 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F087069 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRSKSMMGVQTVVPFKSKKTRQGNGLHSKPRKGKKKYRGQGK |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (98.182 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (34.546 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.727 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (81.818 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF02739 | 5_3_exonuc_N | 38.18 |
| PF00476 | DNA_pol_A | 29.09 |
| PF02867 | Ribonuc_red_lgC | 8.18 |
| PF01503 | PRA-PH | 4.55 |
| PF13155 | Toprim_2 | 4.55 |
| PF02945 | Endonuclease_7 | 3.64 |
| PF11753 | DUF3310 | 1.82 |
| PF10991 | DUF2815 | 1.82 |
| PF00124 | Photo_RC | 0.91 |
| PF00504 | Chloroa_b-bind | 0.91 |
| PF00959 | Phage_lysozyme | 0.91 |
| PF12236 | Head-tail_con | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 38.18 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 29.09 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 8.18 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 98.18 % |
| All Organisms | root | All Organisms | 1.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300006752|Ga0098048_1001594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 9833 | Open in IMG/M |
| 3300025070|Ga0208667_1001040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 10807 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 34.55% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.64% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 8.18% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.45% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.64% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.64% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.73% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.73% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.73% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.82% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.82% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.82% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.82% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.82% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.82% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 1.82% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.91% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.91% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.91% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.91% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.91% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.91% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.91% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.91% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.91% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001940 | Marine microbial communities from Bay of Fundy, Nova Scotia, Canada - GS006 | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300012523 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018543 | Metatranscriptome of freshwater lake microbial communities from Lake Tornetrask, Sweden - GS667_0p8 | Environmental | Open in IMG/M |
| 3300019098 | Metatranscriptome of marine microbial communities from Baltic Sea - GS684_0p1 | Environmental | Open in IMG/M |
| 3300019708 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MG | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300019937 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MG | Environmental | Open in IMG/M |
| 3300020371 | Marine microbial communities from Tara Oceans - TARA_B100000003 (ERX555978-ERR598991) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300023085 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_5_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100088197 | 3300000116 | Marine | MRSKTMMGQKTHVPFKSKKTSQGMGKNSKPKAGKKRYRGQGK* |
| DelMOSpr2010_102728812 | 3300000116 | Marine | MRSKSMMGVLTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK* |
| DelMOWin2010_100468944 | 3300000117 | Marine | MRSKSMMGVQNVIPFTSKKTRQGNGLHSKPRKGKKKYRGQGK* |
| LP_A_09_P04_10DRAFT_10120962 | 3300000265 | Marine | MRSKSMMGVQTVIPFKSKKTRQGNGLHSKPRKGKKKYRGQGK* |
| JGI20158J14315_101707522 | 3300001355 | Pelagic Marine | MISKSMMGVQTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK* |
| JGI24003J15210_100426512 | 3300001460 | Marine | MRSKSMMGVQTVIPFTSKKTRQGTGLHSKPRKGKKKYRGQGK* |
| GOS2222_10123581 | 3300001940 | Marine | PLMRSKSMMGVLTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK* |
| JGI26260J51721_10272422 | 3300003580 | Marine | MRSKSMMGVQTVIPFKSKKTRQGTGLHSKPRKGKKKYRGQGK* |
| Ga0065861_10054912 | 3300004448 | Marine | MRSKSMMGVQTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK* |
| Ga0074648_11604302 | 3300005512 | Saline Water And Sediment | MRSKSLMGVKKFQPFKSKKTTQGQGQHSKPKPGKKAYRGQGR* |
| Ga0075474_101718832 | 3300006025 | Aqueous | SKSMMGQVHKEPFKSKKTKQGTGRHSKPKANKKAYRGQGR* |
| Ga0075478_100084176 | 3300006026 | Aqueous | MRSKTLMGQKTHVPFKSKKTSQGMGKNSKTKPGKKKYRGQGK* |
| Ga0075478_100105364 | 3300006026 | Aqueous | MRSKSMMGQVHKEPFKSKKTKQGTGRHSKPKANKKAYRGQGR* |
| Ga0075478_100186312 | 3300006026 | Aqueous | MMGLSKFQAFKSKKTKQGAGRHSKPKAGKKAYRGQGR* |
| Ga0098073_10006162 | 3300006734 | Marine | MRSKSLMGLKRKDPFTSKKSTQGNGRHSKPKKGKKAYRGQGK* |
| Ga0098073_10262832 | 3300006734 | Marine | MRSKSLMGAKTLTPFTSKKTKQGQGKNSKPKGTRKMSRGQGK* |
| Ga0098048_100159417 | 3300006752 | Marine | MRSKSMMGLQNVIPFTSKKTRQGNGLHSKPRKGKKKYRGQGK* |
| Ga0098074_11287062 | 3300006790 | Marine | MRSKSLMGAKTLTPFTSKKTKQGQGKNSKAKGTRKLSRGQGK* |
| Ga0070749_100826323 | 3300006802 | Aqueous | MMGLSKFQAFKSKKTKQGAGRHSKPKAGKKSYRGQGR* |
| Ga0070749_102705372 | 3300006802 | Aqueous | MRSKTLMGQKTHVPFKSKKTSQGMGKNSKPKAGKKRYRGQGK* |
| Ga0070749_107890532 | 3300006802 | Aqueous | MRSKPKIGVQTVIPFTSKKTRQGNGLHSKPRKGKKKYRGQGK* |
| Ga0070754_100220374 | 3300006810 | Aqueous | MRSKTMMGLEKFQAFKSKKTKQGAGRHSKPKAGKKAYRGQGR* |
| Ga0070754_101745912 | 3300006810 | Aqueous | MRSKTLMGIKKFVPFKSKKTRQGNGQHSKPKAGRKAYRGQGR* |
| Ga0070754_103236712 | 3300006810 | Aqueous | MRSKTLMGQKTHVPFKSKKTSQGMGKNSKPKAGKKKYRGQGK* |
| Ga0070754_104424622 | 3300006810 | Aqueous | MRSKTMMGLSKFQAFKSKKTKQGAGRHSKPKAGKKAYRGQGR* |
| Ga0070754_105309542 | 3300006810 | Aqueous | MRSKSLMGQVHKEPFKSKKTKQGTGRHSKPKANKKEYRGQGR* |
| Ga0075481_100198854 | 3300006868 | Aqueous | MRSKTLMGQKTHVPFKSKKTLQGMGKNSKTKPGKKKYRGQGK* |
| Ga0075479_100489555 | 3300006870 | Aqueous | MGQKTHVPFKSKKTSQGMGKNSKPKAGKKRYRGQGK* |
| Ga0075479_102034412 | 3300006870 | Aqueous | MMGVKKLEPFKSKTTRQGAGKNSRPKKGKKAYRGQGR* |
| Ga0070753_10728172 | 3300007346 | Aqueous | MGLKRKDPFTSKKSTQGNGRHSKPKKGKKAYRGQGK* |
| Ga0099851_10045468 | 3300007538 | Aqueous | MRSKSLMGVKKFQPFKSKKTTQGQGQHSKPKSGKKAYRGQGR* |
| Ga0099849_10624704 | 3300007539 | Aqueous | MGQVHKEPFKSKKTRQGNGQHSKPKAGKKKYRGQGR* |
| Ga0099849_10668233 | 3300007539 | Aqueous | MRIKSMMGVQTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK* |
| Ga0099848_11422522 | 3300007541 | Aqueous | MRSKSLMGVKKFQPFKSKKTKQGQGQHSKPKSGKKAYRGQGR* |
| Ga0102963_12411872 | 3300009001 | Pond Water | MRSKTLMGQKTHVPFKSKKTSQGMGKNSKTKPGKKKYRGQGR* |
| Ga0115566_104778442 | 3300009071 | Pelagic Marine | MRSKTMMGVQTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK* |
| Ga0118687_103655872 | 3300009124 | Sediment | MRSKSMMGQKTHVPFKSKKTLQGMGKNSKTKPGKKKYRGQGR* |
| Ga0118687_104375122 | 3300009124 | Sediment | LMRSKSMMGVQTVVPFKSKKTRQGNGLHSKPRKGKKKYRGQGK* |
| Ga0115003_100292612 | 3300009512 | Marine | MRSKSMMGVQTVVPFTSKKTHQGNGLHSKPRKGKKKYRGQGK* |
| Ga0115011_100149665 | 3300009593 | Marine | MGQVVLTPFKSKKTRQGAGKNSKPKKGRKAYRGQGR* |
| Ga0115011_106975222 | 3300009593 | Marine | SKSMMGVLTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK* |
| Ga0098056_12539861 | 3300010150 | Marine | NPLMRSKSMMGVQTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK* |
| Ga0129348_10039543 | 3300010296 | Freshwater To Marine Saline Gradient | MRSKPLMGVKKFQPFKSKKTTQGQGQHSKPKSGKKAYRGQGR* |
| Ga0129348_10460133 | 3300010296 | Freshwater To Marine Saline Gradient | MRSKLMMGQKTHVPFKSKKTLQGMGKNSKTKPGKKKYRGQGR* |
| Ga0136549_100109722 | 3300010389 | Marine Methane Seep Sediment | MMGVKKLEPFNSKKTKQGAGKNSRPKKGKKAYRGQGR* |
| Ga0118733_1045283292 | 3300010430 | Marine Sediment | MRSKSMMGVQTVVPFTSKKTRQGNGLHSKPHKGKKKYRGQGK* |
| Ga0129350_107556115 | 3300012523 | Aqueous | KTLMGIKKFVPFKSKKTRQGNGQHSKPKAGRKAYRGQGR* |
| Ga0181387_10730332 | 3300017709 | Seawater | MRSKAMMGVLTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK |
| Ga0181380_10328081 | 3300017782 | Seawater | NPLMRSKSMMGVQTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK |
| Ga0181577_100222064 | 3300017951 | Salt Marsh | MRSKTMMGLSKFQAFKSKKTKQGAGRHSKPKAGKKAYRGQGR |
| Ga0181590_102105732 | 3300017967 | Salt Marsh | MRSKSMMGLTKFQAFKSKKTKQGTGRHSKPKAGKKAYRGQGK |
| Ga0181590_102406093 | 3300017967 | Salt Marsh | MRSKSLMGLKRKDPFTSKKSTQGNGRHSKPKKGKKAYRGQ |
| Ga0181592_100249824 | 3300018421 | Salt Marsh | MGLKRKDPFTSKKSTQGNGRHSKPKKGKKAYRGQGK |
| Ga0181592_101592162 | 3300018421 | Salt Marsh | MRSKSMMGQVHKEPFKSKKTKQGTGRHSKPKANKKAYRGQGR |
| Ga0181592_107763921 | 3300018421 | Salt Marsh | MRSKTLMGQKTHVPFKSKKTSQGMGKNSKTKAGKKKYRGQGK |
| Ga0181592_109835292 | 3300018421 | Salt Marsh | MRSKTLMGQKTHVPFKSKKTSQGMGKNSKTKPGKKKYRGQGK |
| Ga0181591_100408502 | 3300018424 | Salt Marsh | MRSKSLMGLKRKDPFTSKKSTQGNGRHSKPKKGKKAYRGQGK |
| Ga0188820_1006462 | 3300018543 | Freshwater Lake | MRSKSMMGVQTVIPFKSKKTRQGTGLHSKPRKGKKKYRGQGK |
| Ga0188859_10040772 | 3300019098 | Freshwater Lake | MKSKSMKGVQTVVPFKSKKTRQGTGLHSKPRKGKKKYRG |
| Ga0194016_10003465 | 3300019708 | Sediment | MMGLSKFQAFKSKKTKQGAGRHSKPKAGKKAYRGQGR |
| Ga0194016_10285411 | 3300019708 | Sediment | MRSKSMMGVQTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK |
| Ga0194029_10982092 | 3300019751 | Freshwater | MRSKSMMGVQTVIPFKSKKTRQGNGLHSKPRKGKKKYRGQGK |
| Ga0194023_11107991 | 3300019756 | Freshwater | MMGQVHKEPFKSKKTKQGTGRHSKPKANKKAYRGQGR |
| Ga0194024_10899352 | 3300019765 | Freshwater | MRSKTLMGQKTHVPFKSKKTSQGMGKNSKPKAGKKKYRGQGK |
| Ga0194022_10037601 | 3300019937 | Freshwater | MGLSKFQAFKSKKTKQGAGRHSKPKAGKKAYRGQGR |
| Ga0211500_10577812 | 3300020371 | Marine | MRSKSLMGQKLHTPFKSKKTLQGTGRNSKPKAGKKKYRGQGK |
| Ga0211554_100661532 | 3300020431 | Marine | MRSKSMMGVLTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK |
| Ga0211546_100001102 | 3300020462 | Marine | MRSKSLMGVITVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK |
| Ga0213858_103990551 | 3300021356 | Seawater | MRSKSLMGVKKFQPFKSKKTTQGQGQHSKPKSGKKAYRGQGR |
| Ga0213859_100714532 | 3300021364 | Seawater | MRSKTMMGQKTHVPFKSKKTSQGMGKNSKPKAGKKRYRGQGK |
| Ga0213859_104302731 | 3300021364 | Seawater | NTLMRSKSLMGVKKFQPFKSKKTTQGQGQHSKPKSGKKAYRGQGR |
| Ga0222718_100601685 | 3300021958 | Estuarine Water | MRSKPKIGVQTVIPFTSKKTRQGNGLHSKPRKGKKKYRGQGK |
| Ga0222718_100949523 | 3300021958 | Estuarine Water | MRSKTLMGQKTHVPFKSKKTSQGMGKNSKPKAGKKKYRGQGR |
| Ga0222718_105601831 | 3300021958 | Estuarine Water | PLMRSKSMMGQVYKEPFKSKKTKQGAGRHSKPKANKKAYRGQGR |
| Ga0222719_102250802 | 3300021964 | Estuarine Water | MRSKTLMGQKTHVPFKSKKTLQGMGKNSKTKPGKKKYRGQGK |
| Ga0222719_103325861 | 3300021964 | Estuarine Water | MRSKSMMGLTKFQAFKSKKTKQGTGRHSKPKAGKK |
| Ga0222719_103557592 | 3300021964 | Estuarine Water | MRSKSMMGVQTVVPFKSKKTRQGNGLHSKPRKGKKKYRGQGK |
| Ga0212025_10501232 | 3300022057 | Aqueous | MRSKSLMGAKTLTPFKSKKTRQGMGKNSRPKAGKKKYRGQGK |
| Ga0212026_10333231 | 3300022069 | Aqueous | LMGQKTHVPFKSKKTSQGMGKNSKPKAGKKRYRGQGR |
| Ga0212028_10319031 | 3300022071 | Aqueous | PLMRSKSMMGVQTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK |
| Ga0212028_10337581 | 3300022071 | Aqueous | MRSKSMMGVQTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQ |
| Ga0212027_10004745 | 3300022168 | Aqueous | MRSKTLMGQKTHVPFKSKKTSQGMGKNSKPKAGKKRYRGQGK |
| Ga0196899_10253441 | 3300022187 | Aqueous | MRSKTLMGQKTHVPFKSKKTSQGMGKNSKPKAGKKRYRG |
| Ga0196899_10918333 | 3300022187 | Aqueous | TLMRSKTLMGQKTHVPFKSKKTSQGMGKNSKPKAGKKRYRGQGK |
| Ga0196899_11666111 | 3300022187 | Aqueous | TLMRSKTLMGQKTHVPFKSKKTSQGMGKNSKPKAGKKRYRGQGR |
| Ga0255781_100248482 | 3300022934 | Salt Marsh | MMGLSKFKPNNSKKTKQGAGRHSKPKADKKIYRGQGR |
| (restricted) Ga0233406_100367791 | 3300023085 | Seawater | MRSKRMMGVQTVIPFKSKKTHQGNGLHSKPRKGKKKYRGQG |
| (restricted) Ga0255040_100488163 | 3300024059 | Seawater | MRSKSMMGVQTVIPFKSKKTHQGNGLHSKPRKGKKKYRGQGK |
| (restricted) Ga0255039_102946163 | 3300024062 | Seawater | GVQTVIPFKSKKTHQGNGLHSKPRKGKKKYRGQGK |
| Ga0208667_10010405 | 3300025070 | Marine | MRSKSMMGLQNVIPFTSKKTRQGNGLHSKPRKGKKKYRGQGK |
| Ga0208793_10890392 | 3300025108 | Marine | MRSKSMMGVQTVVPFTSKKTRQGNGLHSKPRKGKKK |
| Ga0209535_10209435 | 3300025120 | Marine | MRSKSMMGVQTVIPFTSKKTRQGTGLHSKPRKGKKKYRGQGK |
| Ga0209337_12209881 | 3300025168 | Marine | LMRSKSMMGVLTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK |
| Ga0208643_10456282 | 3300025645 | Aqueous | MRSKSMMGVQNVIPFTSKKTRQGNGLHSKPRKGKKKYRGQGK |
| Ga0208160_11097192 | 3300025647 | Aqueous | MRSKTMMGLEKFQAFKSKKTKQGAGRHSKPKAGKKAYRGQGR |
| Ga0208428_10513142 | 3300025653 | Aqueous | MRSKTLMGIKKFVPFKSKKTRQGNGQHSKPKAGRKAYRGQGR |
| Ga0208428_11172443 | 3300025653 | Aqueous | KTLMGQKTHVPFKSKKTSQGMGKNSKPKAGKKRYRGQGK |
| Ga0208898_10102438 | 3300025671 | Aqueous | MRSKTLMGQKTHVPFKSKKTSQGMGKNSKPKAGKKRYR |
| Ga0208898_10322261 | 3300025671 | Aqueous | NTLRSKSLMGIKKLEPFKSKKTRQGNGQHSKPKGTRKLSRGQGK |
| Ga0208898_11746872 | 3300025671 | Aqueous | MRSKTLMGIKKFVPFKSKKTKQGAGRHSKPRAGRKAYRGQGR |
| Ga0208162_10126316 | 3300025674 | Aqueous | MRSKSMMGQKTHVPFKSKKTLQGMGKNSKTKPGKKKYRGQGR |
| Ga0209308_102913492 | 3300025869 | Pelagic Marine | MRSKTMMGVQTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK |
| Ga0209502_100623301 | 3300027780 | Marine | MRSKSMMGVQTVVPFTSKKTHQGNGLHSKPRKGKKKYRGQGK |
| Ga0209404_100617554 | 3300027906 | Marine | MGVLTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK |
| (restricted) Ga0233413_103665662 | 3300027996 | Seawater | MRSKTMMGVQTVIPFKSKKTHQGNGLHSKPRKGKKKYRGQGK |
| Ga0265303_111004972 | 3300028600 | Sediment | MRSKSMMGVLTVVPFTSNKTRQGNGLHSKPRKGKKKYRGQGK |
| Ga0307380_100228296 | 3300031539 | Soil | MRSKSMMGVQTVVPFKSKKTRQGTGLHSKPRKGKKKYRGQGK |
| Ga0307489_103573302 | 3300031569 | Sackhole Brine | MMGVQTVVPFTSKKTRQGNGLHSKPRKGKKKYRGQGK |
| Ga0316201_100430582 | 3300032136 | Worm Burrow | MRSKSLMGQVHKEPFKSKKTKQGTGRHSKPKANKKEYRGQGR |
| Ga0348335_139809_433_561 | 3300034374 | Aqueous | MRSKTMMGQKTHVPFKSKKTSQGMGKNSKPKAGKKKYRGQGK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |