG
Ga0247828_1034003013300028587SoilRASGCSRGTPPPYDTQPMEAPTDAELRRAGKALALGFALGLVLLLVARRASGRRVGGADP
Ga0247818_1096023323300028589SoilMEAPTDAELRRAGKALALGFALGLVLLLVARRASGRRVGGADPR
Ga0247822_1130565113300028592SoilIYDIHPMEAPSEAEREPQRERLAGAPELGLVLLLVARRAPGLRAGGAKRG
Ga0307317_1028775013300028720SoilDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGRSG
Ga0307319_1007133423300028722SoilMEAPSDDELRRAGKALALGFVLGLVLLALGRRATGRCREGAAPG
Ga0307319_1024689113300028722SoilSVAERRRAGKALALGFVLGLVLLAVARRAPGRRGQRAAPG
Ga0307316_1002908823300028755SoilMEAPSDAELRRAGKALALGFVLGLVLLAVARRAPGRRGEGAAPG
Ga0307287_1023948923300028796SoilMEAPSDAELRRAGKALALGFVLGLALLAVGRRAPDRRGEGAAPG
Ga0307281_1016346223300028803SoilMEAPSDAELRRAGKALALGFALGLVLLLVARRASGQRAGGTNPG
Ga0247825_1032038423300028812SoilMEVPSGAELWRAARALVLGFALGLVLLLVARHAPGQDAGGANAG
Ga0247825_1138532823300028812SoilIPIPMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGSG
Ga0307296_1011474823300028819SoilMQAPSDAELLRAGKALALGFALGLVLLLVARRAPGRRAGG
Ga0307286_1005265933300028876SoilHPMEAPSDAELRRAGKALALGFVLGLVLLAVARRAPGRRGQRAAPS
Ga0247826_1000904123300030336SoilMEAPTDAELRRAGKALALGFALGLVLLLVARRASGRRVGGAGPR
Ga0247826_1120391213300030336SoilSIYDIHPMEAPFEAELRRAGKALALGFALGLVLLLVARRAPGLRAGGAKPG
Ga0307498_1040282913300031170SoilMGTPSDAELRRAGKALALGFALGLVLLLVARRASGRRIGGANPG
Ga0310886_1099817323300031562SoilTHPMGAPSDAELRRAGKALALGFALGLVLLLVARRESGRRVGGANPG
Ga0307413_1120029223300031824RhizosphereDDELRRAGKALGLGFVLGLVLLVLARRAPGRRGEGSPPG
Ga0310907_1059710323300031847SoilMEVPADAELRRAGKALALGFALGLVLLLVARRASGRRVGGADPR
Ga0310904_1044725323300031854SoilMEAPTDAELRRAGKALALGFALGLVLLLVARRTSGRRVGGADPR
Ga0310892_1009978523300031858SoilMEVPADAELRRAGKALALGFALGLVLLLVARRASGRRVGGANPG
Ga0310900_1059556623300031908SoilMEVPADAELRRAGKALALGFALGLVLLLVARRTSGRRVGGADPR
Ga0310900_1074350523300031908SoilMEAPSDAELRRAGKALVLGFALGLVLLLVARRAQRQRAGGANPD
Ga0310891_1021480323300031913SoilMEAPSDAELRRAGKALALGFALGLVLLLVARRASGRRVGGAGPR
Ga0310884_1029205223300031944SoilMEAPSDAELRRAGKALALGFALGLVLLLVARRAPERRAGGADRG
Ga0310902_1002266843300032012SoilMEAPSDAELRRAGKALALGFALGLVLLLVARRASGRRVGGADPR
Ga0310890_1013323433300032075SoilMDAPTDAELRRAGKALALGFALGLVLLLVARRASGRRVGGAGPR
Ga0310895_1061092013300032122SoilRGTPPPYDTQPMEVPADAELRRAGKALALGFALGLVLLLVARRASGRRVGGANPG
Ga0247829_1023908723300033550SoilMEAPFEAELRRAGKALALGFALGLVLLLVARRAPGLRAGGAKRG
Ga0247830_1048008023300033551SoilMEAPSEAELRRAGKALALGFALGLVLLLVARRAPGLRAGGAKPG
Ga0364945_0107391_65_1993300034115SedimentMKAPSDDELRRAGKALALGFALGLMLLALARRTPGRRGEEGRSG
Ga0364933_157162_361_4953300034150SedimentMEAPSGAELRRAAKALVVGFALGLVLLLVARHAPGKYAGGANAG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.