NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F087291

Metagenome Family F087291

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087291
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 48 residues
Representative Sequence IEAARVISSAFKSSMEIPLFQWSQVSIHPEWIPQIDAWFNRFEVGVNF
Number of Associated Samples 25
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.83 %
% of genes near scaffold ends (potentially truncated) 80.00 %
% of genes from short scaffolds (< 2000 bps) 64.55 %
Associated GOLD sequencing projects 25
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.273 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(61.818 % of family members)
Environment Ontology (ENVO) Unclassified
(99.091 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(93.636 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF13963Transpos_assoc 1.82
PF02992Transposase_21 1.82
PF13855LRR_8 0.91
PF08284RVP_2 0.91
PF14244Retrotran_gag_3 0.91
PF02493MORN 0.91
PF13952DUF4216 0.91
PF14223Retrotran_gag_2 0.91
PF03140DUF247 0.91
PF00232Glyco_hydro_1 0.91
PF00078RVT_1 0.91
PF13976gag_pre-integrs 0.91
PF00069Pkinase 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.64
COG2723Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidaseCarbohydrate transport and metabolism [G] 0.91
COG2849Antitoxin component YwqK of the YwqJK toxin-antitoxin moduleDefense mechanisms [V] 0.91
COG4642Uncharacterized conserved proteinFunction unknown [S] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.27 %
UnclassifiedrootN/A2.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006353|Ga0075370_10215405All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1134Open in IMG/M
3300028786|Ga0307517_10001685All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus36504Open in IMG/M
3300028786|Ga0307517_10017411All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus9370Open in IMG/M
3300028794|Ga0307515_10608357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica703Open in IMG/M
3300028794|Ga0307515_10659889All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica659Open in IMG/M
3300028794|Ga0307515_10845067All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus541Open in IMG/M
3300028794|Ga0307515_10853137All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides537Open in IMG/M
3300030521|Ga0307511_10072361All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2504Open in IMG/M
3300030521|Ga0307511_10327729All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica672Open in IMG/M
3300030521|Ga0307511_10347383All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica639Open in IMG/M
3300030522|Ga0307512_10144415All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1444Open in IMG/M
3300030522|Ga0307512_10251701All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica879Open in IMG/M
3300030522|Ga0307512_10255448All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica867Open in IMG/M
3300030522|Ga0307512_10256240All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica865Open in IMG/M
3300030522|Ga0307512_10299859All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus749Open in IMG/M
3300030522|Ga0307512_10399140All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus578Open in IMG/M
3300031456|Ga0307513_10206870All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1797Open in IMG/M
3300031456|Ga0307513_10499798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica933Open in IMG/M
3300031456|Ga0307513_10564469All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus849Open in IMG/M
3300031456|Ga0307513_10949305All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides568Open in IMG/M
3300031507|Ga0307509_10008840All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max12727Open in IMG/M
3300031507|Ga0307509_10045698All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4719Open in IMG/M
3300031507|Ga0307509_10095095All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides3036Open in IMG/M
3300031507|Ga0307509_10392517All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1097Open in IMG/M
3300031507|Ga0307509_10701585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica678Open in IMG/M
3300031507|Ga0307509_10939169All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica530Open in IMG/M
3300031507|Ga0307509_10971829All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides515Open in IMG/M
3300031507|Ga0307509_10992240All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica506Open in IMG/M
3300031616|Ga0307508_10021500All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5867Open in IMG/M
3300031616|Ga0307508_10059746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba3371Open in IMG/M
3300031616|Ga0307508_10062951All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3273Open in IMG/M
3300031616|Ga0307508_10183728All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae1693Open in IMG/M
3300031616|Ga0307508_10205435All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1570Open in IMG/M
3300031616|Ga0307508_10268129All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1301Open in IMG/M
3300031616|Ga0307508_10413805All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides939Open in IMG/M
3300031616|Ga0307508_10588367All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica713Open in IMG/M
3300031616|Ga0307508_10650039All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica660Open in IMG/M
3300031616|Ga0307508_10672737All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica642Open in IMG/M
3300031649|Ga0307514_10004484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus12837Open in IMG/M
3300031730|Ga0307516_10125800All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides2348Open in IMG/M
3300031730|Ga0307516_10161632All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1989Open in IMG/M
3300031730|Ga0307516_10285868All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1329Open in IMG/M
3300031730|Ga0307516_10397160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1038Open in IMG/M
3300031730|Ga0307516_10409516All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1014Open in IMG/M
3300031730|Ga0307516_10786179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica612Open in IMG/M
3300031838|Ga0307518_10150259All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1612Open in IMG/M
3300031838|Ga0307518_10265880All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1075Open in IMG/M
3300031838|Ga0307518_10281867All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1027Open in IMG/M
3300031838|Ga0307518_10330694All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica902Open in IMG/M
3300031838|Ga0307518_10524555All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides598Open in IMG/M
3300032354|Ga0325403_1000538All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus27253Open in IMG/M
3300032354|Ga0325403_1006358All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta11235Open in IMG/M
3300032354|Ga0325403_1047571All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3081Open in IMG/M
3300032354|Ga0325403_1054179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2691Open in IMG/M
3300032354|Ga0325403_1081495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1621Open in IMG/M
3300032354|Ga0325403_1113628All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides968Open in IMG/M
3300032354|Ga0325403_1128172All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides811Open in IMG/M
3300032355|Ga0325401_1009518All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus9447Open in IMG/M
3300032355|Ga0325401_1030045All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4776Open in IMG/M
3300032355|Ga0325401_1146597All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica965Open in IMG/M
3300032355|Ga0325401_1193644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides688Open in IMG/M
3300032374|Ga0325400_1006246All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa11310Open in IMG/M
3300032374|Ga0325400_1061025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides2941Open in IMG/M
3300032374|Ga0325400_1113429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1662Open in IMG/M
3300032374|Ga0325400_1273252All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides636Open in IMG/M
3300032389|Ga0325405_1002767All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida18067Open in IMG/M
3300032389|Ga0325405_1015293All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica7068Open in IMG/M
3300032389|Ga0325405_1016043All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6859Open in IMG/M
3300032389|Ga0325405_1016852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba6646Open in IMG/M
3300032389|Ga0325405_1031724All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides4036Open in IMG/M
3300032389|Ga0325405_1054658All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2265Open in IMG/M
3300032389|Ga0325405_1065809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1740Open in IMG/M
3300032389|Ga0325405_1079761All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1260Open in IMG/M
3300032390|Ga0325404_1005909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida12870Open in IMG/M
3300032390|Ga0325404_1094112All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides871Open in IMG/M
3300032735|Ga0325410_1005996All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida13373Open in IMG/M
3300032735|Ga0325410_1052153All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2330Open in IMG/M
3300032740|Ga0325411_1009367All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida10476Open in IMG/M
3300032740|Ga0325411_1070385All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1349Open in IMG/M
3300032740|Ga0325411_1077758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1104Open in IMG/M
3300033179|Ga0307507_10179998All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1513Open in IMG/M
3300033179|Ga0307507_10209487All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1332Open in IMG/M
3300033179|Ga0307507_10256769All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1121Open in IMG/M
3300033179|Ga0307507_10265281All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides1091Open in IMG/M
3300033179|Ga0307507_10325714All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus921Open in IMG/M
3300033179|Ga0307507_10430879All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica736Open in IMG/M
3300033179|Ga0307507_10441645All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica722Open in IMG/M
3300033179|Ga0307507_10464047All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica694Open in IMG/M
3300033179|Ga0307507_10471189All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides686Open in IMG/M
3300033179|Ga0307507_10542651All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica615Open in IMG/M
3300033179|Ga0307507_10554950All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus604Open in IMG/M
3300033180|Ga0307510_10054694All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides4177Open in IMG/M
3300033180|Ga0307510_10073347All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3392Open in IMG/M
3300033180|Ga0307510_10098311Not Available2731Open in IMG/M
3300033180|Ga0307510_10101914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides2656Open in IMG/M
3300033180|Ga0307510_10399210All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus818Open in IMG/M
3300033180|Ga0307510_10409995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus797Open in IMG/M
3300033180|Ga0307510_10447624All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides732Open in IMG/M
3300033180|Ga0307510_10631942All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica526Open in IMG/M
3300034389|Ga0325419_012211All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides8718Open in IMG/M
3300034389|Ga0325419_030806Not Available4209Open in IMG/M
3300034688|Ga0325420_074994All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1610Open in IMG/M
3300034688|Ga0325420_120024All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides821Open in IMG/M
3300034819|Ga0373958_0158916All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica570Open in IMG/M
3300034899|Ga0325407_047754All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2686Open in IMG/M
3300034899|Ga0325407_097505All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica945Open in IMG/M
3300034899|Ga0325407_134936All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica568Open in IMG/M
3300034901|Ga0325409_017872All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba6625Open in IMG/M
3300034901|Ga0325409_050072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2490Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza61.82%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem31.82%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf4.55%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.91%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006353Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5Host-AssociatedOpen in IMG/M
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030522Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032735Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3Host-AssociatedOpen in IMG/M
3300032740Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M
3300034688Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1Host-AssociatedOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M
3300034899Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R4Host-AssociatedOpen in IMG/M
3300034901Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0075370_1021540523300006353Populus EndosphereMEIPLFQWSQVSKHPEWKPNIDAWFKRFQVGVNF*
Ga0307517_10001685333300028786EctomycorrhizaMFRFTNIEAARVISSAFKSSIEILLFQWSQVSRHPEWIPNIDAWFDKFEVDVNF
Ga0307517_1001741133300028786EctomycorrhizaMFTNIEATRVISSAFKSSMEIPLLQWSQVSRHLEWISQINTWFDRFEVGVNL
Ga0307515_1060835713300028794EctomycorrhizaSAFKSSMEIPLFQWSQISKHPEWMPQINAWFDRFEVGVNL
Ga0307515_1065988913300028794EctomycorrhizaEAARVITSKFKSLMEIPLFQWSQVSRNPEWKPYIDSWFKRFKVSVFNKF
Ga0307515_1084506723300028794EctomycorrhizaMFKSSMEIPLFQWSQVSRHPKWRPNIDAWFQQFHVSV
Ga0307515_1085313723300028794EctomycorrhizaTNIEAARIITLAFKSSMEIPLFQWSQVSRHLEWKPNIDAWFKRFQVGVNF
Ga0307511_1007236133300030521EctomycorrhizaMFTNIEAARVISSVFKSSMEIPLLQWSQVSRHLEWIPQINTWFDRFEVGVNL
Ga0307511_1032772913300030521EctomycorrhizaKFTNIEAARVISLAFKSSMEIPLFQWSQISKHPEWMPQINAWFDRFEVGVNL
Ga0307511_1034738323300030521EctomycorrhizaAARVISSAFKLLMEIPLFQWSQISKHPEWMPQINAWFGRFQVGVNL
Ga0307512_1014441513300030522EctomycorrhizaKAARVISSAFKSSMEIPLFQWSQISKHPEWMPQINAWFDRFEVGVNL
Ga0307512_1025170113300030522EctomycorrhizaIYRYTNIEAARVISSAFKSSMEILLFQWSQVSRHPEWIPQIDAWFDRFEVGVNF
Ga0307512_1025544823300030522EctomycorrhizaNIEAAQVISSAFKSSMEIPLFQWSQISKHPEWMPQINAWFDRFEVGVNL
Ga0307512_1025624013300030522EctomycorrhizaLAFKSSMEIPLFQWSQISKHPEWMPQINAWFDRFEVGVNL
Ga0307512_1029985913300030522EctomycorrhizaLVISLAFKSSMEIQLFQWSQISKHLKWMPQINAWFDRFEVGVNL
Ga0307512_1039914023300030522EctomycorrhizaMNLIYFQVHNIEAARVISSAFKSSMEIPLFQWSQVSRHPEWITQIDAWFSRFEIGVNF
Ga0307513_1020687013300031456EctomycorrhizaAFKSSMEIPLFQWSQISKHPEWMPQINAWFDRFQVGVNL
Ga0307513_1049979823300031456EctomycorrhizaVISSAFKSSMEILLFQWSQVSRHPEWIPQIDAWFDRFEVGVNF
Ga0307513_1056446923300031456EctomycorrhizaTFKSSMKIPLFQWSQVSRHPEWRPYIDAWFDKFEVGVNF
Ga0307513_1094930513300031456EctomycorrhizaNILLILFHFRFTNIEAARTITSAFKSSMEIPLFQWSQVSRHPEWRPNIDAWFQRFQFGVN
Ga0307509_1000884013300031507EctomycorrhizaSMEIPLFQWSQVSRHLEWIPQIDAWFDRFEVGVNL
Ga0307509_1004569813300031507EctomycorrhizaIEAARVISSAFKSSMEIPLFQWSQISKHPEWMPQINAWFGRF
Ga0307509_1009509553300031507EctomycorrhizaAKAITLAFKSSMEIPLFQKSQVSRHPEWKPNIDAWFKRFQVGVNF
Ga0307509_1039251733300031507EctomycorrhizaFTNIEAARVISSAFKSSMEIPLFQWSQISKHPEWMPQINAWFGRFQVGVNL
Ga0307509_1070158513300031507EctomycorrhizaNIEAARVISSAFKSSMEIPLFQWSQISKHPEWMPQINAWFDRFEVGVNL
Ga0307509_1093916913300031507EctomycorrhizaARVISSVFKSSMEIPLFQWSQISKHPEWMPQINAWFDKFEVGVNL
Ga0307509_1097182913300031507EctomycorrhizaFNFRFTNIEAARTITLAFKSSMEIPLFQWSQVSRHPEWKPNIDAWFKRFKVGVNF
Ga0307509_1099224013300031507EctomycorrhizaFTNIEAARVISSAFKSSMEIPLFQWSQISKHPEWMPQINAWFDRFEVGVNL
Ga0307508_1002150013300031616EctomycorrhizaFKSSMEIPLFQWSQVSRHPEWIPQINAWFDRFEVGVNF
Ga0307508_1005974643300031616EctomycorrhizaEVARTITSVFKSSMEIPLFQWSQVSRHPEWRPNIDAWFRRFQVGVNF
Ga0307508_1006295133300031616EctomycorrhizaFTNIEAARVISSVFKSSMEIPLFQWSQISKHPEWMPQINAWFDRFQVGVNL
Ga0307508_1018372833300031616EctomycorrhizaVRMGDDLGNCYVRAITLAFKASIEILLFQWSQVPEWKPNIDAWFKRFPVGVNF
Ga0307508_1020543513300031616EctomycorrhizaTFKSSMEILLFQWSQVSKHPDWRPYIDVWFRRFQIGVNF
Ga0307508_1026812913300031616EctomycorrhizaGDSIISMEIPLFQWSQVSRHPEWIPQIDAWFNKFEVDVNF
Ga0307508_1041380513300031616EctomycorrhizaLLLFNFRFTNIEAARAITLAFKSSMEIPLFQWSQVSRHLEWKPNIDAWFKRFQVGVNF
Ga0307508_1058836713300031616EctomycorrhizaIEAARVISSAFKSSMEIPLFQWSQVSIHPEWIPQIDAWFNRFEVGVNF
Ga0307508_1065003913300031616EctomycorrhizaVISSAFKSSMEIPLFQWSQISKHPEWIPQINAWFDRFEVGVNL
Ga0307508_1067273713300031616EctomycorrhizaSSAFKSSMEIPLFQWSQIFKHPELMPQINAWFDRFEVGVNL
Ga0307514_1000448473300031649EctomycorrhizaMFKSSMEILLFQWSQVSRHPEWIPQIDAWFDRFEVGVNFKFPAYF
Ga0307516_1012580033300031730EctomycorrhizaLMEIPLFQWTQVSKYPEWIQNIDAWFDKFEVGVNF
Ga0307516_1016163213300031730EctomycorrhizaLLLFNFRFTNIEAARAITLAFKSSMEIPLFQWSQVSKHPEWKPNIDAWFKRFQVGVSF
Ga0307516_1028586823300031730EctomycorrhizaINIEAARVISSAFKSSMEIPLFQWSQVSRHPEWIPQIDAWFNIFEVSVNF
Ga0307516_1039716013300031730EctomycorrhizaRFTNIEAARVISSAFKSSMEIPLFQWSQVSIHPKWIPQIDAWFNRFEVGVNF
Ga0307516_1040951613300031730EctomycorrhizaEILLFQWSQVSRHPEWIPQIDAWFDRFEVGVNFKFPAYF
Ga0307516_1078617913300031730EctomycorrhizaNIEAARVISSAFKSSMEIPLFQWSQVSKHPEWITQIDAWFNRFEVGVNF
Ga0307518_1015025913300031838EctomycorrhizaFNFRFTNIEAARAITLAFKSSMEIPLFQWSQVSKHPEWKPNIDAWFKIYQYWEIII
Ga0307518_1026588013300031838EctomycorrhizaFKSSMEIPLIQWSQVSRHPEWTPYNDAWFDKFEVGVNF
Ga0307518_1028186713300031838EctomycorrhizaVISSAFKSSMEILLFQWSQVSRHPKWIPQIDAWFDQFEVGVNL
Ga0307518_1033069423300031838EctomycorrhizaFKSSMEIPLIQWSQVSRHPEWTPYIDAWFDKFEVGVNF
Ga0307518_1052455513300031838EctomycorrhizaLLLLFNFRFTNIEAARTITLAFKSSMEIPLFQWSQVSKHPEWKPNIDAWFKRFQVGVNF
Ga0325403_1000538223300032354XylemTNIEATRVISSAFKSSMEIPLFQWSQISKHPEWMPQINAWFDRFQVGVNL
Ga0325403_100635833300032354XylemMFTNIKAARVISSAFKSSMKILLFQWSQVSRHPEWIPQIDAWFDRFEVELISNFQLISNN
Ga0325403_104757153300032354XylemFTNIEAARVISSAFKLSMEIPLFQWSQISKHPEWMPQINAWFDRFEVGVNL
Ga0325403_105417923300032354XylemMVTNIEAARVISSEFKSSMKILFFQWSQVSRHPEWISNMDAWFDKFDVSVNF
Ga0325403_108149513300032354XylemMFTNIEAARVISSAFKSPIEISLFQWSQVSRHPKWIPYIDAWFDKFKVGVNF
Ga0325403_111362813300032354XylemMNNKLILLILFNFRFTNIEAARTITLAFKSSMEIPLFQWSQVSRHPEWKPNIDAWFKRFQVGVNF
Ga0325403_112817213300032354XylemAARTITLAFKSSMEILLFQWSQVSKHPEWKPNIDAWFKRFQVSVNF
Ga0325401_100951823300032355XylemMVTNIEAARVISSEFKSSMKISFFQWSQVSRHPEWISNIDAWFDKFEVSVNF
Ga0325401_103004513300032355XylemRYTNIEAARVISSVFKSSVKIPLFQWSQVSRHPKWIPHIDAWFDRFEVGVNF
Ga0325401_114659723300032355XylemMNLIYFQVHKIEIARVISSTFKSLMEIQLFQCSQVSIHPEWITQIDAWFIIFEIGVNF
Ga0325401_119364413300032355XylemLAFKSSMEIPLFQWSQVSKHPEWKPNIDAWFKRFQVGVNF
Ga0325400_100624613300032374XylemTNIEAARTITMAMKSSMEIPLFQWSQVSRHPEWRPNIDAWFRQFQVGVNI
Ga0325400_106102513300032374XylemAARTITLAFKSSMEIPLFQWSQVSRHPEWKPNIDAWFKQFHVGVNF
Ga0325400_111342913300032374XylemAARTITLAFKSSMEIPLFQWSQVSKHPEWKPNIDAWFKRFQVGVNF
Ga0325400_127325213300032374XylemLVFKSSMEIPLFQWSQVSKHPEWKPNIDAWFKRFQVGVNF
Ga0325405_100276753300032389XylemMFTNIEAVRVISSAFKSSMEILLFQWSQVSRHPEWIPQIDAWFDRFEVGVNF
Ga0325405_101529313300032389XylemSMEIPLFQWSQISKHPEWMPQINAWFNRFEVDINL
Ga0325405_101604313300032389XylemARVISSAFKSSMEIPLFQWSQISKHPEWMPQINAWFNRFEVGINL
Ga0325405_101685263300032389XylemFISFIFRFTNIEAARVISSAFKSSMEIPLFQWSQISKHPEWIPQINAWFNRFEVGINL
Ga0325405_103172423300032389XylemMFTNIEAARTITLAFKSSMVIPLFQWSQVSKYPEWKPNIDAWFKRFQVGVNF
Ga0325405_105465823300032389XylemMVTNIEVARVISSEFKSSMKISFFQWSQVSRHPEWISNIDAWFDKFEVSVNF
Ga0325405_106580913300032389XylemFNFRFTNIEAARTITLAFKSSMEIPLFQWSQVSRHPEWKPNIDAWFRRFQVGVNF
Ga0325405_107976123300032389XylemMTIEFILFISRFTNIEAARVISLAFKSSMQISLFQWSQITKHPEWMPQINAWFDRFEVGVNL
Ga0325404_100590963300032390XylemVSNISLILFISRFTNIEAARVIPLVFKSLMEIPLFQWSQVSKHLDWRPYIDVWFQRFEVGVNF
Ga0325404_109411223300032390XylemIEAARTITLAFKSSMEIPLFQWSQVSKHPEWKPNIDAWFKRFQVGVNF
Ga0325410_100599613300032735XylemRTITLAFKSSMEIPLFQWSQVSRHPEWKPNIDAWFKRFQVGINF
Ga0325410_105215323300032735XylemVTNIEAARVISSVFKSSMEIPLFQWSQISKHPEWMPQINAWFGRFQVGVNL
Ga0325411_100936723300032740XylemMFTNIEATRVISSAFKSSIEIPLFQWSQISKHPEWMPQINAWFDKFEVGVNL
Ga0325411_107038513300032740XylemSMEIPLFQWSQISKHPEWMPQINAWFGRFQVGVNL
Ga0325411_107775813300032740XylemAFKSSMEIPLFQWSQISKHPEWMPQINAWFGRFQVGVNL
Ga0307507_1017999823300033179EctomycorrhizaFTNIEAARVISSAFKSSMEIPLFQWSQISKHPEWMPQINAWFDKFEVGINL
Ga0307507_1020948713300033179EctomycorrhizaFKSSMEIPLFQWSQVSRHPEWIPQIDACFDRFEVGVNF
Ga0307507_1025676913300033179EctomycorrhizaVARVISSAFKSSMEILLFQWSQVSRHPEWIPYIDAWFDKFEVDVNF
Ga0307507_1026528113300033179EctomycorrhizaIEAARAITLVFKSSMKIPLFHWSQVSKHPEWKPNIDAWFKRFQVGVSF
Ga0307507_1032571413300033179EctomycorrhizaNFRFTNIEAARVISSAFKSSMEIPLFQWSQISKHPEWMPQISAWFDRFEVGVNL
Ga0307507_1043087913300033179EctomycorrhizaSMKIPLFQWSQISKHPEWMPQINAWFDKFEVGVNL
Ga0307507_1044164513300033179EctomycorrhizaEAARVISSAFKSSMEIPLFQWSQVSRHPEWITQIDAWFNIFEVDVNF
Ga0307507_1046404713300033179EctomycorrhizaSAFKSSMEIPLFQWSQVSKHPEWITQIDAWFNRFEVGVNF
Ga0307507_1047118913300033179EctomycorrhizaRFTNIEAERAITLAFKSSMEIQLFQWSQVFKHPKWKPNINAWFKRFQVGVSFNFQLIFNK
Ga0307507_1054265113300033179EctomycorrhizaNIEAARVISSAFKSSMEIPLFQWSQISKHHEWMPQINAWFDIFEVSVNL
Ga0307507_1055495013300033179EctomycorrhizaILSAFKSSMEILLFQCGQVSRHPKWIPYIDTWFDRFEVGVNF
Ga0307510_1005469433300033180EctomycorrhizaFNFRFTNIEAARAITLTFKSSMEIPLFQWSQVSKHPEWKPNIDAWFKRFQVGVSF
Ga0307510_1007334713300033180EctomycorrhizaDVARVISLAFKSSMEIQLFQWSQISKYPEWMPQINAWFDKFEVGVNL
Ga0307510_1009831113300033180EctomycorrhizaMFKSSMEILLFQWSQVSRHPEWIPQIDAWFDRFEVGVN
Ga0307510_1010191413300033180EctomycorrhizaIEAARVISLVFKSLMEILLFQWSQVSRHPEWIPQIDAWFDRFEVDVNF
Ga0307510_1039921033300033180EctomycorrhizaEAARVISSAFKLSMEIPLFQWSQVSRHPEWRPQIDAWFDRFEVGVNF
Ga0307510_1040999513300033180EctomycorrhizaTIEFISFIFRFTNIEAARVISSAFKSSMEIPLFQWSQISKHPKWMPQINAWFDRFEVGVN
Ga0307510_1044762413300033180EctomycorrhizaIEAARTITLAFKSSMEIPLFQWSQVSRHPEWKPNIDAWFKRFKVGVNF
Ga0307510_1063194223300033180EctomycorrhizaSAFKSSMEIPLFQWSQVSRHPEWIPQIDAWFDRFEVGVNL
Ga0325419_006453_7041_72323300034389LeafMSNISLILFISRFTNIEAARVIPLVFKSLMEIPLFQWSQVSKHLDWRPYIDVWFQRFEVGVNF
Ga0325419_012211_8522_87163300034389LeafYEQIINFLLFNFRFTNIEAARTITMAMKSSMEIPLFQWSQVSRHPEWRPNIDAWFRRFQVGVNF
Ga0325419_030806_3731_38683300034389LeafMEIPSFQWSKVSRHPEWTPYIDAWFGKFEVGVNSNFQLILNKLLL
Ga0325420_074994_1485_16103300034688LeafSSAFKSSMEIPLFQWSQVSRHLEWIPQIDAWFDRFEVYVNL
Ga0325420_120024_676_8193300034688LeafTLAFKSSMEIPLFQWSQVSKHPEWKPNIDAWFKRFQVGVNFSFPAYF
Ga0373958_0158916_2_1483300034819Rhizosphere SoilIEAAQVISSAFKSSMEIPLFQWSQISKHPEWMPQINAWFDRFQVGVNL
Ga0325407_047754_1_1383300034899XylemARVISSAFKSLMEIPLFQWSQISKHPEWMPQINAWFGRFQVSVNL
Ga0325407_097505_823_9453300034899XylemSAFKSSMEIPLFQWSQISKHPEWMPQINAWFNRFEVGINL
Ga0325407_134936_2_1843300034899XylemIEFISFIFRFTNIEAARVISSAFKSSMEIPLFQWSQISKHPEKMPQINAWFNRFEVGINL
Ga0325409_017872_6469_66243300034901XylemFTNIEAARVISSAFKSSMEIPLFQWSQISKHPEWMPQINAWFNRFEVGINL
Ga0325409_050072_849_10073300034901XylemMFTNIKAARVISSAFKSSMEIPLFQWSQVSRHLEWIPQIDAWFDRFEVYVNL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.