NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087118

Metagenome / Metatranscriptome Family F087118

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087118
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 85 residues
Representative Sequence MTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNTADGIGNLWARGNMVKAIREAAQA
Number of Associated Samples 95
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 98.18 %
% of genes from short scaffolds (< 2000 bps) 93.64 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (75.455 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(18.182 % of family members)
Environment Ontology (ENVO) Unclassified
(56.364 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(48.182 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.12%    β-sheet: 40.00%    Coil/Unstructured: 45.88%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF12705PDDEXK_1 2.73
PF02467Whib 1.82


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.18 %
UnclassifiedrootN/A1.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000864|OpTDRAFT_1009463All Organisms → Viruses → Predicted Viral2070Open in IMG/M
3300002202|metazooDRAFT_1255169All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage638Open in IMG/M
3300002272|B570J29579_104396All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage695Open in IMG/M
3300002408|B570J29032_109057910All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage580Open in IMG/M
3300003394|JGI25907J50239_1118418All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300005943|Ga0073926_10137386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300006029|Ga0075466_1118773All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage703Open in IMG/M
3300006037|Ga0075465_10159240All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300006637|Ga0075461_10191017All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage616Open in IMG/M
3300006641|Ga0075471_10312693All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage798Open in IMG/M
3300006802|Ga0070749_10543399All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage630Open in IMG/M
3300006803|Ga0075467_10415361All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage699Open in IMG/M
3300006875|Ga0075473_10392865All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300006920|Ga0070748_1267754All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage612Open in IMG/M
3300007363|Ga0075458_10158921All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage698Open in IMG/M
3300007363|Ga0075458_10188809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage634Open in IMG/M
3300007639|Ga0102865_1122121All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage779Open in IMG/M
3300007640|Ga0070751_1223037All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage725Open in IMG/M
3300008339|Ga0114878_1099969All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1120Open in IMG/M
3300008450|Ga0114880_1063689All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1516Open in IMG/M
3300008450|Ga0114880_1123994All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage966Open in IMG/M
3300008450|Ga0114880_1166069All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage777Open in IMG/M
3300008450|Ga0114880_1271134All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300009026|Ga0102829_1243064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300009039|Ga0105152_10047737All Organisms → Viruses → Predicted Viral1707Open in IMG/M
3300009081|Ga0105098_10276118All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage800Open in IMG/M
3300009085|Ga0105103_10200847All Organisms → Viruses → Predicted Viral1066Open in IMG/M
3300009152|Ga0114980_10134378All Organisms → Viruses → Predicted Viral1470Open in IMG/M
3300009152|Ga0114980_10776144All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300009155|Ga0114968_10448919All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage698Open in IMG/M
3300009181|Ga0114969_10675076All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage559Open in IMG/M
3300009181|Ga0114969_10768579All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300009183|Ga0114974_10049522All Organisms → Viruses → Predicted Viral2825Open in IMG/M
3300009183|Ga0114974_10268440All Organisms → Viruses → Predicted Viral1014Open in IMG/M
3300009185|Ga0114971_10254610All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1026Open in IMG/M
3300009563|Ga0130030_1006685All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1809Open in IMG/M
3300011182|Ga0136707_1045691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300011183|Ga0136713_1041865All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300011184|Ga0136709_1064935All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage509Open in IMG/M
3300011268|Ga0151620_1027665All Organisms → Viruses → Predicted Viral1947Open in IMG/M
3300012012|Ga0153799_1081939All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300012776|Ga0138275_1216754All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage571Open in IMG/M
3300013004|Ga0164293_10322376All Organisms → Viruses → Predicted Viral1063Open in IMG/M
3300013004|Ga0164293_10438895All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage872Open in IMG/M
3300017736|Ga0181365_1039265All Organisms → Viruses → Predicted Viral1190Open in IMG/M
3300017766|Ga0181343_1133355All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage695Open in IMG/M
3300017766|Ga0181343_1218048All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300017774|Ga0181358_1037390All Organisms → Viruses → Predicted Viral1877Open in IMG/M
3300017778|Ga0181349_1258728All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage578Open in IMG/M
3300017784|Ga0181348_1051099All Organisms → Viruses → Predicted Viral1692Open in IMG/M
3300017785|Ga0181355_1116699All Organisms → Viruses → Predicted Viral1095Open in IMG/M
3300017785|Ga0181355_1380231All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300018416|Ga0181553_10117020All Organisms → Viruses → Predicted Viral1624Open in IMG/M
3300019784|Ga0181359_1063541All Organisms → Viruses → Predicted Viral1409Open in IMG/M
3300020151|Ga0211736_10646329All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage778Open in IMG/M
3300020159|Ga0211734_10842802All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1082Open in IMG/M
3300020205|Ga0211731_11056254All Organisms → Viruses → Predicted Viral1179Open in IMG/M
3300020530|Ga0208235_1023957All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage744Open in IMG/M
3300020549|Ga0207942_1022713All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage798Open in IMG/M
3300020570|Ga0208465_1029402All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage711Open in IMG/M
3300022752|Ga0214917_10442498All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300022929|Ga0255752_10263520All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage756Open in IMG/M
3300024239|Ga0247724_1018091All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1026Open in IMG/M
3300025630|Ga0208004_1126139All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300025635|Ga0208147_1061003All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage953Open in IMG/M
3300025848|Ga0208005_1161285All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage698Open in IMG/M
3300027621|Ga0208951_1133611All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage656Open in IMG/M
3300027631|Ga0208133_1129122All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300027659|Ga0208975_1058902All Organisms → Viruses → Predicted Viral1165Open in IMG/M
3300027720|Ga0209617_10380166All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300027736|Ga0209190_1049230All Organisms → Viruses → Predicted Viral2141Open in IMG/M
3300027754|Ga0209596_1368147All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage549Open in IMG/M
3300027782|Ga0209500_10107228All Organisms → Viruses → Predicted Viral1375Open in IMG/M
3300027798|Ga0209353_10375996All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage588Open in IMG/M
3300027798|Ga0209353_10412275All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage552Open in IMG/M
3300027963|Ga0209400_1372251All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300027972|Ga0209079_10099603All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage992Open in IMG/M
3300027973|Ga0209298_10365773All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300031873|Ga0315297_10069052All Organisms → Viruses → Predicted Viral2731Open in IMG/M
3300031951|Ga0315904_11300369All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300031997|Ga0315278_10555802All Organisms → Viruses → Predicted Viral1178Open in IMG/M
3300032143|Ga0315292_10619991All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage911Open in IMG/M
3300032156|Ga0315295_10538116All Organisms → Viruses → Predicted Viral1187Open in IMG/M
3300032164|Ga0315283_12233642All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage537Open in IMG/M
3300032173|Ga0315268_10511051All Organisms → Viruses → Predicted Viral1185Open in IMG/M
3300032177|Ga0315276_10569521All Organisms → Viruses → Predicted Viral1217Open in IMG/M
3300032177|Ga0315276_11928931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage604Open in IMG/M
3300032342|Ga0315286_12049595All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage530Open in IMG/M
3300032516|Ga0315273_11383937All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage873Open in IMG/M
3300033993|Ga0334994_0483746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300033995|Ga0335003_0085682All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1648Open in IMG/M
3300033996|Ga0334979_0220311All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1110Open in IMG/M
3300034019|Ga0334998_0651446All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage567Open in IMG/M
3300034022|Ga0335005_0662082All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300034062|Ga0334995_0656673All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage598Open in IMG/M
3300034062|Ga0334995_0668612All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage590Open in IMG/M
3300034072|Ga0310127_051752All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2048Open in IMG/M
3300034072|Ga0310127_265861All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300034082|Ga0335020_0174149All Organisms → Viruses → Predicted Viral1080Open in IMG/M
3300034095|Ga0335022_0112609All Organisms → Viruses → Predicted Viral1723Open in IMG/M
3300034101|Ga0335027_0423833All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage856Open in IMG/M
3300034101|Ga0335027_0775407All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage559Open in IMG/M
3300034119|Ga0335054_0355290All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage847Open in IMG/M
3300034120|Ga0335056_0535389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage612Open in IMG/M
3300034121|Ga0335058_0505005All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage685Open in IMG/M
3300034200|Ga0335065_0334314All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage947Open in IMG/M
3300034283|Ga0335007_0805252All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage509Open in IMG/M
3300034355|Ga0335039_0597609All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage541Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater18.18%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake12.73%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.73%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake10.91%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment9.09%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.55%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.64%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.64%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.64%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.73%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.73%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.82%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.82%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water1.82%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.91%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake0.91%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.91%
Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment0.91%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.91%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.91%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.91%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.91%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.91%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.91%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000864Marine plume microbial communities from the Columbia River - Metatranscriptome 25 PSUEnvironmentalOpen in IMG/M
3300002202Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012EnvironmentalOpen in IMG/M
3300002272Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion nsEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300005943Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007639Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300008339Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009039Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cmEnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300009563Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 6m; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300011182Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - 4C3 metaGEnvironmentalOpen in IMG/M
3300011183Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - JTO22cm metaGEnvironmentalOpen in IMG/M
3300011184Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaGEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012264Freshwater sediment bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - Sed-PBS metaGEnvironmentalOpen in IMG/M
3300012776Freshwater microbial communities from Lake Montjoie, Canada - M_130207_X_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020530Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020549Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020570Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300024239Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-EEnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027973Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034072Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-AEnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OpTDRAFT_100946343300000864Freshwater And MarineMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTSM
metazooDRAFT_125516923300002202LakeMSDVFMSEGGAKYPALKFNEIGDTHTGKVVEVKKLEDRDPDGNVKTWPNGDTRFVFVFTLNTADGVANLWARGNMVKSIREA
B570J29579_10439623300002272FreshwaterMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMVKA
B570J29032_10905791013300002408FreshwaterMTDIFLGEGGNKYPALKFDTAGDSHTGKVIEVKKLEDRDPAGNVKTWDNGDTRYVFVFTITTTD
JGI25907J50239_111841823300003394Freshwater LakeMTDIFLQDGGSKYPALKFENPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTE
Ga0073926_1013738623300005943SandMTDIFMQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATAANVTAMVGTNLTVKYTGDGEKK
Ga0075466_111877323300006029AqueousMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDTRYVFVFTINTGTEIGNLWARGAMVKTIREAATAANVTAMV
Ga0075465_1015924023300006037AqueousMTDIFLSDGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTLNTAD
Ga0075461_1019101713300006637AqueousMTDVFMSEGGSKYPALKFENVNDTHTGRVVEVKKLEDRDPDGNVKTWPNGDTRFVFVFTVETNGEFGNIWARGNMVKAIREAAQAAGLST
Ga0075471_1031269333300006641AqueousMTDIFLSESGSKYPALKFENVNDTHSGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMV
Ga0070749_1054339923300006802AqueousMTDIFLSEGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMVKAIREAAQAIGATTMVGTKLTVKYTGDGE
Ga0075467_1041536123300006803AqueousMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDTRYVFVFTINTGTEIGNIWARGAMVKTVREAATAAGVTAMVGTTLTVKYT
Ga0075473_1039286523300006875AqueousMTDIFLQDGGSKYPALKFETPGDTHTGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATAANVTAMVGTNLTVKYTGDGEKKTKG
Ga0070748_126775413300006920AqueousMTDIFLQDGGSKYPALKFETIGDQHSGVVLEVKKLEDRDPSGNTKTWDNGDIRYVFVFTVNTGTEIGNL
Ga0075458_1015892113300007363AqueousMTDIFLSDGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTMNTADGIGNLW
Ga0075458_1018880913300007363AqueousMTDIFLSEGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPSGTVKTWDNGGVRYVFVFTMNTADGI
Ga0102865_112212113300007639EstuarineMTDIFLSEGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNTADGIGNLWARGAMVKSIREAAQAIGASTMIGTKLT
Ga0070751_122303713300007640AqueousMTDIFLSDGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTLNTADGIGNLWARSDG*
Ga0114878_109996913300008339Freshwater LakeMTDIFLSDGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMVKAIREAAQAIGATTMVGTKLTVKYTGDGEKKSK
Ga0114880_106368913300008450Freshwater LakeMTDIFLSEGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMVKAIREAAQAIGATTMVGTKLTVKYTGDGEKKSK
Ga0114880_112399433300008450Freshwater LakeMTDVFMSEGGSKYPALKFENVNDTHTGRVVEVKKLEDRDPDGNVKTWPNGDTRFVFVFTVENNGEFGNIWARGNMVKAIREA
Ga0114880_116606913300008450Freshwater LakeMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNTADGIG
Ga0114880_127113423300008450Freshwater LakeMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTLNTADGIGNLWSRGNMVKAIREAAQSAGVSSMVGTKLTVKYT
Ga0102829_124306423300009026EstuarineMTDIFLQDGGSKYPALKFENPGDTHSGRVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATAA
Ga0105152_1004773733300009039Lake SedimentMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDTRYVFVFTINTGTEIGNLW
Ga0102830_116059823300009059EstuarineMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNTADGIGNLWARGNMVKAIREAAQSIGASTMVGTKLTVKYTGDGEKKSKAF
Ga0105098_1027611823300009081Freshwater SedimentMTDIFLSDGGSKYPALKFENVNDTHSGTVIEVKKLEDRSPDGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMVKAIREAAQAIGATTMVGTKLTVKYTGDG
Ga0105103_1020084713300009085Freshwater SedimentMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGAMVKAIREAAQAIGATTM
Ga0114980_1013437813300009152Freshwater LakeMTDIFLQDGGSKYPALKFETPGDSHTGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFNINTGTEI
Ga0114980_1077614423300009152Freshwater LakeMTDIFLGEGGNKYPALKFDTAGDSHTGKVIEVKKLEDRDPAGNVKTWDNGDTRYVFVFTITTADGFGNLWARGNMVKAIREAATA
Ga0114968_1044891933300009155Freshwater LakeMTDIFLSEGGNKYPALKFENVNDTHSGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNT
Ga0114969_1067507613300009181Freshwater LakeMTDIFLSEGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTLNTADGIGNLWARGAMVKSIREAAQAIG
Ga0114969_1076857923300009181Freshwater LakeMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATAANVTAMVGTNLTVKYTGDGEKK
Ga0114974_1004952263300009183Freshwater LakeMTDIFLQDGGSKYPALKFETIGDTHSGKVLEVKKLEDRDPSGNTKTWDNGDIRYVFVFTINTGTEIGNIWARGAMVKTIREAATAANV
Ga0114974_1026844033300009183Freshwater LakeMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATAANVTAMVGTNL
Ga0114971_1025461033300009185Freshwater LakeMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTMNTADGIGNLWARG
Ga0130030_100668513300009563Meromictic PondMTDIFLSEGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTMNTAD
Ga0136707_104569113300011182FreshwaterMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNTADGIGNLWSRGAMVKAIREAAQSAGVSSMIGTKLTVKYTG
Ga0136713_104186523300011183FreshwaterMTDIFLGEGGNKYPALKFDTAGDSHTGKVIEVKKLEDRDPAGNVKTWDNGDTRYVFVFTITTADGFGNLWARGNMVKAIREAATAAGVTTM
Ga0136709_106493513300011184FreshwaterMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTLNTADGIGNLWARGAMVKAIREAAQAI
Ga0151620_102766513300011268FreshwaterMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTE
Ga0153799_108193923300012012FreshwaterMTDIFLGEGGNKYPALKFDTAGDSHTGKVIEVKKLEDRDPAGNVKTWDNGDTRYVFVFTITTTDGFGNLWARGNMVKA
Ga0136715_103143913300012264Freshwater SedimentMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMVKAIREAAQAIGASTMVGTKLTVKYTGDGEKKSKATKVVQGQG
Ga0138275_121675423300012776Freshwater LakeMTDIFLQDGGSKYPALKFETPGDTHTGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGAMVKTIREAATAAGVTAMVGTNLTVKYTGDGEKKTKG
Ga0164293_1032237633300013004FreshwaterMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNTADGIGNLWARGNMVKAIREAAQA
Ga0164293_1043889513300013004FreshwaterMTDIFLGEGGNKYPALKFDTAGDSHTGKVIEVKKLEDRDPAGNIKTWDNGDTRYVFVFTISTTDGFGNLWARGNM
Ga0181365_103926513300017736Freshwater LakeMTDIFLSEGGSKYPALKFENVNDTHSGTVIEVKKLEDRSPDGTVKTWDNGDVRYVFVFTLNTADGIGNLWARGAMV
Ga0181343_113335523300017766Freshwater LakeMTDIFLSDGWSKYPALKFENVNDTHTGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMVKAIREAAQAIGASTMVGTKLTVKYTGDGEKKSKAF
Ga0181343_121804813300017766Freshwater LakeMTDIFLGEGGNKYPALKFDNPGDSHIGKVIEVKKLEDRDPAGNIKTWDNGDTRYVFVFTITTTDGFGNLWARGNMVKAIREAAT
Ga0181358_103739033300017774Freshwater LakeMSDIFLSEGGAKSPALKFESINDSHAGKVIEVQKLEDRDPNGELKTWPNGDPKFVFVFT
Ga0181349_125872823300017778Freshwater LakeMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATAANVTAMVGTNLTVKYTG
Ga0181348_105109913300017784Freshwater LakeMTDIFLSEGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNTADGIGNLWARGAM
Ga0181355_111669913300017785Freshwater LakeMTDIFLGEGGNKYPALKFDTAGDSHTGKVIEVKKLEDRDPAGNVKTWDNGDTRYVFVFTITTTDGFGNLWARGNMVKAIREAATAAGVTTM
Ga0181355_138023123300017785Freshwater LakeMSDIFLSEGGAKSPALKFESINDSHAGKVIEVQKLEDRDPNGELKTWPNGDPKFVFVFTMATSEG
Ga0181553_1011702013300018416Salt MarshMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTI
Ga0181359_106354113300019784Freshwater LakeMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATA
Ga0211736_1064632933300020151FreshwaterMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGT
Ga0211734_1084280213300020159FreshwaterMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTLNTADGIGNLWARGAMVKSIREAAQAIGASTM
Ga0211731_1105625413300020205FreshwaterMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWA
Ga0208235_102395713300020530FreshwaterMTDIFLSEGGNKYPALKFDTPGDSHTGKVIEVKKLEDRDPAGNIKTWDNGDTRYVFVFTISTTDGFGNLWARGNMVKAIREAATA
Ga0207942_102271313300020549FreshwaterMTDIFLGEGGNKYPALKFDTAGDSHTGKVIEVKKLEDRDPAGNIKTWDNGDTRYVFVFTISTTDGFGNLWARGNMVKA
Ga0208465_102940223300020570FreshwaterMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMVKAIR
Ga0214917_1044249823300022752FreshwaterMTDIFLSDGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTMNTAD
Ga0255752_1026352013300022929Salt MarshMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIR
Ga0247724_101809133300024239Deep Subsurface SedimentMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNTADGIGNLWSRGNMVKAIREA
Ga0208004_112613913300025630AqueousMTDVFMSEGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMVK
Ga0208147_106100313300025635AqueousMTDVFMSEGGSKYPALKFENVNDTHTGRVVEVKKLEDRDPDGNVKTWPNGDTRFVFVFTVENNGEFGNIWARGNMVKAIRE
Ga0208005_116128513300025848AqueousMTDIFLQDGGSKYPALKFETPGDTHTGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATAANVTAMVGTNLTVKYTGDGE
Ga0208951_113361113300027621Freshwater LenticMTDIFLQDGGSKYPALKFENPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATAANVTAMVGTNLTV
Ga0208133_112912213300027631EstuarineMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATAANVTAMVGTNLTVKYTGD
Ga0208975_105890213300027659Freshwater LenticMTDIFLSEGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNTADGIGNLWARGAMVKSIREAAQAIGASTMIGT
Ga0209617_1038016623300027720Freshwater And SedimentMTDIFLQDGGSKYPALKFETIGDQHSGVVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATA
Ga0209190_104923043300027736Freshwater LakeMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGN
Ga0209596_136814723300027754Freshwater LakeMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATAANVTAMVGTNLTVKYT
Ga0209500_1010722833300027782Freshwater LakeMTDIFLSDGGSKYPALKFENINDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMVKAIREAAQAIGASTMVGTKLTVKYTGDGEKKSK
Ga0209353_1037599623300027798Freshwater LakeMTDIFLGEGGNKYPALKFDTAGDSHTGKVIEVKKLEDRDPAGNVKTWDNGDTRYVFVFTITTTDGFGNLWARGNMVKAIREAATAAGVTTMVGTNLSVKFTG
Ga0209353_1041227513300027798Freshwater LakeMTDIFLSEGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNTADGIGNLWARGAMVKSIREAAQAIGASTMIGTKLTVK
Ga0209400_137225113300027963Freshwater LakeMTDIFLSEGGNKYPALKFENVNDTHSGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNTADGIGNLWA
Ga0209079_1009960333300027972Freshwater SedimentMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNTADG
Ga0209298_1036577323300027973Freshwater LakeMTDIFLQDGGSKYPALKFETPGDSHTGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNIWARGAMVKTIREAATAANVTAMVGTN
Ga0315297_1006905253300031873SedimentMTDIFLQDGGSKYPALKFENPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATAANVTAMVGTNLTVKY
Ga0315904_1130036923300031951FreshwaterMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNM
Ga0315278_1055580213300031997SedimentMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATAAN
Ga0315292_1061999133300032143SedimentMTDIFLSEGGSKYPALKFENVNDTHSGTVIEIKKLEDRDPSGTVKTWDNGDVRYVFVFTLNTADGIGNLWARGAMVKSIR
Ga0315295_1053811633300032156SedimentMTDIFLSEGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTLNTADGIGNLWARGAMVKSIREAAQAIGASTM
Ga0315283_1223364213300032164SedimentMTDIFLSEGGSKYPALKFENVNDTHSGTVIEIKKLEDRDPSGTVKTWDNGDVRYVFVFTLNTADGIGNLWARGAMVKSIREAAQAIGASTMIG
Ga0315268_1051105133300032173SedimentMTDIFLQDGGSKYPALKFENPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATAANVTAMVGTNLTVKYTG
Ga0315276_1056952133300032177SedimentMTDIFLSDGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPAGTVKTWDNGDVRYIFVFTLNTADGIGNLWARGAMVK
Ga0315276_1192893123300032177SedimentMTDIFLQDGGSKYPALKFENPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATAADVTAM
Ga0315286_1204959513300032342SedimentMTDIFLSEGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNTADGIGNLWARGAMVKSI
Ga0315273_1138393733300032516SedimentMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATAANVTAMVGTNLTVKYTGDGEKKTK
Ga0334994_0483746_3_3263300033993FreshwaterMTDIFLSDGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMVKAIREAAQAIGASTMVGTKLTVKYTGDGEKKS
Ga0335003_0085682_1364_16483300033995FreshwaterMTDIFLSEGGNKYPALKFDTPGDSHTGKVIEVKKLEDRDPAGNIKTWDNGDTRYVFVFTISTTDGFGNLWARGNMVKAIREAATAIGASTMVGTT
Ga0334979_0220311_3_3113300033996FreshwaterMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMVKAIREAAQAIGASTMVGTKLTVKYTGD
Ga0334998_0651446_310_5673300034019FreshwaterMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMVKAIREAAQAI
Ga0335005_0662082_3_3173300034022FreshwaterMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAATAANVTAMVGTNLTVKYTGDGE
Ga0334995_0656673_413_5983300034062FreshwaterMTDIFLGEGGNKYPALKFDTAGDSHTGKVIEVKKLEDRDPAGNVKTWDNGDTRYVFVFTITT
Ga0334995_0668612_390_5903300034062FreshwaterMTDIFLSDGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTMNTADGIG
Ga0310127_051752_1806_20483300034072Fracking WaterMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMVKAIRE
Ga0310127_265861_1_2133300034072Fracking WaterMTDIFLSEGGSKYPALKFENVNDTHSGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTLNTADGIGNLWS
Ga0335020_0174149_1_2883300034082FreshwaterMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNTADGIGNLWSRGAMVKAIREAAQSAGVTSMIGTKL
Ga0335022_0112609_3_2513300034095FreshwaterMTDIFLQDGGSKYPALKFETPGDTHSGKVLEVKKLEDRDPQGNTKTWDNGDVRYVFVFTINTGTEIGNLWARGNMVKTIREAA
Ga0335027_0423833_3_2033300034101FreshwaterMTDVFMSEGGSKYPALKFENVNDTHTGRVVEVKKLEDRDPDGNVKTWPNGDTRFVFVFTVENNGEFG
Ga0335027_0775407_1_2223300034101FreshwaterMTDIFLSEGGNKYPALKFDTPGDSHTGKVIEVKKLEDRDPAGNIKTWDNGDTRYVFVFTISTTDGFGNLWARGN
Ga0335054_0355290_635_8473300034119FreshwaterMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNTADGIGNLWA
Ga0335056_0535389_280_6123300034120FreshwaterMTDIFLQDGGSKYPALKFETIGDTHSGVVLEVKKLEDRDPSGNTKTWDNGDIRYVFVFTINTGTEIGNIWARGSLVKTVREAAQAANVTAMVGTNLTVKYTGNGEQKTKGF
Ga0335058_0505005_415_6843300034121FreshwaterMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPAGTVKTWDNGDVRYVFVFTLNTADGIGNLWARGAMVKAIREAAQAIGAST
Ga0335065_0334314_1_2013300034200FreshwaterMTDIFLSEGGNKYPALKFDTPGDSHTGKVIEVKKLEDRDPAGNVKTWDNGDTRYVFVFTITTTDGFG
Ga0335007_0805252_224_5083300034283FreshwaterMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMVKAIREAAQAIGATTMVGTK
Ga0335039_0597609_1_2403300034355FreshwaterMTDIFLSDGGSKYPALKFENVNDTHTGTVIEVKKLEDRDPSGTVKTWDNGDVRYVFVFTMNTADGIGNLWARGNMVKAIR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.