Basic Information | |
---|---|
Family ID | F086984 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 46 residues |
Representative Sequence | MDQRVVETPQRASQGQKPAVTRYVLSIGLALVVILFAVAYVISV |
Number of Associated Samples | 74 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 46.79 % |
% of genes near scaffold ends (potentially truncated) | 56.36 % |
% of genes from short scaffolds (< 2000 bps) | 93.64 % |
Associated GOLD sequencing projects | 71 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (50.909 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.273 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.545 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (65.455 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF03740 | PdxJ | 30.91 |
PF02771 | Acyl-CoA_dh_N | 4.55 |
PF13419 | HAD_2 | 0.91 |
PF13515 | FUSC_2 | 0.91 |
PF02668 | TauD | 0.91 |
PF01883 | FeS_assembly_P | 0.91 |
PF03098 | An_peroxidase | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG0854 | Pyridoxine 5'-phosphate synthase PdxJ | Coenzyme transport and metabolism [H] | 30.91 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 4.55 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 50.91 % |
All Organisms | root | All Organisms | 49.09 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002568|C688J35102_120195643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 922 | Open in IMG/M |
3300004153|Ga0063455_101328690 | Not Available | 549 | Open in IMG/M |
3300004153|Ga0063455_101610501 | Not Available | 512 | Open in IMG/M |
3300004157|Ga0062590_101952904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
3300004463|Ga0063356_100474358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1643 | Open in IMG/M |
3300005093|Ga0062594_102088786 | Not Available | 609 | Open in IMG/M |
3300005167|Ga0066672_10609402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
3300005329|Ga0070683_102380324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
3300005338|Ga0068868_100799628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 851 | Open in IMG/M |
3300005344|Ga0070661_100531092 | Not Available | 945 | Open in IMG/M |
3300005444|Ga0070694_101546817 | Not Available | 562 | Open in IMG/M |
3300005457|Ga0070662_100340268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1227 | Open in IMG/M |
3300005458|Ga0070681_10153058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2232 | Open in IMG/M |
3300005466|Ga0070685_10592156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
3300005529|Ga0070741_10985712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 723 | Open in IMG/M |
3300005535|Ga0070684_102284639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
3300005564|Ga0070664_101315276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 683 | Open in IMG/M |
3300005577|Ga0068857_102036306 | Not Available | 563 | Open in IMG/M |
3300006755|Ga0079222_12035160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
3300006846|Ga0075430_101661888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
3300006854|Ga0075425_101773151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
3300006904|Ga0075424_100473702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1337 | Open in IMG/M |
3300009012|Ga0066710_100392193 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2067 | Open in IMG/M |
3300009094|Ga0111539_12041700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
3300009098|Ga0105245_11558448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 712 | Open in IMG/M |
3300009156|Ga0111538_11358346 | Not Available | 897 | Open in IMG/M |
3300009789|Ga0126307_10130904 | Not Available | 2003 | Open in IMG/M |
3300010040|Ga0126308_10629955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
3300010045|Ga0126311_11054415 | Not Available | 667 | Open in IMG/M |
3300010373|Ga0134128_10918438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 969 | Open in IMG/M |
3300010396|Ga0134126_12488908 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
3300011332|Ga0126317_10341101 | Not Available | 685 | Open in IMG/M |
3300011332|Ga0126317_10632696 | Not Available | 684 | Open in IMG/M |
3300011332|Ga0126317_11069671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 942 | Open in IMG/M |
3300011332|Ga0126317_11079780 | Not Available | 510 | Open in IMG/M |
3300012212|Ga0150985_100160971 | Not Available | 505 | Open in IMG/M |
3300012212|Ga0150985_100538797 | Not Available | 514 | Open in IMG/M |
3300012212|Ga0150985_100803026 | Not Available | 546 | Open in IMG/M |
3300012212|Ga0150985_101789822 | Not Available | 515 | Open in IMG/M |
3300012212|Ga0150985_101995345 | Not Available | 514 | Open in IMG/M |
3300012212|Ga0150985_102371921 | Not Available | 615 | Open in IMG/M |
3300012212|Ga0150985_106543433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
3300012212|Ga0150985_109693135 | Not Available | 603 | Open in IMG/M |
3300012212|Ga0150985_110782030 | Not Available | 527 | Open in IMG/M |
3300012212|Ga0150985_114325164 | Not Available | 776 | Open in IMG/M |
3300012212|Ga0150985_114799471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 904 | Open in IMG/M |
3300012212|Ga0150985_115385551 | Not Available | 677 | Open in IMG/M |
3300012212|Ga0150985_116320815 | Not Available | 553 | Open in IMG/M |
3300012212|Ga0150985_121705490 | Not Available | 587 | Open in IMG/M |
3300012469|Ga0150984_100506586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 683 | Open in IMG/M |
3300012469|Ga0150984_102598205 | Not Available | 998 | Open in IMG/M |
3300012469|Ga0150984_108389508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 674 | Open in IMG/M |
3300012469|Ga0150984_109821637 | Not Available | 709 | Open in IMG/M |
3300012469|Ga0150984_109833517 | Not Available | 680 | Open in IMG/M |
3300012469|Ga0150984_115612267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1235 | Open in IMG/M |
3300012469|Ga0150984_119566710 | Not Available | 704 | Open in IMG/M |
3300012469|Ga0150984_121646905 | Not Available | 823 | Open in IMG/M |
3300012469|Ga0150984_123024392 | Not Available | 528 | Open in IMG/M |
3300012469|Ga0150984_123606812 | Not Available | 584 | Open in IMG/M |
3300012469|Ga0150984_123674090 | Not Available | 617 | Open in IMG/M |
3300012508|Ga0157315_1078143 | Not Available | 500 | Open in IMG/M |
3300012957|Ga0164303_11059760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
3300012960|Ga0164301_10658807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
3300012985|Ga0164308_11447294 | Not Available | 629 | Open in IMG/M |
3300012986|Ga0164304_11865545 | Not Available | 503 | Open in IMG/M |
3300012987|Ga0164307_11854833 | Not Available | 511 | Open in IMG/M |
3300013306|Ga0163162_10968134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 961 | Open in IMG/M |
3300014325|Ga0163163_10921045 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
3300014969|Ga0157376_11771948 | Not Available | 653 | Open in IMG/M |
3300015371|Ga0132258_10754662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2451 | Open in IMG/M |
3300015371|Ga0132258_13015389 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300015372|Ga0132256_102390286 | Not Available | 631 | Open in IMG/M |
3300018469|Ga0190270_12934509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
3300018469|Ga0190270_13132401 | Not Available | 523 | Open in IMG/M |
3300018476|Ga0190274_10299591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1495 | Open in IMG/M |
3300019361|Ga0173482_10506235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
3300020080|Ga0206350_10002498 | Not Available | 853 | Open in IMG/M |
3300020080|Ga0206350_10668050 | Not Available | 582 | Open in IMG/M |
3300021082|Ga0210380_10412555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
3300021184|Ga0196959_10095916 | Not Available | 676 | Open in IMG/M |
3300021344|Ga0193719_10063800 | Not Available | 1599 | Open in IMG/M |
3300021388|Ga0213875_10578325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
3300021445|Ga0182009_10825829 | Not Available | 508 | Open in IMG/M |
3300022467|Ga0224712_10614387 | Not Available | 531 | Open in IMG/M |
3300022467|Ga0224712_10640451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
3300025315|Ga0207697_10188269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 906 | Open in IMG/M |
3300025901|Ga0207688_10273202 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1028 | Open in IMG/M |
3300025903|Ga0207680_10118359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1729 | Open in IMG/M |
3300025912|Ga0207707_10107079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2444 | Open in IMG/M |
3300025917|Ga0207660_11584628 | Not Available | 528 | Open in IMG/M |
3300025926|Ga0207659_10744984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 840 | Open in IMG/M |
3300025931|Ga0207644_10276275 | Not Available | 1348 | Open in IMG/M |
3300025936|Ga0207670_11161840 | Not Available | 653 | Open in IMG/M |
3300025944|Ga0207661_10482620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1132 | Open in IMG/M |
3300025944|Ga0207661_12162610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
3300025972|Ga0207668_10742250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 866 | Open in IMG/M |
3300026023|Ga0207677_11927216 | Not Available | 549 | Open in IMG/M |
3300026035|Ga0207703_10774899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
3300026035|Ga0207703_11061863 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300026078|Ga0207702_11593907 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300030902|Ga0308202_1144449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
3300030905|Ga0308200_1109646 | Not Available | 597 | Open in IMG/M |
3300030905|Ga0308200_1178969 | Not Available | 506 | Open in IMG/M |
3300031058|Ga0308189_10428829 | Not Available | 553 | Open in IMG/M |
3300031091|Ga0308201_10343527 | Not Available | 545 | Open in IMG/M |
3300031091|Ga0308201_10434599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
3300031092|Ga0308204_10147868 | Not Available | 694 | Open in IMG/M |
3300031092|Ga0308204_10316757 | Not Available | 527 | Open in IMG/M |
3300031965|Ga0326597_10092603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3692 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.27% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 12.73% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 10.00% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 6.36% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.55% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 3.64% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.73% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.73% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.82% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.82% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.91% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.91% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.91% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.91% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021184 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C688J35102_1201956432 | 3300002568 | Soil | MDDRIVKSPQEASQGQKPAVTRYVLTIGLALVVILFLVAYLTVV* |
Ga0063455_1013286902 | 3300004153 | Soil | DAQIIEGQAMDDRIVKSPQEASQGQKPAVTRYVLTIGLALVVILFLVAYLTVV* |
Ga0063455_1016105012 | 3300004153 | Soil | MLTVKGQAMDDRIVKSPQEASQGQKPAVTRYVLTIGLALVVILFLVAYLTVV* |
Ga0062590_1019529041 | 3300004157 | Soil | MDQRVVETPQRASQGQKPGVTRYVLTIGLTLVVILFAVAYVISV* |
Ga0063356_1004743583 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDHRVVESPQQASQGQKPGVVRYVLAISLLLVVILFAVAYVIST* |
Ga0062594_1020887861 | 3300005093 | Soil | AMDQRVVETPERASQGQKPGVVRYVLSIGLALVVILFVVAYVISV* |
Ga0066672_106094022 | 3300005167 | Soil | MDQRVVETPERASAGQKPGIVRYILAISTLLVVILFAVAYVIST* |
Ga0070683_1023803242 | 3300005329 | Corn Rhizosphere | MDDRIVKSPQEASQGQKPGVTRYVLSIGLALVVILFLVAYLIVV* |
Ga0068868_1007996281 | 3300005338 | Miscanthus Rhizosphere | MDRRVVETPERASQGQKPAVTRYVLSVGLALVVILFVVAYVISV* |
Ga0070661_1005310921 | 3300005344 | Corn Rhizosphere | RVVETPERASQGQKPAVTRYVLSVILALVVILFVVAYVISV* |
Ga0070694_1015468171 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VETPQRASQGQKPGVTRYVLTIGLTLVVILFAVAYVISV* |
Ga0070662_1003402681 | 3300005457 | Corn Rhizosphere | MDDRIVKSPQEASQGQKPAVTRCVLTIGLALVVILFLVAYL |
Ga0070681_101530583 | 3300005458 | Corn Rhizosphere | MDQRVVETPQRASQGQKPAVTRYVLTIGLTLVVILFAVAYVISV* |
Ga0070685_105921561 | 3300005466 | Switchgrass Rhizosphere | SQPTEQAMDQRVVETPQRASQGQKPGVTRYVLTIGLTLVVILFAVAYVISV* |
Ga0070741_109857122 | 3300005529 | Surface Soil | MDDRIVKSPQEASQGQKPRVTRYVLGVGLVLVVILFVVAYLISV* |
Ga0070684_1022846391 | 3300005535 | Corn Rhizosphere | MLKPTEQAMDQRVVETPQRASQGQKPGVTRYVLTIGLTLVVILFAVAYVISV* |
Ga0070664_1013152762 | 3300005564 | Corn Rhizosphere | MDDRVVKSPQEASQGQKPGVTRYVLSIGLALVVILFLVAYLIVV* |
Ga0068857_1020363062 | 3300005577 | Corn Rhizosphere | MDDRIVKSPQEASQGQKPAVTRYVLTIGLALVVILFLVAYLIVV* |
Ga0079222_120351602 | 3300006755 | Agricultural Soil | MDDRIVKSPQEASQGQKPRVTRYVLTVGLVLVVILFVVAYLIAV* |
Ga0075430_1016618882 | 3300006846 | Populus Rhizosphere | MDQRVVETPQNASAGQKPAVTRYVLAIGLALVVILFVVAYVIST* |
Ga0075425_1017731511 | 3300006854 | Populus Rhizosphere | QAMDQRVVETPERASQGQKPAVTRYVLSVGLALVVILFVVAYVISV* |
Ga0075424_1004737021 | 3300006904 | Populus Rhizosphere | MDQRVVETPERASQGQKPAVTRYVLSVGLALVVILFVVAYVISV* |
Ga0066710_1003921933 | 3300009012 | Grasslands Soil | MDQRVVETPERARQARKEHVVRYVLMISLTLVVILFWVAYVIFV |
Ga0111539_120417002 | 3300009094 | Populus Rhizosphere | MDQRVVETPERASQGQKPGVVRYVLSIGLALVVILFVVAYVISV* |
Ga0105245_115584481 | 3300009098 | Miscanthus Rhizosphere | MDQRVVETPQRASQGQKPGVTRYVLTIGLTLVVILFAVAYV |
Ga0111538_113583461 | 3300009156 | Populus Rhizosphere | MEQAMDQRVVETPQRASQGQKPRQVRYVLSIGLVLVVILFVVAYVISV* |
Ga0126307_101309041 | 3300009789 | Serpentine Soil | MEQAMDQRVVETPQKASAGQKPGVTRYVLTIGLTLVVILFVVAYVISI* |
Ga0126308_106299551 | 3300010040 | Serpentine Soil | MEQAMDQRVVETPQKASAGQKPAVTRYVLSIGLALVVILFLVAYVISV* |
Ga0126311_110544152 | 3300010045 | Serpentine Soil | MDDRIVKTPQEASQGQKPAVTRYVLTIGLALVVILFLVAYLIAV* |
Ga0134128_109184382 | 3300010373 | Terrestrial Soil | MLATTEQAMDHRVVETPQRASQGQKPAVTRYVLSVGLVLVVILFAVAYVISV* |
Ga0134126_124889082 | 3300010396 | Terrestrial Soil | MDDRIVKSPQEASQGQKPGVTRYVLTVGLLLVVILFLIAYFLVV* |
Ga0126317_103411011 | 3300011332 | Soil | QEASQGQKPRVTRYVLTVSLVLVVILFVVAYLISV* |
Ga0126317_106326961 | 3300011332 | Soil | SPQEASQGQKPRVTRYVLTVSLVLVVILFAVAYLISV* |
Ga0126317_110696713 | 3300011332 | Soil | DDRVVKSPQEASQGQKPAVTRYVLTIGLALVVILFLVAYLIVV* |
Ga0126317_110797801 | 3300011332 | Soil | ATKGQAMDDRVVKSPQQASQGQKPGVTRYVLSIGLALVVILFIVAYFIAL* |
Ga0150985_1001609711 | 3300012212 | Avena Fatua Rhizosphere | EGQAMDDRVVKSPQDASQGHKPKVTRYVLTVSLVLVVILFAVAYFISV* |
Ga0150985_1005387971 | 3300012212 | Avena Fatua Rhizosphere | MDDRVVKSPQEASQGHKPGVTRYVLTVGLVLVVILFIVAYFIAV* |
Ga0150985_1008030263 | 3300012212 | Avena Fatua Rhizosphere | SQHTEQAMDQRVVETPQRASQGQKPGVTRYVLTIGLALVVILFAVAYVISV* |
Ga0150985_1017898221 | 3300012212 | Avena Fatua Rhizosphere | QPREQAMDDRVVKSPQDASQGQKPGVTRYVLTVGLALVIILFIVAYLIGRG* |
Ga0150985_1019953451 | 3300012212 | Avena Fatua Rhizosphere | SKPTEHAMDQRVVETPQRASQGQKPGVTRYVLTIGLTLVVILFAVAYVISV* |
Ga0150985_1023719211 | 3300012212 | Avena Fatua Rhizosphere | PRGQAMDDRVVKSPQDASQGQKPGVTRYVLTVGLVLVVILFVVAYLIAV* |
Ga0150985_1065434333 | 3300012212 | Avena Fatua Rhizosphere | LTVQAMDQRVVETPQRASQGQKPGVTRYVLTVGLALVVILFVVAYVISV* |
Ga0150985_1096931353 | 3300012212 | Avena Fatua Rhizosphere | DDRIVKSPQEASQGQKPAVTRYVLTIGLALVVILFLVAYLIVV* |
Ga0150985_1107820302 | 3300012212 | Avena Fatua Rhizosphere | LFRSVHAIEGQAMDDRVVKSPQDASQGQKPRVTRYVLTASLVLVVILFIVAYLISV* |
Ga0150985_1143251643 | 3300012212 | Avena Fatua Rhizosphere | GQAMDDRIVKSPQDASQGHKPRVTRYVLTVSLVLVVILFAVAYLISV* |
Ga0150985_1147994711 | 3300012212 | Avena Fatua Rhizosphere | EGQAMDDRVVKSPQEASQGQKPGVTRYVLSIGLVLVVILFVVAYLIAV* |
Ga0150985_1153855511 | 3300012212 | Avena Fatua Rhizosphere | TIEGQAMDDRIVKSPQEASQGQKPAVTRYVLTIGLALVVILFLVAYLIVV* |
Ga0150985_1163208152 | 3300012212 | Avena Fatua Rhizosphere | SDLDRIVKTPQEASQGQKPAVTRYVLTIGLVLVVILFAVAYVISV* |
Ga0150985_1217054901 | 3300012212 | Avena Fatua Rhizosphere | MDDRVVKSPQEASQGRKPRVTRYVLTVSLVLVVILFIVAYLISV* |
Ga0150984_1005065861 | 3300012469 | Avena Fatua Rhizosphere | DDRVVKSPQEASQGHKPRVTRYVLTVGLVLVVILFIVAYFIAV* |
Ga0150984_1025982051 | 3300012469 | Avena Fatua Rhizosphere | MDDRVVKSPQEASQGHKPGVTRYVLTVGLVLVVILLIVAYFIAV* |
Ga0150984_1083895081 | 3300012469 | Avena Fatua Rhizosphere | MDDRVVKSPQEASQGQKPAVTRYVLTIGLALVVILFLVAYLIVV* |
Ga0150984_1098216371 | 3300012469 | Avena Fatua Rhizosphere | QHTEQAMDQRVVETPQRASQGQKPAVTRYVLSIGLALVVILFAVAYVISI* |
Ga0150984_1098335173 | 3300012469 | Avena Fatua Rhizosphere | VVKSPQDASQGQKPGVTRYVLTVGLVLVVILFVVAYLIAV* |
Ga0150984_1156122671 | 3300012469 | Avena Fatua Rhizosphere | TIEGQAMDDRVVKSPQEASQGQKPAVTRYVLSIGLALVVILFLVAYFIAV* |
Ga0150984_1195667103 | 3300012469 | Avena Fatua Rhizosphere | SQLRGQAMDDRIVKSPQDASQGHKPRVTRYVLTVSLVLVVILFAVAYLISV* |
Ga0150984_1216469053 | 3300012469 | Avena Fatua Rhizosphere | MDDRVVKSPQEASQGQKPGVTRYVLSIGLVLVVILFVVAYLIAV* |
Ga0150984_1230243922 | 3300012469 | Avena Fatua Rhizosphere | GQAMDDRIVKSPQDASQGRKPRVTRYVLAVSLVLVVILFVVAYLISV* |
Ga0150984_1236068123 | 3300012469 | Avena Fatua Rhizosphere | PKGQAMDDRVVKSAQDASQGNKPRVTRYVLTVSLVLVVILFVVAYLISV* |
Ga0150984_1236740901 | 3300012469 | Avena Fatua Rhizosphere | AIEGQAMDDRVVKSPQDASQGQKPRVTRYVLTASLVLVVILFIVAYLISV* |
Ga0157315_10781431 | 3300012508 | Arabidopsis Rhizosphere | AQIIEGQAMDDRIVKSPQEASQGQKPAVTRYVLTIGLALVVILFLVAYLIVV* |
Ga0164303_110597602 | 3300012957 | Soil | MDQRVVETPQRASQGQKPGVTRYVLTIGLTLVVILFAVAYVISI* |
Ga0164301_106588072 | 3300012960 | Soil | MDQRVVETPQRASQGQKPAVTRYVLSIGLALVVILFLVAYLTVV* |
Ga0164308_114472943 | 3300012985 | Soil | RIVKSPQEASQGQKPAVTRYVLTIGLALVVILFLVAYLTVV* |
Ga0164304_118655452 | 3300012986 | Soil | QPRGQAMDDRVVKSPQDASQGQKPGVTRYVLTVGLVLVVILFVVAYVISV* |
Ga0164307_118548331 | 3300012987 | Soil | EGQAMDNRIVKSPQEASQGQKPAVTRYVLTIGLALVVILFLVAYLTVV* |
Ga0163162_109681342 | 3300013306 | Switchgrass Rhizosphere | MLKPTEQAMDQRVVETPQRASQGQKPGVTRYVLTIGLTLVVILFAVAYVI |
Ga0163163_109210451 | 3300014325 | Switchgrass Rhizosphere | MDDRIVKSPQEASQGQKPAVTRYVLTIGLALVVILFL |
Ga0157376_117719483 | 3300014969 | Miscanthus Rhizosphere | MDNRIVKSPQEASQGQKPAVTRYVLTIGLALVVILFLVAYLTVV* |
Ga0132258_107546623 | 3300015371 | Arabidopsis Rhizosphere | MEQAMDQRVVETPQNASAGQKPAVARYVLAIGLALVVILFVVAYVIST* |
Ga0132258_130153893 | 3300015371 | Arabidopsis Rhizosphere | MDDPPRVVETPQRAIAGQKPGVTRYVLSIGLALVIILFV |
Ga0132256_1023902861 | 3300015372 | Arabidopsis Rhizosphere | QRASQGQKPGVTRYVLTIGLTLVVILFAVAYVISV* |
Ga0190270_129345092 | 3300018469 | Soil | MDERIVETPERAAAAQKPAVTRYVLGIGLTLVVILFVVAYVISI |
Ga0190270_131324011 | 3300018469 | Soil | MDQRVVETPQRASQGQKPAVVRYVLSIGLALVVILFVVAYVISV |
Ga0190274_102995912 | 3300018476 | Soil | MLPHTEQAMDQRVVETPERASQGQKPGVVRYVLSIGLALVVILFVIAYVISV |
Ga0173482_105062351 | 3300019361 | Soil | MDQRVVETPQRASQGQKPGVTRYVLSIGLVLVVILFAVAYVIVV |
Ga0206350_100024981 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | ATTEQAMDHRVVETPQRASQGQKPAVTRYVLSVGLVLVVILFAVAYVISV |
Ga0206350_106680501 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | RNTREQAMDRRVVETPERASQGQKPAVTRYVLSVGLALVVILFVVAYVISV |
Ga0210380_104125551 | 3300021082 | Groundwater Sediment | MDQRVVETPQRASQGQKPGVTRYVLTVGLALVVILF |
Ga0196959_100959163 | 3300021184 | Soil | MDDHVVKSPQEARQGQKPRVTRYVLTVGLALVVILFAVAYLVVI |
Ga0193719_100638001 | 3300021344 | Soil | DQRVVETPQRASAGHKPGTVRYILAISTLLVIILFAVAYVIST |
Ga0213875_105783252 | 3300021388 | Plant Roots | MPDRIVQTPTEASAGHKPGVVRYVLLISTLLVVILFLVAYTVSV |
Ga0182009_108258292 | 3300021445 | Soil | EQAMDRRVVETPERASQGQKPAVTRYVLSVGLALVVILFVVAYVISV |
Ga0224712_106143872 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | SQPTEQTMDQRVVETPQRASQGQKPAVTRYVLTIGLTLVVILFAVAYVISV |
Ga0224712_106404511 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | PDTEQAMDHRIVETPSRASQGQKPAVTRYVLSIGLALVVILFVVAYVISV |
Ga0207697_101882692 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MDQRVVETPQRASQGQKPAVTRYVLSIGLALVVILFAVAYVISV |
Ga0207688_102732022 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDRIVKSPQEASQGQKPAVTRYVLTIGLALVVILFLVAYLTVV |
Ga0207680_101183592 | 3300025903 | Switchgrass Rhizosphere | MDQRVVETPQRASQGQKPGVTRYVLTIGLTLVVILFAVAYVISV |
Ga0207707_101070793 | 3300025912 | Corn Rhizosphere | MDQRVVETPQRASQGQKPAVTRYVLTIGLTLVVILFAVAYVISV |
Ga0207660_115846282 | 3300025917 | Corn Rhizosphere | MDQRVVETPERASQGQKPGVVRYVLSIGLALVVILFVVAYVISV |
Ga0207659_107449842 | 3300025926 | Miscanthus Rhizosphere | MDQRVVETPQRASQGQKPAVTRYVLSIGLALVVILFAVAYVISI |
Ga0207644_102762753 | 3300025931 | Switchgrass Rhizosphere | EQAMDQRVVETPQRASQGQKPGVTRYVLTIGLTLVVILFAVAYVISV |
Ga0207670_111618403 | 3300025936 | Switchgrass Rhizosphere | NTREQAMDQRVVETPERASQGQKPAVVRYVLSIGLALVVILFMVAYVISV |
Ga0207661_104826202 | 3300025944 | Corn Rhizosphere | MDDRVIKSPQEASQGQKPGVTRYVLSIGLALVVILFLVAYLIVV |
Ga0207661_121626102 | 3300025944 | Corn Rhizosphere | MDDRIVKSPQEASQGQKPAVTRYVLTIGLALVVIL |
Ga0207668_107422502 | 3300025972 | Switchgrass Rhizosphere | MDDRIVKSPQEASQGQKPAVTRYVLTIGLALVVILFVVAYVIST |
Ga0207677_119272162 | 3300026023 | Miscanthus Rhizosphere | MDQRVVETPERASQGQKPAVTRYVLSVGLALVVILFVVAYVISV |
Ga0207703_107748992 | 3300026035 | Switchgrass Rhizosphere | MDRRVVETPERASQGQKPAVTRYVLSVGLALVVILFVVAYVISV |
Ga0207703_110618631 | 3300026035 | Switchgrass Rhizosphere | MDQRVVETPQRASQGQKPAVTRYVLSIGLVLVVILFAVAYVI |
Ga0207702_115939072 | 3300026078 | Corn Rhizosphere | MLATTEQAMDHRVVETPQRASQGQKPAVTRYVLSVGLVLVVILFAVAYVISV |
Ga0308202_11444492 | 3300030902 | Soil | LTVQAMDQRVVETPQRASQGQKPGVTRYVLTVGLALVVILFVVAYVISV |
Ga0308200_11096463 | 3300030905 | Soil | AIEGQAMDDRVVKSPQDASQGQKPRVTRYVLTVSLVLVVILFIVAYLISV |
Ga0308200_11789691 | 3300030905 | Soil | IEGQAMDDRIVKSPQEASQGQKPAVTRYVLTIGLALVVILFLVAYLTVV |
Ga0308189_104288291 | 3300031058 | Soil | RGQAMDDRVVKSPQDASQGQKSGVARYVLTVGLVLVVILFIVAYLIGRG |
Ga0308201_103435271 | 3300031091 | Soil | TIEGQAMDDRIVKSPQEASQGQKPAVTRYVLTIGLALVVILFLVAYLTVV |
Ga0308201_104345991 | 3300031091 | Soil | MDQRVVETPQRASQGQKPGVTRYVLTVGLALVVILFVVAYVISV |
Ga0308204_101478683 | 3300031092 | Soil | VKSPQEASQGHKPRVTRYVLAVSLVLVVILFAVAYLISV |
Ga0308204_103167571 | 3300031092 | Soil | RNTREQAMDQRVVETPERASQGQKPGVVRYVLSIGLALVVILFVVAYVISV |
Ga0326597_100926036 | 3300031965 | Soil | MGQAMDDRVVKTPQDARQGQKPGVTRYVLTIGLALVVILFLVAYLIAV |
Ga0348332_102118933 | 3300032515 | Plant Litter | DQRVVQTPEKARQGITPGVTRYVLVISTLLVVILFAVAYVISV |
⦗Top⦘ |