 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F087302 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKDKRTYTNLKEHGEDMSHENESKITNEDRGPLDLTLL |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.27 % |
| % of genes from short scaffolds (< 2000 bps) | 98.18 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (79.091 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (40.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (80.909 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.09% β-sheet: 0.00% Coil/Unstructured: 90.91% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF03592 | Terminase_2 | 56.36 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 56.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 79.09 % |
| All Organisms | root | All Organisms | 20.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 40.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 16.36% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.91% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 3.64% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.73% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 2.73% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.82% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 1.82% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.82% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.82% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.82% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.82% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.91% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.91% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.91% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.91% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.91% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.91% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.91% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.91% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.91% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.91% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000239 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 120m | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001853 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300024259 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MG | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026258 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 (SPAdes) | Environmental | Open in IMG/M |
| 3300027865 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21 | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300028414 | Seawater microbial communities from Monterey Bay, California, United States - 33D | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100714151 | 3300000115 | Marine | MKDKRTYTNLKEHGEDMSHENESKITNEARDPLAVTLLT |
| SI36aug09_120mDRAFT_10508841 | 3300000239 | Marine | MKDKRTYTKLKEHGEDMSHENESTITNEDRGPGDLTLLIE |
| JGI24006J15134_100868213 | 3300001450 | Marine | MKEKRTYTHLKEHGEDMTHENEFKVDLKEDRGQLD* |
| JGI24006J15134_102235521 | 3300001450 | Marine | MKDKRTYTNLKEHGEDMSHENESKITNEARDPLAVTLLTEQYRAD |
| JGI24003J15210_101584002 | 3300001460 | Marine | MKDKRTYTKLKEHGEDMTHENESKVDPKEDRGSLDLT |
| JGI24524J20080_10177841 | 3300001853 | Marine | MKEKRTYTHLKEHGEDMTHENEFKVDLKEDRGQLDLT |
| KVRMV2_1019237282 | 3300002231 | Marine Sediment | MKDKRTYNKLKEHGEDMTHENESTITNDDRGTGDLTYLIEM |
| Ga0068511_10478301 | 3300005057 | Marine Water | MKDKRTYTNLKEHGEDMTHENESKVDPKENRGSLDLTFMLEQHK |
| Ga0068511_10708991 | 3300005057 | Marine Water | MKDKRTYTHLKEHGEDMTHENESRVNVDPKYKSESNPSDLVF |
| Ga0066856_104524052 | 3300005404 | Marine | MKDKRTYTNIKEYGEDMSHENEASITSEPKEDRGSGDLTYLIEM |
| Ga0066861_102071732 | 3300005522 | Marine | MKDKRTYNKLKEHGEDMSHENESRIEPKDDRGPGDLTLLTEQY |
| Ga0070723_105928631 | 3300005612 | Marine Sediment | MKDKRTYTHLKEHGEDMTHENESKVDPKEDRGSLDLTFM |
| Ga0075478_100782441 | 3300006026 | Aqueous | MKDKRTYTNLKEHGEDMSHENESKITNEARDPLAVTLLTEQYRADL |
| Ga0068500_11727681 | 3300006332 | Marine | MKDKRTYNKLKEHGEDMTHENESKIDPKEDRGPLDITLLTEQYRAD |
| Ga0098037_11931601 | 3300006737 | Marine | MKDKRTYTHLKEHGEDMTHENESKITIDPNYKEDRGPGDLSLLVELHKKE |
| Ga0098058_11459922 | 3300006750 | Marine | MKDKRTYTNLKEHGEDMSHENEATITPEPKEDRGPLDLAFLIDKHKAEIW |
| Ga0098039_12863132 | 3300006753 | Marine | MKDKRTYTKLKEHGEDMSLENEVKITIDPNYKEDRGPNDLSLHIEKLQARIKQLEE |
| Ga0098044_13394202 | 3300006754 | Marine | MKDKRTYTNAKEHGEDMSHENEAKITNEPKEDRGSGDLTYLIE |
| Ga0098055_13871141 | 3300006793 | Marine | MKDKRTYTNKKEHGEDMSYENYTKITNEDRGPGDLT |
| Ga0070749_101598425 | 3300006802 | Aqueous | MKDKRTYTKLKEHGEDMSHENESKITNEDRGPLDLT |
| Ga0075476_103015491 | 3300006867 | Aqueous | MKDKRTYTNLKEHGEDMSHENESKITNEARDPLAVTLLTEQY |
| Ga0070748_13678692 | 3300006920 | Aqueous | MKDKRTYTKLKEHGEDMTHENESKITNEDRGPLDLTLL |
| Ga0098060_10953853 | 3300006921 | Marine | MKEKRTYTHLKEHGEDMTHENEFKVDLKEDRGQLDL |
| Ga0098045_11331711 | 3300006922 | Marine | MKDKRTYTKLKEHGEDMSHQNESKITNEVKEDRGPG |
| Ga0098053_10829721 | 3300006923 | Marine | MKDKRTYTNLKEYGEDMSHENEAKITNEDRGPGDLTLIAELHQKEIWE |
| Ga0098041_10979383 | 3300006928 | Marine | MKEKRTYTHLKEHGEDMTHENEFQVNIKEDRGQLDLTRQIDELK |
| Ga0098036_11736112 | 3300006929 | Marine | MKEKRTYTHLKEHGEDMTHENEFKVDLKEDRGQLDLTR |
| Ga0102853_10810162 | 3300007543 | Estuarine | MKDKRTYTKLKEHGEDMSHENESKITNEDRGPLDLTL |
| Ga0070751_13269062 | 3300007640 | Aqueous | MKDKRTYTNKKEHGEDMSHENESTITNNDRGPLDLTLLTEQ |
| Ga0102855_10817612 | 3300007647 | Estuarine | MKDKRTYTNLKEHGEDMSHENESKITNEARDPLAVTLLTEQYRADLKK |
| Ga0105737_10729193 | 3300007862 | Estuary Water | MKDKRTYTKLKEHGEDMTHENESKITNEDRGLLDLTLLT |
| Ga0110931_10990022 | 3300007963 | Marine | MKDKRTYTHLKEHGEDITHENEFKVSAKEDRGPLDLTKQIDGLK |
| Ga0114905_12251582 | 3300008219 | Deep Ocean | MKEKRTYTHLKEHGEDMTHENEFKVDLKEDRGQLDLTRQI |
| Ga0114916_10512593 | 3300008221 | Deep Ocean | MKDKRTYTNLKEHGEDMSHENESTITNEDRGPLDLTLLTEQYRADLKKYQD |
| Ga0115008_102835762 | 3300009436 | Marine | MKDKRTYTNLKEHGEDMSHENESKIINEARDPLAVTLLTEQYRADLKKYQ |
| Ga0114932_109257022 | 3300009481 | Deep Subsurface | MKDKRTYTKQKEHGEDMSHENERKHTNDGIKEDRGPLDITLLTEQY |
| Ga0115011_101991821 | 3300009593 | Marine | MKDKRTYTKLKEHGEDMSHENEAKIKHEAKEDRGPNDLT |
| Ga0114900_10571241 | 3300009602 | Deep Ocean | MKDKRTYTNAKEHGEDMSHENEAKIKSAPSKEDRGMGDLT |
| Ga0115012_117647632 | 3300009790 | Marine | MKDKRTYNNIKEYGEDMSYENDAKITNEPKEDRGPLDL |
| Ga0115012_117798721 | 3300009790 | Marine | MKDKRTYTNLKEHGEDMSHENEAKIKHEAKEDRGPGDLTLMA |
| Ga0098043_10713321 | 3300010148 | Marine | MKDKRTYTHLKEHGEDMTHENESKITIDSNYKEDRGPG |
| Ga0098061_10871252 | 3300010151 | Marine | MKDKRTYTKLKEHGEDMSHENEAKITNEVKEDRGPGDL |
| Ga0098047_102788072 | 3300010155 | Marine | MKDKRTYTNLKEYGEDMSHENEAKITNEVKEDRGPGDLTLMAELHQK |
| Ga0114934_101967961 | 3300011013 | Deep Subsurface | MKDKRTYTNAKEHGEDMSLENEVKITNEPKEDRGSLDLAFLI |
| Ga0114934_104609341 | 3300011013 | Deep Subsurface | MKDKRTYNNLKEHGEDMTYESERKHESDDRGELDLSLL |
| Ga0160422_105402152 | 3300012919 | Seawater | MKDKRTYTNAKEHGEDMSLENEINIKHEPKEDRGALDLTFLIE |
| Ga0163180_116273331 | 3300012952 | Seawater | MKDKRTYNKLKEHGEDMTHENESKVDPKEDRGPLDITLLTEQYKSDLNRYM |
| Ga0163179_119473132 | 3300012953 | Seawater | MKDKRTYTNIKEYGEDMSHENERKHTNENRGPGDLTYLIELH |
| Ga0129327_108717541 | 3300013010 | Freshwater To Marine Saline Gradient | MKDKRTYTKLKEHGEDMTHENESKITNEDRGPLDLT |
| Ga0181377_10197925 | 3300017706 | Marine | MKDKRTYTNLKEHGIDMTYENESKVDPKEDRGPGDLSLL |
| Ga0181369_10502511 | 3300017708 | Marine | MKEKRTYTHLKEHGEDMTHENEFKVDLKEDRGQLDLTRQIDE |
| Ga0181391_11313782 | 3300017713 | Seawater | MKDKRTYTNKKEHGEDMSHENESKITNEDRGPLDLTLLTEQYR |
| Ga0181391_11554231 | 3300017713 | Seawater | MKDKRTYTNLKEHGEDMSHENESKTNLSEDRDPGDLTLL |
| Ga0181404_11515771 | 3300017717 | Seawater | MKEKRTYTHLKEHGEDITHENEFQVNIKEDRGQLDL |
| Ga0181383_11514652 | 3300017720 | Seawater | MKDKRTYTHLKEHGEDMTHENESKITIDPNYRENRGPGDLSLLIE |
| Ga0181383_11729772 | 3300017720 | Seawater | MKDKRTYINKKEHGEDMSHENESKMTKDDRGPLDLTLLTEQYKADIKKYQDRETL |
| Ga0181373_10407721 | 3300017721 | Marine | MKDKRTYTHLKEHGEDMSHENESKITNEPKEDRGTLDLAFLIDEHKAEIWKYK |
| Ga0181373_10885472 | 3300017721 | Marine | MQDKRTYTHLKEHGEDMTHENEFKVDMKEDRGPLDLTKQIEDLHL |
| Ga0181388_11409761 | 3300017724 | Seawater | MKDKRTYTKLKEHGEDMTHENESKITIDPNYKEDRRPN |
| Ga0181428_11572892 | 3300017738 | Seawater | MKDKRTYTHLKEHGEDMTHENESKTKLSEDRGPGDLSLLVELHKK |
| Ga0181402_11398001 | 3300017743 | Seawater | MKDKRTYTHLKEHGEDMTHENESKVDPKEDRGPGDLSLLV |
| Ga0181393_11725191 | 3300017748 | Seawater | MKDKRTYTHLKEHGEDMSHENESKVDPKEDRGPGDLS |
| Ga0181392_11684211 | 3300017749 | Seawater | MKDKRTYTKLKEHGEDMSHENESKVKPREDRGALDLSFLI |
| Ga0181407_11132251 | 3300017753 | Seawater | MKDKRTYTNKKEHGEDMSHENESKITNEDRGPLDLTLLTEQYRADLKK |
| Ga0181411_10951223 | 3300017755 | Seawater | MKDKRTYINKKEHGEDMTHENESKMTKEDRGPLDLTLLTE |
| Ga0181409_10912403 | 3300017758 | Seawater | MKEKRTYTHLKEHGEDITHENEFKVDLKEDRGQLDLTRQ |
| Ga0181385_10899853 | 3300017764 | Seawater | MKEKRTYTHLKEHGEDMTHENEFKVDLKEDRGQLDLTRQMDELNSLLRSE |
| Ga0181406_11196712 | 3300017767 | Seawater | MKDKRTYTNKKEHGEDMTHENETKLTNEDRGPLDLTLLIEMHKKEIWEW |
| Ga0181425_11727181 | 3300017771 | Seawater | MKDKRTYTNKKEHGEDMTHENESKITNEDRGPLDITL |
| Ga0181394_11227051 | 3300017776 | Seawater | MKDKRTYTNAKEHGEDMSHENETKIKHEPKEDRGALDLTFLLEQHKKEI |
| Ga0181394_12372571 | 3300017776 | Seawater | MKDKRTYTKLKEHGEDMSHENESKITNEDRGPLDLTS |
| Ga0194029_10489582 | 3300019751 | Freshwater | MKDKRTYTNLKEHGEDMSHENESKIINEARDPLAVTLL |
| Ga0211576_104575432 | 3300020438 | Marine | MKEKRTYTHLKEHGEDMTHENEFKVDLKKDRGHLGLTRQIDELKQT |
| Ga0211518_103466311 | 3300020440 | Marine | MKDKRTYTHLKEHGEDMTHENESKVDPKEDRGPGDLSLL |
| Ga0211548_104259451 | 3300020454 | Marine | MKDKRTYNKLKEHGEDMSHENESKVDPKEDRGALDITLL |
| Ga0222717_102597583 | 3300021957 | Estuarine Water | MKEKRTYTHLKEHGEDMTHENEFKVDLKKGRGHLGLT |
| Ga0212020_10577091 | 3300022167 | Aqueous | MKDKRTYTKLKEHGEDMTHENESKITNEDRGPLDLTLLT |
| Ga0196887_10529701 | 3300022178 | Aqueous | MKDKRTYTHLKEHGEDMTHENESKITIDPNYREDR |
| Ga0196891_10350603 | 3300022183 | Aqueous | MKDKRTYTHLKEHGEDMTHENESKVDPKEDRGSLDLTFMIEQHK |
| Ga0196891_10451993 | 3300022183 | Aqueous | MKDKRTYTKLKEHGEDMTHENESKITNEDRGPLDLTLLTEQYRD |
| Ga0196891_10948311 | 3300022183 | Aqueous | MKDKRTYTKLKEHGEDMTHENESKITNEDRGPLDLTLLTEQYR |
| (restricted) Ga0233437_11496311 | 3300024259 | Seawater | MKDKRTYTKLKEHGEDMSHENESTITNEDRGALDLTFLIEQHKQ |
| Ga0207905_10621262 | 3300025048 | Marine | MKEKRTYTHLKEHGEDISHENEVKLEPREDRGQLDLTRQID |
| Ga0207896_10625702 | 3300025071 | Marine | MKDKRTYTHLKEHGEDMTHENESKITVDPNYKKDTN |
| Ga0208298_10634691 | 3300025084 | Marine | MKDKRTYTNLKEHGEDMSHENEAKITNEPKEERGTLDLTFLIE |
| Ga0208157_10496033 | 3300025086 | Marine | MKDKRTYTNAKEHGEDMSHENETKIKHEPKEDRGSL |
| Ga0208669_10369123 | 3300025099 | Marine | MKDKRTYKYEKEHGEDMSHENESTVKPSEDRGPGDLTLLTEQYK |
| Ga0208669_11009312 | 3300025099 | Marine | MKDKRTYTHLKEHGEDMTHENESKITIDPNYKEDRGPGDLS |
| Ga0208666_11110711 | 3300025102 | Marine | MKDKRTYTNAKEHGEDMSHENETKIKHEPKEDRGALDLTFLIEQHRKE |
| Ga0208013_10724551 | 3300025103 | Marine | MKDKRTYNNLKEHGEDMSHENEAKIKHEAKEDRGPLDITLLTEQYRRDLFKYQQKEA |
| Ga0208158_11055602 | 3300025110 | Marine | MKDKRTYTHKKEHGEDMSHENETKITNEDRGPLDLTLLIELHQNRKPTVW |
| Ga0209535_10361155 | 3300025120 | Marine | MKEKRTYTHLKEHGEDMTHENEFKIDIPEDRGTLDLSRQIDELRQ |
| Ga0209535_11737481 | 3300025120 | Marine | MKEKRTYTHLKEHGEDISHENEVKLEPREDRGQLDLTRQIDELKET |
| Ga0209336_101529912 | 3300025137 | Marine | MKDKRTYTHLKEHGEDISHENEVKLEPGEDRGQLDLTRQIDELKET |
| Ga0209634_12440172 | 3300025138 | Marine | MKDKRTYTHLKEHGEDITHENEFKVEMKEDRGPLD |
| Ga0209756_12604792 | 3300025141 | Marine | MKDKRTYKNIKEYGEDMSHENEAKIKHEAKEDRGPLDITLLTEQYKADLFKYQQKEAEYIKTK |
| Ga0209756_12880191 | 3300025141 | Marine | MKDKRTYTKLKEHGEDMTHENERKHSNEDRGGGDLTFL |
| Ga0208179_10699322 | 3300025267 | Deep Ocean | MKDKRTYTNAKEHGEDMSHENEAKIKSAPSKEDRGMGD |
| Ga0209194_10493171 | 3300025632 | Pelagic Marine | MKDKRTYTHLKEHGEDMTHENESKITVDPNYKKDTNPLAVTLLTEQYRADLKK |
| Ga0208425_10422541 | 3300025803 | Aqueous | MKDKRTYTHLKEHGEDMSHENESKVDPKEDRGPGD |
| Ga0209193_11383222 | 3300025816 | Pelagic Marine | MKDKRTYTHLKEHGEDMTHENESKTKLSDDRGPLDLTLLTEQYRSDLKKYQ |
| Ga0208644_11676683 | 3300025889 | Aqueous | MKDKRTYTHLKEHGEDMTHENESKITVDPNYKKDTNPLAVTLLTEQYRADL |
| Ga0208130_10623081 | 3300026258 | Marine | MKDKRTYTNAKEHGEDMSLENEVKIKHEPKEDRGPGDLSLLNEQHKAEIWEWK |
| (restricted) Ga0255052_104316152 | 3300027865 | Seawater | MKDKRTYTKLKEHGEDMSHENESTITNEDRGALDLTFLIEQHKQEIWEF |
| Ga0257110_12786871 | 3300028197 | Marine | MKDKRTYTNLKEHGEDMSHENESKITNEARDPLAV |
| Ga0228627_11299112 | 3300028414 | Seawater | MKEKRTYTHLKEHGEDITHENEFQVNIKEDRGQSDLTRQIDEL |
| Ga0307488_104199583 | 3300031519 | Sackhole Brine | MKDKRTYTNLKEHGEDMSHENESKITNEDRGPLDLTLL |
| Ga0310344_104371153 | 3300032006 | Seawater | MKDKRTYTKLKEHGEDMTHENERKHSNEDRGVGDLT |
| Ga0316203_10691371 | 3300032274 | Microbial Mat | MKDKRTYTHLKEHGEDISHENEVKLEPGEDRGQLDLTRQIDELK |
| Ga0316202_104534741 | 3300032277 | Microbial Mat | MKDKRTYTNKKEHGEDMSHENESKITNEDRGPLDLTLLTEQY |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |