NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087290

Metagenome / Metatranscriptome Family F087290

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087290
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 42 residues
Representative Sequence MSYGVAESELLTEDTVLRRVQGAMSYKFRTGLDVNKEVNGNP
Number of Associated Samples 100
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 85.45 %
% of genes near scaffold ends (potentially truncated) 22.73 %
% of genes from short scaffolds (< 2000 bps) 83.64 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.364 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.454 % of family members)
Environment Ontology (ENVO) Unclassified
(29.091 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.182 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.71%    β-sheet: 0.00%    Coil/Unstructured: 54.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF12833HTH_18 48.18
PF00106adh_short 3.64
PF00165HTH_AraC 1.82
PF00561Abhydrolase_1 1.82
PF00072Response_reg 0.91
PF13561adh_short_C2 0.91
PF02566OsmC 0.91
PF16694Cytochrome_P460 0.91
PF01850PIN 0.91
PF12770CHAT 0.91
PF13577SnoaL_4 0.91
PF12681Glyoxalase_2 0.91
PF13517FG-GAP_3 0.91
PF00174Oxidored_molyb 0.91
PF11453DUF2950 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.91
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.91
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 0.91
COG3915Uncharacterized conserved proteinFunction unknown [S] 0.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.36 %
UnclassifiedrootN/A3.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886007|SwRhRL2b_contig_1005107All Organisms → cellular organisms → Bacteria1471Open in IMG/M
3300000559|F14TC_100577850All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1341Open in IMG/M
3300000955|JGI1027J12803_100510690All Organisms → cellular organisms → Bacteria → Acidobacteria1014Open in IMG/M
3300000955|JGI1027J12803_104655341All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis564Open in IMG/M
3300002245|JGIcombinedJ26739_100257619All Organisms → cellular organisms → Bacteria1632Open in IMG/M
3300002245|JGIcombinedJ26739_100476766All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300003505|JGIcombinedJ51221_10003877All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4340Open in IMG/M
3300005093|Ga0062594_102750232All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300005177|Ga0066690_10598029All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium737Open in IMG/M
3300005293|Ga0065715_10305012All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300005332|Ga0066388_101241976All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300005336|Ga0070680_100982462All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300005341|Ga0070691_11098451Not Available501Open in IMG/M
3300005343|Ga0070687_100570815All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300005406|Ga0070703_10080857All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis1107Open in IMG/M
3300005444|Ga0070694_101331930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis604Open in IMG/M
3300005445|Ga0070708_100382839All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300005459|Ga0068867_101947282All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005518|Ga0070699_100549116All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300005538|Ga0070731_10293809All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1079Open in IMG/M
3300005544|Ga0070686_100194744All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300005552|Ga0066701_10837641All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300005553|Ga0066695_10608978All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300005563|Ga0068855_100246366All Organisms → cellular organisms → Bacteria1995Open in IMG/M
3300005602|Ga0070762_10494733All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300005713|Ga0066905_100172552All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1585Open in IMG/M
3300005921|Ga0070766_10866154All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300006050|Ga0075028_100001345All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8962Open in IMG/M
3300006354|Ga0075021_10004089All Organisms → cellular organisms → Bacteria7655Open in IMG/M
3300006794|Ga0066658_10470257All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300006797|Ga0066659_10156861All Organisms → cellular organisms → Bacteria1624Open in IMG/M
3300006797|Ga0066659_10624470All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis876Open in IMG/M
3300006844|Ga0075428_100902058All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300006847|Ga0075431_101119620All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300006852|Ga0075433_10305528All Organisms → cellular organisms → Bacteria1408Open in IMG/M
3300006852|Ga0075433_11676886All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis548Open in IMG/M
3300006893|Ga0073928_10171746All Organisms → cellular organisms → Bacteria1726Open in IMG/M
3300006904|Ga0075424_100628628All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300006969|Ga0075419_10142146All Organisms → cellular organisms → Bacteria1565Open in IMG/M
3300007788|Ga0099795_10539572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis548Open in IMG/M
3300009094|Ga0111539_11479969All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis787Open in IMG/M
3300009147|Ga0114129_10640798All Organisms → cellular organisms → Bacteria → Acidobacteria1372Open in IMG/M
3300009147|Ga0114129_10932088All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300009148|Ga0105243_11492466All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300009156|Ga0111538_10627626All Organisms → cellular organisms → Bacteria1363Open in IMG/M
3300009176|Ga0105242_12394750All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300009553|Ga0105249_10318358All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300010043|Ga0126380_10071294All Organisms → cellular organisms → Bacteria1973Open in IMG/M
3300010400|Ga0134122_10130612All Organisms → cellular organisms → Bacteria2023Open in IMG/M
3300010401|Ga0134121_10206447All Organisms → cellular organisms → Bacteria1701Open in IMG/M
3300012203|Ga0137399_11158482All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis651Open in IMG/M
3300012208|Ga0137376_11766987Not Available509Open in IMG/M
3300012361|Ga0137360_11508357All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis576Open in IMG/M
3300012918|Ga0137396_10427413All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae982Open in IMG/M
3300012923|Ga0137359_10130762All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis2231Open in IMG/M
3300012923|Ga0137359_11650444All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis528Open in IMG/M
3300012923|Ga0137359_11730162All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012930|Ga0137407_12435785All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis500Open in IMG/M
3300012957|Ga0164303_11250770All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300012977|Ga0134087_10617035All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis564Open in IMG/M
3300012985|Ga0164308_10557071All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300013297|Ga0157378_11726221All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300013308|Ga0157375_12167330All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300015374|Ga0132255_100517058All Organisms → cellular organisms → Bacteria1756Open in IMG/M
3300015374|Ga0132255_102346266All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium814Open in IMG/M
3300018061|Ga0184619_10163779All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300019882|Ga0193713_1043265All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300019883|Ga0193725_1081857All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis784Open in IMG/M
3300020140|Ga0179590_1164584All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300020579|Ga0210407_10127959All Organisms → cellular organisms → Bacteria1946Open in IMG/M
3300020580|Ga0210403_10254680All Organisms → cellular organisms → Bacteria1440Open in IMG/M
3300020581|Ga0210399_10439807All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1086Open in IMG/M
3300020583|Ga0210401_10097235All Organisms → cellular organisms → Bacteria2766Open in IMG/M
3300021168|Ga0210406_11074576All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis594Open in IMG/M
3300021170|Ga0210400_11274345Not Available590Open in IMG/M
3300021178|Ga0210408_10875443All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis700Open in IMG/M
3300021180|Ga0210396_10004097All Organisms → cellular organisms → Bacteria14296Open in IMG/M
3300021344|Ga0193719_10457080All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300021405|Ga0210387_10010774All Organisms → cellular organisms → Bacteria7029Open in IMG/M
3300021405|Ga0210387_11679502Not Available538Open in IMG/M
3300021432|Ga0210384_10031727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4930Open in IMG/M
3300022525|Ga0242656_1020105All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300022724|Ga0242665_10298966All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300024330|Ga0137417_1416050All Organisms → cellular organisms → Bacteria → Acidobacteria2333Open in IMG/M
3300025885|Ga0207653_10200114All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300025900|Ga0207710_10122481All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300025910|Ga0207684_10107247All Organisms → cellular organisms → Bacteria2390Open in IMG/M
3300025930|Ga0207701_10638206All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300025932|Ga0207690_10678116All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis846Open in IMG/M
3300025935|Ga0207709_10286207All Organisms → cellular organisms → Bacteria1219Open in IMG/M
3300025949|Ga0207667_11206961All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300025961|Ga0207712_11407941All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300026089|Ga0207648_10631431All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300026118|Ga0207675_100048522All Organisms → cellular organisms → Bacteria3963Open in IMG/M
3300026118|Ga0207675_100565262All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300026285|Ga0209438_1004544All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis4704Open in IMG/M
3300026555|Ga0179593_1243500All Organisms → cellular organisms → Bacteria2291Open in IMG/M
3300027681|Ga0208991_1010744All Organisms → cellular organisms → Bacteria2738Open in IMG/M
3300027873|Ga0209814_10005044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5016Open in IMG/M
3300027889|Ga0209380_10097211All Organisms → cellular organisms → Bacteria1699Open in IMG/M
3300031057|Ga0170834_104928000All Organisms → cellular organisms → Bacteria1309Open in IMG/M
3300031543|Ga0318516_10179635All Organisms → cellular organisms → Bacteria1219Open in IMG/M
3300031715|Ga0307476_10367645All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300031718|Ga0307474_10015173All Organisms → cellular organisms → Bacteria → Proteobacteria5578Open in IMG/M
3300031724|Ga0318500_10307127All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300031782|Ga0318552_10156522All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300031890|Ga0306925_10160472All Organisms → cellular organisms → Bacteria2421Open in IMG/M
3300032179|Ga0310889_10316272All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis757Open in IMG/M
3300032180|Ga0307471_100215105All Organisms → cellular organisms → Bacteria1939Open in IMG/M
3300033290|Ga0318519_10872211All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.45%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.91%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.27%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.55%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.73%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.82%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.82%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.82%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.82%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.91%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.91%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.91%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886007Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300022525Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SwRhRL2b_0710.000068102162886007Switchgrass RhizosphereMNYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNGNTQG
F14TC_10057785033300000559SoilMSYGVAESELLTEDTVLRRVQEAMSYKLRIGLDVNKEVNGNP*
JGI1027J12803_10051069023300000955SoilMSYGVAKSELLREGNCAEAVQEAMSYKFRTRLDVSKEVTGNG*
JGI1027J12803_10465534123300000955SoilMNYGVTESEVSTEDTVLRRVQRAISYKVRTGLDVNKEVNGNTQG*
JGIcombinedJ26739_10025761933300002245Forest SoilMRVRMSYGVAESELLTEDTVLRRVQEAMSCKFRTKLEVNNEVKR*
JGIcombinedJ26739_10047676623300002245Forest SoilMSYGVAESELLTEDTVLRRVQEAMSCKFRTKLEVNNEVKR*
JGIcombinedJ51221_1000387713300003505Forest SoilMSYGLAESQLLMEGTVLRRVQGALLQIPDRGLDVSKEVNGNL
Ga0062594_10275023213300005093SoilMSYGVAESELLTEDTVLRRVQGAMSYKFRTGLDVNKEVNGNP*
Ga0066690_1059802923300005177SoilMSRGVADSELLTDDTVLTVQGALSYKFRTGLDVNKEVNGNP*
Ga0065715_1030501213300005293Miscanthus RhizosphereMSYGVAASEVLMEDTVLRRLQRAMSYKFRTGVDVNKEVNGNA*
Ga0066388_10124197623300005332Tropical Forest SoilMSNGVAESELLTEDTVLRRVQGAMSYKFRTELHVYKEVNGNP*
Ga0070680_10098246213300005336Corn RhizosphereMSYGVAGSELLTENTVLRRVQGAMSYKFRIGLDVNKELKGNAWE*
Ga0070691_1109845113300005341Corn, Switchgrass And Miscanthus RhizosphereMSYGVAESELSTENTVLRRVQGAMSYKFRTRLDVNKEVNGNS*
Ga0070687_10057081513300005343Switchgrass RhizosphereYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNGNTQG*
Ga0070703_1008085723300005406Corn, Switchgrass And Miscanthus RhizosphereMNYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNGNTQG*
Ga0070694_10133193013300005444Corn, Switchgrass And Miscanthus RhizosphereMSYGLAESELLTEDAVLRRVQGAMSHKFRTRLDVNKEVKGNP*
Ga0070708_10038283933300005445Corn, Switchgrass And Miscanthus RhizosphereRQREFRMNYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNGNTQG*
Ga0068867_10194728223300005459Miscanthus RhizosphereMNYGLTESEGSTEGAVLRRVQGAISYKVPTGLDVNNVVNGNTQG*
Ga0070699_10054911613300005518Corn, Switchgrass And Miscanthus RhizosphereMSYGVAQPQLLTEDTVLRPAQGAMSYKFRTRLDVNKEVNG
Ga0070731_1029380943300005538Surface SoilMSDCVAESELLTEDKGLRLAQGALSYKLGTGLDANQQVSGNL*
Ga0070686_10019474413300005544Switchgrass RhizosphereMSYAVAESELLTKDKAVRRVQGAMSYKFRTGLDVNKEVNGNP*
Ga0066701_1083764133300005552SoilMSYGVAESDLLTEDTVLRRVQGALNYKFRTGLDVNKEVNGN
Ga0066695_1060897823300005553SoilMSYGVAESELFTEDRVLRGVQGAMSYKFRTRLDVNKEVNGNP*
Ga0068855_10024636613300005563Corn RhizosphereSEVLMEDTVLRRLQRAMSYKFRTGVDVNKEVNGNA*
Ga0070762_1049473323300005602SoilMSYGVAESDPLTEDIVLRQVQGAMSYKVRTGMDFNLHFNREVSATHES*
Ga0066905_10017255223300005713Tropical Forest SoilMSYGVAESELLTEDTVLRRVQGAMSYKFRTELHVNKEVNGNP*
Ga0070766_1086615413300005921SoilMSYGVTESELLTEDTVLRRVQGALSYEFRTGLDVNKEVNGNP*
Ga0075028_10000134543300006050WatershedsMSYGVAESELLAKDAVLRRMQGAMGYKFWTGVDVNNKVKGER*
Ga0075021_1000408933300006354WatershedsMSYGVAESELLAKDAVLRRMQRAMGYKFWTEVDVNNKVKGEP*
Ga0066658_1047025723300006794SoilMSYSVAESELLTGDTVLRWVQGAMSYKFRTRLDVNKEVNGNP*
Ga0066659_1015686123300006797SoilMSYGVAESELLTEDRVLRRVQGAMSYKFRTRLDVNKEVNGNP*
Ga0066659_1062447013300006797SoilMLPERESDLLTEDTVLRRVQGALNYKFRTGLDVNKEVNGNSLE*
Ga0075428_10090205823300006844Populus RhizosphereMSYGVAESELLTEDTVLRRVQGAMSYKFPTGLEVNKEVNGNP*
Ga0075431_10111962023300006847Populus RhizosphereMSYGMAESELLTEDTVLRRVRGAMSYKFRTQLDVNKEVNGNP*
Ga0075433_1030552813300006852Populus RhizosphereLEGTATRVRMSYRVVESELLMKDTVLRRVQEAMSYKFRTRLDVNKEVNGNP*
Ga0075433_1167688613300006852Populus RhizosphereMSYGVAESELSTEDTVLRRMRGAMSYKFRTELDVNKEVNG
Ga0073928_1017174623300006893Iron-Sulfur Acid SpringMSYGEAESELLTEDPVLRRVRGAMSYKFRTGLDVNKEVNGNP*
Ga0075424_10062862823300006904Populus RhizosphereMSYGVAESELSTEDTVLRRMRGAMSYKFRTELDVNKEVNGNS*
Ga0075419_1014214643300006969Populus RhizosphereMSYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNGNTQG*
Ga0099795_1053957223300007788Vadose Zone SoilMSYGVAESELLTDDTVLRRVQGAMSYKFRTRLDVNKEVNGNP*
Ga0111539_1147996923300009094Populus RhizosphereMSCGVAESELLTEDTVLRRVRGAMSYKFRTQLDVNKEVNGNP*
Ga0114129_1064079843300009147Populus RhizosphereMNYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVV
Ga0114129_1093208833300009147Populus RhizosphereFRMNYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNGNTQG*
Ga0105243_1149246613300009148Miscanthus RhizosphereNYGLTESEVSTECVVLRRVQGAISYKVLTGLDVNNVVNGNTQG*
Ga0111538_1062762613300009156Populus RhizosphereSTKGAVLRRVQEAISYKVLTGLDVNHVVNGNTQG*
Ga0105242_1239475023300009176Miscanthus RhizosphereMSYGVEESELLAEDTVLRWVQGAMSYKFRTRLDIKKEVNGNS*
Ga0105249_1031835843300009553Switchgrass RhizosphereMNYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNGNTRG*
Ga0126380_1007129443300010043Tropical Forest SoilMSYGVAESELLTENTVLRRVQGAMSYKFRTELHVNKEVNGNP*
Ga0134122_1013061243300010400Terrestrial SoilMNDGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNGNTQG*
Ga0134121_1020644733300010401Terrestrial SoilMNYGLTESEVSTEGAVLRRVQEAISYKVLTGLDVNNVVNGNTQG*
Ga0137399_1115848223300012203Vadose Zone SoilMSYGVAESELLTEDTLLRRVQGAMSYKFRTGMDVNNEVKGEP*
Ga0137376_1176698723300012208Vadose Zone SoilMGYDVAASELLTEDTVLRRVQGAMSYKSRTRLDVNKEVNGNP*
Ga0137360_1150835723300012361Vadose Zone SoilMSYGVAESELLTEDTVLMRVQGAMSYKFRTRLDVNKEVNGNP*
Ga0137396_1042741333300012918Vadose Zone SoilMSYGVAESELLTGETVLRRVQGAMSYKFRTRLDVN
Ga0137359_1013076243300012923Vadose Zone SoilMSYSVAESELLTGDTVLRWVQGAMSYKFRTWLDVNKEVNGIP*
Ga0137359_1165044413300012923Vadose Zone SoilMSYGAAESELLTEDTALRRVQGAMSYKFRTRLDVNKEVNGNP*
Ga0137359_1173016213300012923Vadose Zone SoilMSYGVAESELLTEETVLRRVQGAISYECRTELDFNNELKGDR*
Ga0137407_1243578513300012930Vadose Zone SoilMSNGVAESELLTEDTVLRRVQGAMSYKFRTRLDVNKEVSGNP*
Ga0164303_1125077023300012957SoilMSYGVAESELLTEDTVLRRVQEAMSYKFPTGLDVNREVNGNP*
Ga0134087_1061703523300012977Grasslands SoilMSYGVAESELLTEDRVLRRVQGAMSYKFRTRLDVNKEVNG
Ga0164308_1055707123300012985SoilMNYGLTESEVSTEGAVLKRVQGAIRYKVLTGLDVNNVVNGNTQE*
Ga0157378_1172622123300013297Miscanthus RhizosphereMNYGVTESEVSTEGAVLRWVQGAISYKVLTGLDVNNVVNGNTQG*
Ga0157375_1216733013300013308Miscanthus RhizosphereMSYGVAASEVLMEDTVLRRPQRAMSYKFRTGVDVNKEVNGNA*
Ga0132255_10051705843300015374Arabidopsis RhizosphereMNYGVTESEVSTEGAVLRRVQGAISCKILTGLDVNNVVNGNTQG*
Ga0132255_10234626613300015374Arabidopsis RhizosphereMNYGLTESEVSTEGAVLRRVQGAVSYKVLTGLDVNNVVNGNTQG*
Ga0184619_1016377923300018061Groundwater SedimentMSYGVAESELLTEDTVMRRVQGAMSYKFRTRLDVNKEVNGNP
Ga0193713_104326513300019882SoilVYNRVRMSYGVAESELLTEDTVLRRVQGAMSYKFRTRLEVNKEVNGNP
Ga0193725_108185723300019883SoilMRVRMTYGVAESELLTEDTVLRRVQGAMSYKFRTRLDVNKEVNGNP
Ga0179590_116458423300020140Vadose Zone SoilMSYGVAESELLAEDTVLRRVQGAMSYKFRTRLDVNKEVNGNP
Ga0210407_1012795923300020579SoilMSYGVAESELLTENTVLRRVQGAMSYKFRIGLDVNKEVYGNA
Ga0210403_1025468033300020580SoilMSYGVAKSEWLTEDTVLRRMQGAMSYKFRIELDANNEVKGNS
Ga0210399_1043980733300020581SoilMSYGVAESELLAKDAVLRRMQRAMGYKFWTEVDVNNKVKGEP
Ga0210401_1009723523300020583SoilMSYGVTELELLTEDAVLRRVQGVVMSYKFRTGLDANNELKGSQ
Ga0210406_1107457623300021168SoilMSYGVAESELLAKDAVLRRMQGAMGYKFWTGVDINNKVKGEP
Ga0210400_1127434523300021170SoilMSYGVAESELLAKDAVLRRMQGAMGYKFWTGVDVNNKVKGEP
Ga0210408_1087544313300021178SoilMIYGVAESDLLTEDTVLRRVQGAMSYKVRTGMDFNLYFNRKVNGNP
Ga0210396_1000409743300021180SoilMSYGVAESELLTEDTVLRRVQRAMSYKFRTGLDVNKEVNSNP
Ga0193719_1045708023300021344SoilMSYGVAESELLTEDTVMRRVQGTMSYKLRTRPDVNKEVNGNP
Ga0210387_1001077453300021405SoilMSYGAAESELLTDNTTLKRVQGAMSYKFRRGLDVNKEVNGKS
Ga0210387_1167950213300021405SoilMSHGVAESELSTGDRVPRRVQGAIIYKFRAGLEVNKEVNGNP
Ga0210384_1003172763300021432SoilMSYGIAESESLTEDTVLRRMQGAMSYKFRTRPDVDNELGINQ
Ga0242656_102010523300022525SoilSELLIEAIVLRRMQGAMSYKFRTGLDVNNELKGNQ
Ga0242665_1029896613300022724SoilSELLTENTVLRRVQGAMSYKFRIGLDVNKEVYGNA
Ga0137417_141605053300024330Vadose Zone SoilMSYGVAESELFTEDTVLRRMQERMSHKFRTRPDVNKEVNGSP
Ga0207653_1020011423300025885Corn, Switchgrass And Miscanthus RhizosphereMNYGLTESEVSTEGAVLRRVQEAIGYKVLTGLDVNNVVNGNTQG
Ga0207710_1012248123300025900Switchgrass RhizosphereMSYGVAASEVLMEDTVLRRLQRAMSYKFRTGVDVNKEVNGNA
Ga0207684_1010724723300025910Corn, Switchgrass And Miscanthus RhizosphereMSYGVAESELLTEDRVLRRVQGAMSYKFRTRLDVNKEVNGNP
Ga0207701_1063820623300025930Corn, Switchgrass And Miscanthus RhizosphereMSYGVAESELLTEDTVLRRVQGAMSYKFRTGLDVNKEVNGNP
Ga0207690_1067811623300025932Corn RhizosphereMSYGVAASEVLMEDTVLRRLQRAMSYKFRTGLDVNKEVSGNS
Ga0207709_1028620733300025935Miscanthus RhizosphereESEVSTECVVLRRVQGAISYKVLTGLDVNNVVNGNTQG
Ga0207667_1120696123300025949Corn RhizosphereVAASEVLMEDTVLRRLQRAMSYKFRTGVDVNKEVNGNA
Ga0207712_1140794113300025961Switchgrass RhizosphereMNYGLTESEVSTEGAVLKRVQGAICYKVLTGLDVNNVVNGNTRG
Ga0207648_1063143123300026089Miscanthus RhizosphereMSYGVIESELLTEDTVLRRVQGAISYKVPTGLDVNNVVNGNTQG
Ga0207675_10004852233300026118Switchgrass RhizosphereMSYGVGESEWLTEDTVLRRVQGAMSYKFRRRLEVNKEVNGNPWE
Ga0207675_10056526223300026118Switchgrass RhizosphereMNYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNANTQG
Ga0209438_100454473300026285Grasslands SoilMSYGVAGSELLTEDIVLRRVQGAMSYKFRTRLDVNKEVNGNP
Ga0179593_124350023300026555Vadose Zone SoilMSYGVAESELLAKDAVLRRMQGAMGYKFWTEVDVNNKVKGEP
Ga0208991_101074433300027681Forest SoilMSYGVAESELLTEGTVLRRVQEAMSYKFRRRLDVNKEVNGNP
Ga0209814_1000504413300027873Populus RhizosphereMNYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVKNVVNGNTQG
Ga0209380_1009721123300027889SoilMSYGLAESELLTEDTVLRRVQGALSYEFRTGLDVNKEVNGNP
Ga0170834_10492800023300031057Forest SoilMSYRVAESKLLMEDTVQRRVPGALSYKFLTGPDVNKEVSGNL
Ga0318516_1017963533300031543SoilMSYGMAESELPTEDTALRRVQGAMSYRFRTRLDVNKEVNGNP
Ga0307476_1036764523300031715Hardwood Forest SoilMSCGAAEPELLTEDSALRRVRGAMSYKFPTGADSNKEVSGNP
Ga0307474_1001517333300031718Hardwood Forest SoilMNYGVAESELLTEDAVLRRVQGAMSYKFPTGLDVNKEVNGNP
Ga0318500_1030712713300031724SoilMSYGVAESELLTEDTVLRRVRGGMSYKFRTLLDVNEEVNGNP
Ga0318552_1015652213300031782SoilLEGTTTRVGMSYGMAESELPTEDTALRRVQGAMSYRFRTRLDVNKEVNGNP
Ga0306925_1016047243300031890SoilSELPTEDTALRRVQGAMSYRFRTRLDVNKEVNGNP
Ga0310889_1031627233300032179SoilMNYGVTDSEVSTEATVLRRVQGASSYKVRTGLDVKKD
Ga0307471_10021510533300032180Hardwood Forest SoilMSYGVAGSELLTENTVLRRVQGAMSYKFRIGLDVNKEVNGNA
Ga0318519_1087221113300033290SoilAESELLTEDTVLRRVRGGMSYKFRTLLDVNEEVNGNP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.