Metagenome / Metatranscriptome Family F086770

Basic Information
Family ID	F086770
Family Type	Metagenome / Metatranscriptome
Number of Sequences	110
Average Sequence Length	43 residues
Representative Sequence	LDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA
Number of Associated Samples	83
Number of Associated Scaffolds	110

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	40.91 %
% of genes near scaffold ends (potentially truncated)	67.27 %
% of genes from short scaffolds (< 2000 bps)	77.27 %
Associated GOLD sequencing projects	80
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.30

Most Common Taxonomy
Group	Bacteria (70.000 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (29.091 % of family members)
Environment Ontology (ENVO)	Unclassified (23.636 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (56.364 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 27.14% β-sheet: 0.00% Coil/Unstructured: 72.86%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 110 Family Scaffolds
PF00496	SBP_bac_5	2.73
PF13561	adh_short_C2	2.73
PF01609	DDE_Tnp_1	2.73
PF13751	DDE_Tnp_1_6	2.73
PF07883	Cupin_2	2.73
PF02585	PIG-L	1.82
PF02775	TPP_enzyme_C	1.82
PF13610	DDE_Tnp_IS240	1.82
PF13586	DDE_Tnp_1_2	1.82
PF02371	Transposase_20	1.82
PF10258	PHAX_RNA-bd	1.82
PF13683	rve_3	1.82
PF03972	MmgE_PrpD	1.82
PF13340	DUF4096	1.82
PF11941	DUF3459	0.91
PF00239	Resolvase	0.91
PF00076	RRM_1	0.91
PF13546	DDE_5	0.91
PF13384	HTH_23	0.91
PF04909	Amidohydro_2	0.91
PF00296	Bac_luciferase	0.91
PF13560	HTH_31	0.91
PF08592	Anthrone_oxy	0.91
PF13738	Pyr_redox_3	0.91
PF12762	DDE_Tnp_IS1595	0.91
PF01872	RibD_C	0.91
PF05534	HicB	0.91
PF08241	Methyltransf_11	0.91
PF07690	MFS_1	0.91
PF01327	Pep_deformylase	0.91
PF02899	Phage_int_SAM_1	0.91
PF02894	GFO_IDH_MocA_C	0.91
PF01797	Y1_Tnp	0.91
PF01370	Epimerase	0.91
PF00561	Abhydrolase_1	0.91
PF00226	DnaJ	0.91
PF00582	Usp	0.91
PF13592	HTH_33	0.91
PF01116	F_bP_aldolase	0.91
PF13482	RNase_H_2	0.91
PF09423	PhoD	0.91
PF07992	Pyr_redox_2	0.91
PF00011	HSP20	0.91
PF01339	CheB_methylest	0.91
PF13701	DDE_Tnp_1_4	0.91
PF00588	SpoU_methylase	0.91
PF00589	Phage_integrase	0.91
PF07592	DDE_Tnp_ISAZ013	0.91

COG ID	Name	Functional Category	% Frequency in 110 Family Scaffolds
COG3293	Transposase	Mobilome: prophages, transposons [X]	2.73
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	2.73
COG5421	Transposase	Mobilome: prophages, transposons [X]	2.73
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	2.73
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	2.73
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	2.73
COG3547	Transposase	Mobilome: prophages, transposons [X]	1.82
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	1.82
COG2120	N-acetylglucosaminyl deacetylase, LmbE family	Carbohydrate transport and metabolism [G]	1.82
COG2201	Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains	Signal transduction mechanisms [T]	1.82
COG4226	Predicted nuclease of the RNAse H fold, HicB family	General function prediction only [R]	0.91
COG4973	Site-specific recombinase XerC	Replication, recombination and repair [L]	0.91
COG4974	Site-specific recombinase XerD	Replication, recombination and repair [L]	0.91
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.91
COG0191	Fructose/tagatose bisphosphate aldolase	Carbohydrate transport and metabolism [G]	0.91
COG0219	tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain	Translation, ribosomal structure and biogenesis [J]	0.91
COG0242	Peptide deformylase	Translation, ribosomal structure and biogenesis [J]	0.91
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	0.91
COG0565	tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase	Translation, ribosomal structure and biogenesis [J]	0.91
COG0566	tRNA G18 (ribose-2'-O)-methylase SpoU	Translation, ribosomal structure and biogenesis [J]	0.91
COG0673	Predicted dehydrogenase	General function prediction only [R]	0.91
COG1598	Antitoxin component HicB of the HicAB toxin-antitoxin system	Defense mechanisms [V]	0.91
COG1943	REP element-mobilizing transposase RayT	Mobilome: prophages, transposons [X]	0.91
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	0.91
COG1985	Pyrimidine reductase, riboflavin biosynthesis	Coenzyme transport and metabolism [H]	0.91
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.91
COG2452	Predicted site-specific integrase-resolvase	Mobilome: prophages, transposons [X]	0.91

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	70.00 %
Unclassified	root	N/A	30.00 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	70.00 %
Unclassified	root	N/A	30.00 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	70.00 %
Unclassified	root	N/A	30.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.00 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	12.73 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	10.00 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	2.73 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	2.73 %
Nitrospinae/Tectomicrobia group	clade	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group	2.73 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.82 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.91 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.00 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	4.55 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	4.55 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	3.64 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	2.73 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2.73 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.73 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	2.73 %
Candidatus Tectomicrobia	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia	2.73 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.82 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.91 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.91 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.91 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.00 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	4.55 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	4.55 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	2.73 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	2.73 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1.82 %
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	1.82 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.82 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.82 %
Patescibacteria group	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group	0.91 %
Candidatus Acidoferrales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales	0.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %
Betaproteobacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis	0.91 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.91 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.91 %
Chloroflexi incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis	0.91 %
unclassified Planctomycetota	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota	0.91 %
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	0.91 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.00 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	2.73 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	2.73 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	1.82 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	1.82 %
unclassified Cyanobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria	1.82 %
Candidatus Acidoferrum	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum	0.91 %
Parcubacteria group	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group	0.91 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.91 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples	0.91 %
Planctomycetes bacterium SCN 63-9	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-9	0.91 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.91 %
Micromonosporales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales	0.91 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.91 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.91 %
Herpetosiphonales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Herpetosiphonales	0.91 %
SAR202 cluster	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster	0.91 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.91 %
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	0.91 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.00 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2.73 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	2.73 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.82 %
Nitrosomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas	1.82 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.91 %
Candidatus Falkowbacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria	0.91 %
uncultured Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium	0.91 %
SAR202 cluster bacterium Io17-Chloro-G7	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G7	0.91 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.91 %
unclassified Gemmatimonadales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales	0.91 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.91 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.91 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.91 %
Candidatus Endolissoclinum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum	0.91 %
Herpetosiphonaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Herpetosiphonales → Herpetosiphonaceae	0.91 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.91 %
Planctomycetes bacterium SCN 63-9	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-9	0.91 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.91 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.91 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.00 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2.73 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	2.73 %
unclassified Nitrosomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas	1.82 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.82 %
Gemmatimonadales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	0.91 %
unclassified Candidatus Endolissoclinum	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum	0.91 %
Candidatus Falkowbacteria bacterium CG23_combo_of_CG06-09_8_20_14_all_49_15	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium CG23_combo_of_CG06-09_8_20_14_all_49_15	0.91 %
Herpetosiphon	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Herpetosiphonales → Herpetosiphonaceae → Herpetosiphon	0.91 %
Archangiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae	0.91 %
Phytohabitans	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans	0.91 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.91 %
uncultured Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium	0.91 %
SAR202 cluster bacterium Io17-Chloro-G7	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G7	0.91 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.91 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.91 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.91 %
Planctomycetes bacterium SCN 63-9	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-9	0.91 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.91 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.91 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.00 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2.73 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	2.73 %
Nitrosomonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp.	1.82 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.82 %
Candidatus Endolissoclinum sp. TMED37	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37	0.91 %
Herpetosiphon aurantiacus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Herpetosiphonales → Herpetosiphonaceae → Herpetosiphon → Herpetosiphon aurantiacus	0.91 %
Stigmatella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella	0.91 %
Phytohabitans flavus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans flavus	0.91 %
Gemmatimonadales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	0.91 %
Candidatus Falkowbacteria bacterium CG23_combo_of_CG06-09_8_20_14_all_49_15	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium CG23_combo_of_CG06-09_8_20_14_all_49_15	0.91 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.91 %
uncultured Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium	0.91 %
SAR202 cluster bacterium Io17-Chloro-G7	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G7	0.91 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.91 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.91 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.91 %
Planctomycetes bacterium SCN 63-9	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-9	0.91 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.91 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.91 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	30.00 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2.73 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	2.73 %
Nitrosomonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp.	1.82 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.82 %
Stigmatella aurantiaca	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca	0.91 %
Herpetosiphon aurantiacus DSM 785	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Herpetosiphonales → Herpetosiphonaceae → Herpetosiphon → Herpetosiphon aurantiacus → Herpetosiphon aurantiacus DSM 785	0.91 %
Candidatus Endolissoclinum sp. TMED37	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37	0.91 %
Phytohabitans flavus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans flavus	0.91 %
Gemmatimonadales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	0.91 %
Candidatus Falkowbacteria bacterium CG23_combo_of_CG06-09_8_20_14_all_49_15	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium CG23_combo_of_CG06-09_8_20_14_all_49_15	0.91 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.91 %
uncultured Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium	0.91 %
SAR202 cluster bacterium Io17-Chloro-G7	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G7	0.91 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.91 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.91 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.91 %
Planctomycetes bacterium SCN 63-9	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-9	0.91 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.91 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.91 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.91 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2040502000\|ACOD_FV90NF402F6C8F	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
2088090014\|GPIPI_17091283	Not Available	1099	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_100499150	Not Available	707	Open in IMG/M
3300000550\|F24TB_10577737	All Organisms → cellular organisms → Bacteria	630	Open in IMG/M
3300004633\|Ga0066395_10069709	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1615	Open in IMG/M
3300004798\|Ga0058859_11351791	Not Available	650	Open in IMG/M
3300005187\|Ga0066675_10029368	All Organisms → cellular organisms → Bacteria	3209	Open in IMG/M
3300005294\|Ga0065705_10019206	All Organisms → cellular organisms → Bacteria	1771	Open in IMG/M
3300005294\|Ga0065705_10480317	All Organisms → cellular organisms → Bacteria	796	Open in IMG/M
3300005332\|Ga0066388_100444622	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1938	Open in IMG/M
3300005440\|Ga0070705_101079780	Not Available	656	Open in IMG/M
3300005718\|Ga0068866_11296519	Not Available	529	Open in IMG/M
3300005764\|Ga0066903_101421376	All Organisms → cellular organisms → Bacteria	1305	Open in IMG/M
3300005764\|Ga0066903_105229184	Not Available	686	Open in IMG/M
3300005937\|Ga0081455_10030045	All Organisms → cellular organisms → Bacteria	4944	Open in IMG/M
3300006049\|Ga0075417_10019317	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	2694	Open in IMG/M
3300006049\|Ga0075417_10032885	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2159	Open in IMG/M
3300006844\|Ga0075428_100823115	Not Available	986	Open in IMG/M
3300006844\|Ga0075428_101888977	Not Available	620	Open in IMG/M
3300006845\|Ga0075421_100048385	All Organisms → cellular organisms → Bacteria → Proteobacteria	5385	Open in IMG/M
3300006845\|Ga0075421_101592650	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	711	Open in IMG/M
3300006846\|Ga0075430_100125689	All Organisms → cellular organisms → Bacteria	2137	Open in IMG/M
3300006846\|Ga0075430_100499912	Not Available	1003	Open in IMG/M
3300006846\|Ga0075430_100538846	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	963	Open in IMG/M
3300006847\|Ga0075431_100476885	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1241	Open in IMG/M
3300006852\|Ga0075433_10485984	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1088	Open in IMG/M
3300006852\|Ga0075433_11942509	All Organisms → cellular organisms → Bacteria	504	Open in IMG/M
3300006853\|Ga0075420_100434181	Not Available	1135	Open in IMG/M
3300006853\|Ga0075420_101363320	Not Available	609	Open in IMG/M
3300006871\|Ga0075434_100868108	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	917	Open in IMG/M
3300006880\|Ga0075429_100203632	Not Available	1734	Open in IMG/M
3300006881\|Ga0068865_101749352	Not Available	561	Open in IMG/M
3300006904\|Ga0075424_100128004	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2685	Open in IMG/M
3300006904\|Ga0075424_100579251	Not Available	1198	Open in IMG/M
3300006904\|Ga0075424_100795630	Not Available	1009	Open in IMG/M
3300007076\|Ga0075435_100082691	All Organisms → cellular organisms → Bacteria	2640	Open in IMG/M
3300007265\|Ga0099794_10070386	All Organisms → cellular organisms → Bacteria	1713	Open in IMG/M
3300009012\|Ga0066710_100812893	All Organisms → cellular organisms → Bacteria	1433	Open in IMG/M
3300009090\|Ga0099827_10159365	All Organisms → cellular organisms → Bacteria	1852	Open in IMG/M
3300009090\|Ga0099827_10884814	All Organisms → cellular organisms → Bacteria → Proteobacteria	773	Open in IMG/M
3300009094\|Ga0111539_11536746	Not Available	772	Open in IMG/M
3300009098\|Ga0105245_10114615	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2510	Open in IMG/M
3300009100\|Ga0075418_10191693	All Organisms → cellular organisms → Bacteria	2177	Open in IMG/M
3300009100\|Ga0075418_10191796	All Organisms → cellular organisms → Bacteria	2176	Open in IMG/M
3300009100\|Ga0075418_10249553	All Organisms → cellular organisms → Bacteria	1890	Open in IMG/M
3300009100\|Ga0075418_10481058	Not Available	1331	Open in IMG/M
3300009100\|Ga0075418_11710205	Not Available	684	Open in IMG/M
3300009137\|Ga0066709_101736009	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	882	Open in IMG/M
3300009147\|Ga0114129_10348413	All Organisms → cellular organisms → Bacteria	1963	Open in IMG/M
3300009147\|Ga0114129_12972617	Not Available	558	Open in IMG/M
3300009553\|Ga0105249_11649006	All Organisms → cellular organisms → Bacteria	714	Open in IMG/M
3300009792\|Ga0126374_10272034	All Organisms → cellular organisms → Bacteria	1119	Open in IMG/M
3300010038\|Ga0126315_10424722	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	839	Open in IMG/M
3300010046\|Ga0126384_10060630	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium	2650	Open in IMG/M
3300010046\|Ga0126384_10566680	Not Available	989	Open in IMG/M
3300010145\|Ga0126321_1497440	Not Available	908	Open in IMG/M
3300010359\|Ga0126376_10921425	All Organisms → cellular organisms → Bacteria	866	Open in IMG/M
3300010359\|Ga0126376_11958691	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	627	Open in IMG/M
3300010360\|Ga0126372_10059750	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	2643	Open in IMG/M
3300010360\|Ga0126372_10244335	Not Available	1535	Open in IMG/M
3300010360\|Ga0126372_12392291	Not Available	579	Open in IMG/M
3300010361\|Ga0126378_10424262	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca	1443	Open in IMG/M
3300010362\|Ga0126377_10420551	All Organisms → cellular organisms → Bacteria	1352	Open in IMG/M
3300010362\|Ga0126377_11526675	Not Available	742	Open in IMG/M
3300010366\|Ga0126379_11634205	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	749	Open in IMG/M
3300010366\|Ga0126379_12688242	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	595	Open in IMG/M
3300012199\|Ga0137383_10742435	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	717	Open in IMG/M
3300012209\|Ga0137379_10085335	All Organisms → cellular organisms → Bacteria	3037	Open in IMG/M
3300012209\|Ga0137379_10548677	Not Available	1063	Open in IMG/M
3300012211\|Ga0137377_10083088	All Organisms → cellular organisms → Bacteria	3016	Open in IMG/M
3300012362\|Ga0137361_11695739	Not Available	551	Open in IMG/M
3300012918\|Ga0137396_10964099	Not Available	620	Open in IMG/M
3300012930\|Ga0137407_10927077	All Organisms → cellular organisms → Bacteria	824	Open in IMG/M
3300012944\|Ga0137410_11271299	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M
3300012971\|Ga0126369_10051441	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	3523	Open in IMG/M
3300012971\|Ga0126369_11300506	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	817	Open in IMG/M
3300012971\|Ga0126369_12689640	Not Available	582	Open in IMG/M
3300013306\|Ga0163162_10036262	All Organisms → cellular organisms → Bacteria	4913	Open in IMG/M
3300015241\|Ga0137418_10028215	All Organisms → cellular organisms → Bacteria	5193	Open in IMG/M
3300015373\|Ga0132257_100923489	All Organisms → cellular organisms → Bacteria	1095	Open in IMG/M
3300015374\|Ga0132255_101427360	All Organisms → cellular organisms → Bacteria	1046	Open in IMG/M
3300016371\|Ga0182034_11545569	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300016422\|Ga0182039_11000650	Not Available	750	Open in IMG/M
3300017792\|Ga0163161_10872440	Not Available	761	Open in IMG/M
3300021344\|Ga0193719_10435052	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37	536	Open in IMG/M
3300026067\|Ga0207678_10078607	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Herpetosiphonales → Herpetosiphonaceae → Herpetosiphon → Herpetosiphon aurantiacus → Herpetosiphon aurantiacus DSM 785	2825	Open in IMG/M
3300026118\|Ga0207675_101532822	All Organisms → cellular organisms → Bacteria	687	Open in IMG/M
3300026295\|Ga0209234_1212065	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans flavus	648	Open in IMG/M
3300026528\|Ga0209378_1032576	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	2724	Open in IMG/M
3300027846\|Ga0209180_10123535	All Organisms → cellular organisms → Bacteria	1485	Open in IMG/M
3300027875\|Ga0209283_10212719	All Organisms → cellular organisms → Bacteria	1284	Open in IMG/M
3300027880\|Ga0209481_10718626	Not Available	519	Open in IMG/M
3300027903\|Ga0209488_11217577	Not Available	506	Open in IMG/M
3300027907\|Ga0207428_10044252	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G7	3592	Open in IMG/M
3300027909\|Ga0209382_10008311	All Organisms → cellular organisms → Bacteria → Proteobacteria	13092	Open in IMG/M
3300027909\|Ga0209382_10039924	All Organisms → cellular organisms → Bacteria	5623	Open in IMG/M
3300028592\|Ga0247822_10163017	All Organisms → cellular organisms → Bacteria	1648	Open in IMG/M
3300028608\|Ga0247819_10109378	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-9	1396	Open in IMG/M
3300030563\|Ga0247653_1000646	All Organisms → cellular organisms → Bacteria	1239	Open in IMG/M
3300031058\|Ga0308189_10016277	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1668	Open in IMG/M
3300031092\|Ga0308204_10019111	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1388	Open in IMG/M
3300031114\|Ga0308187_10476057	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium CG23_combo_of_CG06-09_8_20_14_all_49_15	509	Open in IMG/M
3300031573\|Ga0310915_10059853	All Organisms → cellular organisms → Bacteria	2483	Open in IMG/M
3300031719\|Ga0306917_10096091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp.	2116	Open in IMG/M
3300031833\|Ga0310917_10675660	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	700	Open in IMG/M
3300031910\|Ga0306923_10471678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp.	1422	Open in IMG/M
3300031954\|Ga0306926_11398668	All Organisms → cellular organisms → Bacteria	812	Open in IMG/M
3300032174\|Ga0307470_11459734	Not Available	567	Open in IMG/M
3300032211\|Ga0310896_10628188	All Organisms → cellular organisms → Bacteria	602	Open in IMG/M
3300032261\|Ga0306920_101260979	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1065	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	59.09%
Host-Associated	Host-Associated	40.91%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	58.18%
Plants	Host-Associated → Plants	39.09%
Aquatic	Environmental → Aquatic	0.91%
Human	Host-Associated → Human	0.91%
Arthropoda	Host-Associated → Arthropoda	0.91%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	58.18%
Rhizosphere	Host-Associated → Plants → Rhizosphere	31.82%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.27%
Freshwater	Environmental → Aquatic → Freshwater	0.91%
Digestive System	Host-Associated → Human → Digestive System	0.91%
Symbiotic Fungal Gardens And Galleries	Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	52.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	30.91%
Loam	Environmental → Terrestrial → Soil → Loam	5.45%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.45%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.82%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.91%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	0.91%
Fungus Garden	Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden	0.91%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	34.55%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	30.91%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	9.09%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.36%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.45%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.64%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.73%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.82%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.91%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.91%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.91%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	0.91%
Unclassified	Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified	0.91%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	29.09%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	14.55%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	13.64%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.64%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.64%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.64%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.73%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	1.82%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.82%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.82%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.91%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.91%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.91%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.91%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	0.91%
Fungus Garden	Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden	0.91%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.91%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.91%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.91%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2040502000	Fungus garden microbial communities from Atta colombica in Panama - dump bottom	Host-Associated	Open in IMG/M
2088090014	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010145	Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026295	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026528	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300028608	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6	Environmental	Open in IMG/M
3300030563	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb6 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031058	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031092	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031114	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032211	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.30
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.30
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F086770

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ACODB_12960280	2040502000	Fungus Garden	DVPMAYNPTFVMLPSLKSLFFNSFKNELRLLDNVGA
GPIPI_02288900	2088090014	Soil	VDLPMAHNLTFVILSSLKPLFFNNLKNEFRFSDNVGAQAPGVVF
INPhiseqgaiiFebDRAFT_1004991501	3300000364	Soil	LVSRVVDLPMAHNLTFVILSSLKPLFFNXLKNEFRFSDNV
F24TB_105777371	3300000550	Soil	MSVLHQQLPPRLLLDSRGVDEPMAYNSTLVILSSLKPLFFNSLNNELRFSDN
Ga0066395_100697092	3300004633	Tropical Forest Soil	LDSRVVDVSIAYTPTLVMLSSLKPLFFNSLSNELHFSDNAGA*
Ga0058859_113517912	3300004798	Host-Associated	MRWLLLDSRVVDVAMAYGPPFVMLSSLKPFFFNSLKHTLRFSDNTGA*
Ga0066675_100293684	3300005187	Soil	VGNLLRLLLDSRVVDVPMESNPTFVILTPWKPLFINSLKNELCFSDNAGV*
Ga0065705_100192062	3300005294	Switchgrass Rhizosphere	MAHYEYXLLLDSRVVDLSTAYHPTLVXLSSLKPLFFNXLKDELRFLDNGGA*
Ga0065705_104803172	3300005294	Switchgrass Rhizosphere	LVSRVVDLPMAHNLTFVILSSLKPLFFNNLKNEFRFSDNVGA*
Ga0066388_1004446223	3300005332	Tropical Forest Soil	MLLKLVKPELLDSRVVDVSMAYSPTLVILSSLKPLFFNGLKNELRFLDNAGA*
Ga0070705_1010797801	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	LLLDARVVDVTMAYNPPFVMRSSLKPFFFNGLKHKLRFSDNTGA*
Ga0068866_112965191	3300005718	Miscanthus Rhizosphere	LQRGRKHSRSRTMRWLLLDSRVVDVAMAYGPPFVMLSSLKPFFFNSLKHTLRFSDNTGA*
Ga0066903_1014213761	3300005764	Tropical Forest Soil	LLLDSRVVDVPMAYNPTFVMLSSLKPFFFHSLKNELPFSDNAGA*
Ga0066903_1052291841	3300005764	Tropical Forest Soil	LLLDSRVVDVPIAYNPTFVVLFSLKPFFFNSLKNERRFSDNAGA*
Ga0081455_100300452	3300005937	Tabebuia Heterophylla Rhizosphere	MDVPMAYNPAFVMLSYVKPLFFSNLKNEFCFSDNARA*
Ga0075417_100193173	3300006049	Populus Rhizosphere	LDSRVVDVPMAYNPTFVMLSSLKPLFLNGLKKELCFSDYAGA*
Ga0075417_100328851	3300006049	Populus Rhizosphere	PMACNPTLIILSSLKSLFFNNLTNELYFSDNVGAQDPGIQ*
Ga0075428_1008231151	3300006844	Populus Rhizosphere	LLDSRVVDVPMAYNPTFVMLSSFKPLYLNSLKKEVCFADHAGA*
Ga0075428_1018889772	3300006844	Populus Rhizosphere	LDSRVVAVPMASNPTFVMLSSLKPLFFNSLKNEWCFLDNE
Ga0075421_1000483856	3300006845	Populus Rhizosphere	MPYRSRLLLDSRVLDAPMAYNLIFVTLSSLKPLFFNSHKKELCFSDNMGT*
Ga0075421_1015926502	3300006845	Populus Rhizosphere	RLLLDSRVVDEPMAYNPTFVILSSLKPLFFNSLKNELRFSDNAGA*
Ga0075430_1001256892	3300006846	Populus Rhizosphere	PTFVMLSSLKSLFFNSRKNAFRFLDNVGAKAPGIQ*
Ga0075430_1004999122	3300006846	Populus Rhizosphere	LDSRVVDMPMASTPNFVMLSSLKPLFINGLKNAVCFSDNAGA*
Ga0075430_1005388463	3300006846	Populus Rhizosphere	WLLLDSRVVDLLMAYNPTFVMLSFLKPLFFNSLKNEFRFSDNAGA*
Ga0075431_1004768852	3300006847	Populus Rhizosphere	EWLLLDSRVVDVPMACNPTFVMLSSLQPFFFNGLQNALCFSDNAGA*
Ga0075433_104859843	3300006852	Populus Rhizosphere	DLSMASNPTFVFLSSLKPLFFNSPEKALHFSDNTGA*
Ga0075433_119425091	3300006852	Populus Rhizosphere	VDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA*
Ga0075420_1004341812	3300006853	Populus Rhizosphere	MGIYRVWLLLDSRVVDVPMAYDPPFVMPSSLKPLFFNSLKHKLHFSDNTGT*
Ga0075420_1013633202	3300006853	Populus Rhizosphere	LDSRVVDLLMAYNPTFVILSFLKPLFLNSLKNELRFSDNAGA*
Ga0075434_1008681081	3300006871	Populus Rhizosphere	DVPRAYNRTFVMLSSLKPFFFNSLQKELRFSNNAGA*
Ga0075429_1002036322	3300006880	Populus Rhizosphere	LDARGVDVPMASNPTFVMLSSVKPLLFMSLTKALCFSDNAGA*
Ga0068865_1017493521	3300006881	Miscanthus Rhizosphere	MRWLLLDSRVVDVAMAYGPPFVMLSSLKPFFFNSLKHTLRFS
Ga0075424_1001280043	3300006904	Populus Rhizosphere	MASTPTFVMLSSLKPLFVNSLKNELRFSDNVGAEDPGIQ*
Ga0075424_1005792513	3300006904	Populus Rhizosphere	PMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA*
Ga0075424_1007956301	3300006904	Populus Rhizosphere	VDLSMASNPTLVFLSSLEPLFFNSPANEFRFSDNTGA*
Ga0075435_1000826916	3300007076	Populus Rhizosphere	LLLDSRVVDVPMAYNPTFVMLSSLKPLFLNGLKKELCFSDYAGA*
Ga0099794_100703862	3300007265	Vadose Zone Soil	VDVPMADNPTFVILSSLKPLFFNGLKNELCFSVNAGA*
Ga0066710_1008128931	3300009012	Grasslands Soil	LDSRVVDVPRAYNRTFVMLSSLKPFFFNSLQKELRFSD
Ga0099827_101593653	3300009090	Vadose Zone Soil	VDVPRAYNRTFVMLSSLKPFFFNSLQKELRFSNNAGA*
Ga0099827_108848142	3300009090	Vadose Zone Soil	VTALEQHIQAWLLLDARVVDVPMAYNPTFVMLSSLKPLFFHGLKNDLCCSDNAG
Ga0111539_115367461	3300009094	Populus Rhizosphere	VDVLMAYNPTFVLLSFLKPFFFKSLNNELSFSDNAGA*
Ga0105245_101146154	3300009098	Miscanthus Rhizosphere	LLDARVVDVTMAYNPPFVMRSSLKPFFFNGLKHKLRFSDNTGA*
Ga0075418_101916935	3300009100	Populus Rhizosphere	MRLLLDSRVVEVLMAYNATFVILSSLEPLFFHSHRHELRFSDNAGA*
Ga0075418_101917963	3300009100	Populus Rhizosphere	LDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAG
Ga0075418_102495534	3300009100	Populus Rhizosphere	DSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA*
Ga0075418_104810582	3300009100	Populus Rhizosphere	GVEVPMAYTPPFVMLSSLQPLFFNSLKNEVRFLDNVGA*
Ga0075418_117102051	3300009100	Populus Rhizosphere	QRRLLLDSRGVDVPMAYNPTFVMLSSLKPLFLYSLKKEWCFSDRAGA*
Ga0066709_1017360091	3300009137	Grasslands Soil	TLLLDSRVVDVPRAYNRTFVMLSSLKPFFFNSLQKELRFSDNAGA*
Ga0114129_103484134	3300009147	Populus Rhizosphere	MRLLLDSRVVEVLMAYNATFVILSSLEPLFFHSHRHELRFSYNAGA*
Ga0114129_129726172	3300009147	Populus Rhizosphere	LLLDSRVVDEPMAYNPTFVILSSSKPLFFNSLKNDLRFSDNAGA*
Ga0105249_116490062	3300009553	Switchgrass Rhizosphere	EGLLLDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA*
Ga0126374_102720342	3300009792	Tropical Forest Soil	VDVLMAYNPTFVMLAFLKPLFFNSLKNEIRFSDNAGA*
Ga0126315_104247223	3300010038	Serpentine Soil	LDSRVVDVSRAYTPTLVMLSSLKPLFFNSLSNELHFSDN
Ga0126384_100606304	3300010046	Tropical Forest Soil	LLLDSRVVDVLMAYNPTFVMLAFLKPSFFNSLKNEIRFSDNAGA*
Ga0126384_105666801	3300010046	Tropical Forest Soil	VDVLMAYNPTFVMLAFLKPLFFNSLKNEIRFSENAGA*
Ga0126321_14974403	3300010145	Soil	SGTDSPLSVYARLLLDSRVVDMPMASNPNFVLLSSLKPLFCNGLKNALCFSDNAGA*
Ga0126376_109214251	3300010359	Tropical Forest Soil	MLSYDKWLLLDSRGVDVPMVYAPTFAMLSSLKPLFFNSLTNTLRFSDKAGA*
Ga0126376_119586911	3300010359	Tropical Forest Soil	QRETIPTFVMLFSLKPLFFNSLKNALGFSDNPGA*
Ga0126372_100597503	3300010360	Tropical Forest Soil	MFQSRLLLDSRVVDVSTAYHPTLVILSSLKPLFFNRFKNELRFLDNGGA*
Ga0126372_102443351	3300010360	Tropical Forest Soil	VDSRGVDVPRAYNPTFVMLFSLKPLFFNSLKNALGFSDNA
Ga0126372_123922912	3300010360	Tropical Forest Soil	LDSRVVYVPMAYNPTCVLLSSLKPFFCHRLKNESPFSDNARA*
Ga0126378_104242621	3300010361	Tropical Forest Soil	LSMAYNPTFVVLSSVKPLFFNNLKNELRFLGNVGA*
Ga0126377_104205512	3300010362	Tropical Forest Soil	LVDSRGVDVPRAYNPTFVMLFSLKPLFFNSLKNALGFSDNAGA*
Ga0126377_115266751	3300010362	Tropical Forest Soil	VDVPMVYNLGFAMLSSLKLLFFKSLKNALRFSDNAAA*
Ga0126379_116342051	3300010366	Tropical Forest Soil	MPSRLLLDSRVVDVPMASNPIVVTLSSLKPFFFNSLNTEVRFSDHVGA
Ga0126379_126882421	3300010366	Tropical Forest Soil	LLLDSRVVDVAMVYNPNFVILSSLKPLFFNSDKNELRFSDNAGA*
Ga0137383_107424353	3300012199	Vadose Zone Soil	VVDVPMASNPTFVMLSSLKPLFFNSLKNELCFSDNAGA*
Ga0137379_100853354	3300012209	Vadose Zone Soil	SRVVDLLMAYNPTFVMLSFLKPLFFNSLKNEFRFSDNAGA*
Ga0137379_105486772	3300012209	Vadose Zone Soil	LLLDSRVVDVPRAYNRTFVMLSSLKPFFFNSLQKELCFSDNAGA*
Ga0137377_100830883	3300012211	Vadose Zone Soil	QGSSGRYNARLLLDSRVVDVPMASNPTFVMLSALKPLFFNSLKNELCFSDNAGA*
Ga0137361_116957391	3300012362	Vadose Zone Soil	DVPMAYNLTFVMLSSLKPLFFNNLKNELPFLDHAGA*
Ga0137396_109640991	3300012918	Vadose Zone Soil	DLLMAYNPTFVMLSFLKPLFCNRLKNEFRFSDNVGA*
Ga0137407_109270771	3300012930	Vadose Zone Soil	DLPMAYNPILVLLSSLKPLFFNSLKNELRFSDNAGA*
Ga0137410_112712992	3300012944	Vadose Zone Soil	LDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA*
Ga0126369_100514411	3300012971	Tropical Forest Soil	MPCQMGLLLESRVVDVSMVSNPTVVFLSSLRPLFFNSPENEFRFSDNTGA*
Ga0126369_113005063	3300012971	Tropical Forest Soil	VVAVPMASHPTCVMFSSWKPLFFNSLKHEFHFSDNAGA*
Ga0126369_126896402	3300012971	Tropical Forest Soil	VLRLLVDSRGVDVPRAYNPTFVMLFSLKPLFFNSLKNALGFSDNA
Ga0163162_100362622	3300013306	Switchgrass Rhizosphere	MAHNLTFVILSSLKSLFFNNLKNEFRFSDNVGAQAPGVVF*
Ga0137418_100282153	3300015241	Vadose Zone Soil	MWKISRLLLDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA*
Ga0132257_1009234891	3300015373	Arabidopsis Rhizosphere	LDSRVVDVPMMSNPTFVMLSSLQPFFFNSLQMGVCCTDNAG
Ga0132255_1014273602	3300015374	Arabidopsis Rhizosphere	MKIATNPVDLLMAYNPTFVMLSFLKPLFFNSLKNELRFSGNAGA*
Ga0182034_115455692	3300016371	Soil	VVYVTMAKTPTFVMRSFLKSFFLNSLKNELPFSDNAGA
Ga0182039_110006501	3300016422	Soil	MPSFLHWLLLDSRVVDVPMAYNPTFVMLSSLQPFFLKSLQKELCFSAHAGAYDPGIQEERPRFSP
Ga0163161_108724402	3300017792	Switchgrass Rhizosphere	VDLPMAQNLTFVILSSLKPLFFNNLKNEFRFSDNVGA
Ga0193719_104350522	3300021344	Soil	LDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSD
Ga0207678_100786073	3300026067	Corn Rhizosphere	FFNLRWLLLDSRVVDMPMASNPNFVLLFSLKPFFFNGLKNALGFEANAGA
Ga0207675_1015328222	3300026118	Switchgrass Rhizosphere	FRFGLLLDSRVVDLPMTYGLTFDVLLSLKPLFFNSLKNKSRFSDNVEA
Ga0209234_12120652	3300026295	Grasslands Soil	QTLLLDSRVVDVPRAYNRTFVMLSSLKPFFFNSLKNELRFSGNAGA
Ga0209378_10325761	3300026528	Soil	IWLLLDSRVVDLSMASNPTFVFLSSLKPLFFNSPENELRFSDNPGA
Ga0209180_101235355	3300027846	Vadose Zone Soil	VDLPMAYNPIFVIFSSLKPLFFNSLKNELRFSDNAGV
Ga0209283_102127191	3300027875	Vadose Zone Soil	RVVDVPRAYNRTFVMLSSLKPFFFNSLQKELRFSDNAGA
Ga0209481_107186261	3300027880	Populus Rhizosphere	RLLLDSRVVDVPMAYNPTFVMLSSLKPLFLNGLKKELCFSDYAGA
Ga0209488_112175771	3300027903	Vadose Zone Soil	VDVPMADNPTFVILSSLKPLFFNGLKNELCFSVNAGA
Ga0207428_100442521	3300027907	Populus Rhizosphere	HNDSQGERLLLDSRVLDAPRAYNLIFVTPPSLKPLFFNSHKKELGFSDHMGT
Ga0209382_100083119	3300027909	Populus Rhizosphere	MPYRSRLLLDSRVLDAPMAYNLIFVTLSSLKPLFFNSHKKELCFSDNMGT
Ga0209382_100399241	3300027909	Populus Rhizosphere	MPMAYNPTFVMLSSLKSLFFNSRKNAFRFLDNVGAKAPGIQ
Ga0247822_101630172	3300028592	Soil	VDLPMAHNLTFVILSSLKPLFFNNLKNEFRFSDNVGA
Ga0247819_101093782	3300028608	Soil	VDLPMAHNLTFVILSSLNPLFFNNLKNEFRFSDNVGA
Ga0247653_10006462	3300030563	Soil	DSRVVDVSMASNPTFVFLSSLEPLFFNNPENELRFSDNTGA
Ga0308189_100162771	3300031058	Soil	VELPMGDNPTFVILSSLKPFFFNRLKSEWRFVDNVGA
Ga0308204_100191111	3300031092	Soil	SRVVDLTMPCDPIVVTLSSLKPLFFKGLQNELRFSDNLEA
Ga0308187_104760572	3300031114	Soil	LLDSRVVDVPMAYNSIFVTPYSMKLFFFNGLKNELRFSDNVG
Ga0310915_100598532	3300031573	Soil	MLSYDKWLLLDSRGVDVPMVYGPTFVMLSSLKPLFFNSLTNKLRFSDKAGA
Ga0306917_100960914	3300031719	Soil	MPSFLHWLLLDSRVVDVPMAYNPTFVMLSSLQPFFLKSLQKELCFSAHAGAY
Ga0310917_106756602	3300031833	Soil	DSRVVDLLMAYNLTFVRFSFLKSLFFNSLKNEFRFSDNAGV
Ga0306923_104716781	3300031910	Soil	MPSFLHWLLLDSRVVDVPMAYNPTFVMLSSLQPFFLKSLQKELCFSAHAGAYDPGIQEERPRFSS
Ga0306926_113986681	3300031954	Soil	LDSRVVEVPMAYNPTFVMLSSLKPLFLHSLKNALCFSDN
Ga0307470_114597341	3300032174	Hardwood Forest Soil	MECRKYEWLLLDFRVMELARPYPQTFVMLSSWKPLFFNSLKHEFRFSDHIGA
Ga0310896_106281882	3300032211	Soil	MASNPTFIVLSFLKPLFFTGLKNESPFSDNVEAEDP
Ga0306920_1012609792	3300032261	Soil	PKRLLLDSRVVDVPMASNLTFVMLSSWKALFFNSLKNDLCFSANAGA

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign