Metagenome Family F087452

Basic Information
Family ID	F087452
Family Type	Metagenome
Number of Sequences	110
Average Sequence Length	44 residues
Representative Sequence	MPRWMRDKLTWIVVFAAIAAASSSYSAYKVYLMTDGKAVPTKGKR
Number of Associated Samples	93
Number of Associated Scaffolds	110

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	84.55 %
% of genes near scaffold ends (potentially truncated)	21.82 %
% of genes from short scaffolds (< 2000 bps)	84.55 %
Associated GOLD sequencing projects	87
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.50

Most Common Taxonomy
Group	Bacteria (60.909 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (13.636 % of family members)
Environment Ontology (ENVO)	Unclassified (30.909 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (59.091 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 42.47% β-sheet: 0.00% Coil/Unstructured: 57.53%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 110 Family Scaffolds
PF00571	CBS	10.00
PF06627	DUF1153	7.27
PF02557	VanY	6.36
PF13763	DUF4167	4.55
PF00072	Response_reg	3.64
PF04828	GFA	1.82
PF00691	OmpA	1.82
PF12802	MarR_2	0.91
PF00816	Histone_HNS	0.91
PF05598	DUF772	0.91
PF00156	Pribosyltran	0.91
PF08837	DUF1810	0.91
PF00005	ABC_tran	0.91
PF10503	Esterase_PHB	0.91
PF12599	DUF3768	0.91
PF14534	DUF4440	0.91
PF01255	Prenyltransf	0.91
PF01252	Peptidase_A8	0.91
PF05257	CHAP	0.91
PF08501	Shikimate_dh_N	0.91
PF04186	FxsA	0.91
PF05853	BKACE	0.91
PF02515	CoA_transf_3	0.91

COG ID	Name	Functional Category	% Frequency in 110 Family Scaffolds
COG1876	LD-carboxypeptidase LdcB, LAS superfamily	Cell wall/membrane/envelope biogenesis [M]	6.36
COG2173	D-alanyl-D-alanine dipeptidase	Cell wall/membrane/envelope biogenesis [M]	6.36
COG0597	Lipoprotein signal peptidase	Cell wall/membrane/envelope biogenesis [M]	1.82
COG3791	Uncharacterized conserved protein	Function unknown [S]	1.82
COG0020	Undecaprenyl pyrophosphate synthase	Lipid transport and metabolism [I]	0.91
COG0169	Shikimate 5-dehydrogenase	Amino acid transport and metabolism [E]	0.91
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	0.91
COG2916	DNA-binding protein H-NS	Transcription [K]	0.91
COG3030	FxsA protein affecting phage T7 exclusion by the F plasmid, UPF0716 family	General function prediction only [R]	0.91
COG3246	Uncharacterized conserved protein, DUF849 family	Function unknown [S]	0.91
COG5579	Uncharacterized conserved protein, DUF1810 family	Function unknown [S]	0.91

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	60.91 %
Unclassified	root	N/A	39.09 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	60.91 %
Unclassified	root	N/A	39.09 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	60.91 %
Unclassified	root	N/A	39.09 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	57.27 %
Unclassified	root	N/A	39.09 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	54.55 %
Unclassified	root	N/A	39.09 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.09 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	14.55 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	9.09 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.09 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	9.09 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	6.36 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.91 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.09 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	9.09 %
unclassified Hyphomicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae	2.73 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	1.82 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.91 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	39.09 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	9.09 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	2.73 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	1.82 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.91 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.91 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_101912407	All Organisms → cellular organisms → Bacteria → Proteobacteria	3248	Open in IMG/M
3300000550\|F24TB_13363563	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	597	Open in IMG/M
3300000787\|JGI11643J11755_11094398	Not Available	551	Open in IMG/M
3300000789\|JGI1027J11758_12523154	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	843	Open in IMG/M
3300000956\|JGI10216J12902_118874098	Not Available	641	Open in IMG/M
3300004114\|Ga0062593_101324836	Not Available	764	Open in IMG/M
3300004463\|Ga0063356_100445771	All Organisms → cellular organisms → Bacteria → Proteobacteria	1687	Open in IMG/M
3300004463\|Ga0063356_105270313	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	555	Open in IMG/M
3300004479\|Ga0062595_100931719	Not Available	736	Open in IMG/M
3300004479\|Ga0062595_102038121	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	556	Open in IMG/M
3300005093\|Ga0062594_102717348	Not Available	548	Open in IMG/M
3300005177\|Ga0066690_10671719	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	688	Open in IMG/M
3300005332\|Ga0066388_100136209	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	3011	Open in IMG/M
3300005334\|Ga0068869_100691381	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	869	Open in IMG/M
3300005353\|Ga0070669_100591061	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	929	Open in IMG/M
3300005367\|Ga0070667_102208066	Not Available	518	Open in IMG/M
3300005440\|Ga0070705_101634275	Not Available	543	Open in IMG/M
3300005441\|Ga0070700_100784774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	766	Open in IMG/M
3300005457\|Ga0070662_101259919	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	636	Open in IMG/M
3300005518\|Ga0070699_101975519	Not Available	533	Open in IMG/M
3300005564\|Ga0070664_101282008	Not Available	692	Open in IMG/M
3300005577\|Ga0068857_102091720	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	555	Open in IMG/M
3300005719\|Ga0068861_102152350	Not Available	558	Open in IMG/M
3300005764\|Ga0066903_100937927	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1572	Open in IMG/M
3300006038\|Ga0075365_10023721	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3861	Open in IMG/M
3300006038\|Ga0075365_10066411	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2420	Open in IMG/M
3300006042\|Ga0075368_10039619	All Organisms → cellular organisms → Bacteria → Proteobacteria	1848	Open in IMG/M
3300006046\|Ga0066652_100126617	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2106	Open in IMG/M
3300006046\|Ga0066652_100565099	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1067	Open in IMG/M
3300006046\|Ga0066652_100816195	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	891	Open in IMG/M
3300006051\|Ga0075364_10096263	Not Available	1968	Open in IMG/M
3300006177\|Ga0075362_10751405	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	511	Open in IMG/M
3300006178\|Ga0075367_10010957	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4778	Open in IMG/M
3300006196\|Ga0075422_10323847	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	666	Open in IMG/M
3300006353\|Ga0075370_10915103	Not Available	536	Open in IMG/M
3300006791\|Ga0066653_10094422	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1350	Open in IMG/M
3300006844\|Ga0075428_100027717	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6267	Open in IMG/M
3300006844\|Ga0075428_100544577	Not Available	1241	Open in IMG/M
3300006845\|Ga0075421_100000477	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	42013	Open in IMG/M
3300006846\|Ga0075430_101029260	Not Available	678	Open in IMG/M
3300006852\|Ga0075433_10141823	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2136	Open in IMG/M
3300006852\|Ga0075433_10169678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1942	Open in IMG/M
3300006852\|Ga0075433_10809250	All Organisms → cellular organisms → Bacteria	819	Open in IMG/M
3300006852\|Ga0075433_10947824	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	750	Open in IMG/M
3300006854\|Ga0075425_101698293	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	710	Open in IMG/M
3300007076\|Ga0075435_100606191	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	950	Open in IMG/M
3300009156\|Ga0111538_10150690	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2955	Open in IMG/M
3300009156\|Ga0111538_14113508	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300009162\|Ga0075423_11097825	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	847	Open in IMG/M
3300009176\|Ga0105242_12975670	Not Available	524	Open in IMG/M
3300009837\|Ga0105058_1184498	Not Available	517	Open in IMG/M
3300010038\|Ga0126315_10061349	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2071	Open in IMG/M
3300010044\|Ga0126310_11524798	Not Available	549	Open in IMG/M
3300010046\|Ga0126384_11608694	Not Available	612	Open in IMG/M
3300010366\|Ga0126379_12569401	Not Available	607	Open in IMG/M
3300010366\|Ga0126379_13227591	Not Available	546	Open in IMG/M
3300010397\|Ga0134124_12359620	Not Available	573	Open in IMG/M
3300010399\|Ga0134127_10319496	Not Available	1503	Open in IMG/M
3300010400\|Ga0134122_11143954	Not Available	775	Open in IMG/M
3300011119\|Ga0105246_10833442	Not Available	821	Open in IMG/M
3300011440\|Ga0137433_1012704	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	2484	Open in IMG/M
3300012081\|Ga0154003_1097417	Not Available	513	Open in IMG/M
3300012349\|Ga0137387_10783590	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	690	Open in IMG/M
3300012930\|Ga0137407_11053634	Not Available	771	Open in IMG/M
3300012944\|Ga0137410_10377305	Not Available	1139	Open in IMG/M
3300012948\|Ga0126375_10862375	All Organisms → cellular organisms → Bacteria	724	Open in IMG/M
3300012957\|Ga0164303_10451909	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	809	Open in IMG/M
3300012961\|Ga0164302_10109070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1549	Open in IMG/M
3300012987\|Ga0164307_10485336	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	930	Open in IMG/M
3300014325\|Ga0163163_13293545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	504	Open in IMG/M
3300014326\|Ga0157380_11598640	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	707	Open in IMG/M
3300014968\|Ga0157379_10726854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	933	Open in IMG/M
3300015084\|Ga0167654_1044745	Not Available	624	Open in IMG/M
3300015195\|Ga0167658_1005494	All Organisms → cellular organisms → Bacteria	4332	Open in IMG/M
3300015195\|Ga0167658_1009793	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3001	Open in IMG/M
3300015371\|Ga0132258_13314320	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1108	Open in IMG/M
3300015373\|Ga0132257_100099848	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3339	Open in IMG/M
3300017792\|Ga0163161_11549952	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	583	Open in IMG/M
3300017997\|Ga0184610_1031994	Not Available	1481	Open in IMG/M
3300018053\|Ga0184626_10097022	Not Available	1248	Open in IMG/M
3300018056\|Ga0184623_10034416	Not Available	2290	Open in IMG/M
3300018422\|Ga0190265_12786546	Not Available	584	Open in IMG/M
3300018429\|Ga0190272_10397098	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1123	Open in IMG/M
3300018429\|Ga0190272_11069629	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	778	Open in IMG/M
3300018429\|Ga0190272_11452946	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	693	Open in IMG/M
3300018429\|Ga0190272_11453474	Not Available	693	Open in IMG/M
3300018433\|Ga0066667_10311950	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1230	Open in IMG/M
3300018476\|Ga0190274_11044274	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	894	Open in IMG/M
3300018482\|Ga0066669_10145118	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1736	Open in IMG/M
3300019377\|Ga0190264_10743008	Not Available	734	Open in IMG/M
3300021560\|Ga0126371_11367681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	840	Open in IMG/M
3300025899\|Ga0207642_11098915	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	514	Open in IMG/M
3300025918\|Ga0207662_10372550	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	963	Open in IMG/M
3300025926\|Ga0207659_11864776	Not Available	510	Open in IMG/M
3300025936\|Ga0207670_11159303	Not Available	653	Open in IMG/M
3300025972\|Ga0207668_12045376	Not Available	516	Open in IMG/M
3300025972\|Ga0207668_12067486	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	513	Open in IMG/M
3300026035\|Ga0207703_11846796	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	580	Open in IMG/M
3300026067\|Ga0207678_11936882	Not Available	514	Open in IMG/M
3300026075\|Ga0207708_10741974	Not Available	842	Open in IMG/M
3300026118\|Ga0207675_102222498	Not Available	563	Open in IMG/M
3300026377\|Ga0257171_1079068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	579	Open in IMG/M
3300027866\|Ga0209813_10022466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1784	Open in IMG/M
3300027866\|Ga0209813_10133831	Not Available	874	Open in IMG/M
3300027909\|Ga0209382_10004227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	19316	Open in IMG/M
3300028536\|Ga0137415_10268356	Not Available	1513	Open in IMG/M
3300031716\|Ga0310813_10869384	Not Available	816	Open in IMG/M
3300031720\|Ga0307469_11200366	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	717	Open in IMG/M
3300032180\|Ga0307471_100288300	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1721	Open in IMG/M
3300034965\|Ga0370497_0035668	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1066	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	55.45%
Host-Associated	Host-Associated	44.55%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	51.82%
Plants	Host-Associated → Plants	43.64%
Aquatic	Environmental → Aquatic	3.64%
Fungi	Host-Associated → Fungi	0.91%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	51.82%
Rhizosphere	Host-Associated → Plants → Rhizosphere	24.55%
Rhizoplane	Host-Associated → Plants → Rhizoplane	10.00%
Roots	Host-Associated → Plants → Roots	9.09%
Sediment	Environmental → Aquatic → Sediment	3.64%
Mycelium	Host-Associated → Fungi → Mycelium	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	41.82%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	17.27%
Loam	Environmental → Terrestrial → Soil → Loam	8.18%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.18%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	8.18%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.27%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.64%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.82%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.91%
Sand	Environmental → Terrestrial → Soil → Sand	0.91%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.91%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	25.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	17.27%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	10.00%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.18%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	8.18%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.27%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.45%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.64%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.64%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.73%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.82%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.82%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.91%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.91%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.91%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.91%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	13.64%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	10.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	8.18%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	8.18%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.55%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.64%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	3.64%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.64%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.64%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.73%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.73%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	2.73%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.73%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.73%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.82%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.82%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.82%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.82%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.82%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.82%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.82%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.82%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.91%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.91%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.91%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.91%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.91%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.91%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental	Open in IMG/M
3300000787	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000789	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006042	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006051	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Host-Associated	Open in IMG/M
3300006177	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Host-Associated	Open in IMG/M
3300006178	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Host-Associated	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006353	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Host-Associated	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009837	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30	Environmental	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300011440	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2	Environmental	Open in IMG/M
3300012081	Attine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaG	Host-Associated	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015084	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine)	Environmental	Open in IMG/M
3300015195	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017997	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026377	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B	Environmental	Open in IMG/M
3300027866	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300034965	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1019124074	3300000364	Soil	MRWIRDKMTWVVLFAAIAATSSAYSAYKLYLMTDGRPVPATKSKR*
F24TB_133635631	3300000550	Soil	MPRWLIDXXXXXXIFAAIAAASSSYSAYKIYLMTDGKPPVVKGKR*
JGI11643J11755_110943982	3300000787	Soil	MRDKLTWILVFAFISAGGSTYSAYKVYQMTDGRPAPTKNKR*
JGI1027J11758_125231541	3300000789	Soil	MPRWLXDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPIAKGKR*
JGI10216J12902_1188740982	3300000956	Soil	MPRWMRDKITWVVLFAGIAAASSAYSAYKLFQMPDGKLLASKSKR*
Ga0062593_1013248362	3300004114	Soil	MRDKLTWILVFAVIAAGGSSYSAYKAYQMTDGRPAPTKSKR*
Ga0063356_1004457713	3300004463	Arabidopsis Thaliana Rhizosphere	MRDKLTWILVFAFIAAGGSTYSAYKVYQMTDGRPAPTKNKR*
Ga0063356_1052703131	3300004463	Arabidopsis Thaliana Rhizosphere	MPRWLTDKLIWILVFAAIAAGASSYGAYKTYLMTDGKSVPAKGKR*
Ga0062595_1009317191	3300004479	Soil	CSRVGPRGEDREMPRWLTDKMTWLVVFAAIAAASSSYSAYKIYQMTDGKPVATKGKR*
Ga0062595_1020381211	3300004479	Soil	MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVVKGKR*
Ga0062594_1027173482	3300005093	Soil	TKREDREMPRWLTDKMTWLVVFAALAAASSSYSAYKIYQMTDGKPVPTKGKR*
Ga0066690_106717191	3300005177	Soil	MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVA
Ga0066388_1001362094	3300005332	Tropical Forest Soil	MRWLTDKSLWLVLLAAIAAASSSYSAYKIYQMTDGKAAAAAAKSRR*
Ga0068869_1006913811	3300005334	Miscanthus Rhizosphere	VGEKDVHMPRWMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR*
Ga0070669_1005910612	3300005353	Switchgrass Rhizosphere	MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPIAKG
Ga0070667_1022080662	3300005367	Switchgrass Rhizosphere	MPRWMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR
Ga0070705_1016342752	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MPRWMRDKLTWIVVFAAIAAASSSYSAYKVYLMTDGKAVPTKGKR*
Ga0070700_1007847742	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MPRWIRDKLTWIVVFAAIAAASSVYSAYKLYQMTDGRPVPTKSKR*
Ga0070662_1012599192	3300005457	Corn Rhizosphere	MPRWLTDRMTWLVIFAAIGAASSSYSAYKIYLMTDGKPPVVKGKR*
Ga0070699_1019755191	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MLPRWIRDKLTWIAVFAAIAAASSAYSAYKLYQMTDGRPVPAKSKR*
Ga0070664_1012820082	3300005564	Corn Rhizosphere	MPRWLTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPGPVPAKSKR*
Ga0068857_1020917202	3300005577	Corn Rhizosphere	MPRGLTDRLTWILVFAAIAAASSSYAAYKIYLMTDARPVPTK
Ga0068861_1021523501	3300005719	Switchgrass Rhizosphere	MPRWMRDKLTWVVLFVGIAAASSAYSAYKLFQMTDGRLVASKSKR*
Ga0066903_1009379272	3300005764	Tropical Forest Soil	MPRWMRDKLTWIVVFAAVAAVSSAYSAYKLYQMTDGRPVPTKSRK*
Ga0075365_100237214	3300006038	Populus Endosphere	MRDKLTWILVFAFIAAGGSSYSAYKTYQMTDGRPAPTKNKR*
Ga0075365_100664113	3300006038	Populus Endosphere	MPRWMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR*
Ga0075368_100396191	3300006042	Populus Endosphere	MPRWIRDKLTWIAVFAAIAAASSAYSAYKLYQMTDGRPVPAKSKR*
Ga0066652_1001266173	3300006046	Soil	MPRWLRDKMTWLVILAAIAAASSSYSAYKIYLMTDAKTPVTKAKR*
Ga0066652_1005650991	3300006046	Soil	MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPIAKGKR*
Ga0066652_1008161952	3300006046	Soil	MPRWLIDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVAKGKR*
Ga0075364_100962633	3300006051	Populus Endosphere	MPRWMRDKLTWVVLFAGIAAASSAYSAYKLFQMTDGRLVASKSKR*
Ga0075362_107514052	3300006177	Populus Endosphere	DVHMPRWMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR*
Ga0075367_100109576	3300006178	Populus Endosphere	MPRWMREKLTWVVLFAGIAAASSAYSAYKLFQMTDGRLVASKSKR*
Ga0075422_103238472	3300006196	Populus Rhizosphere	MRWITDKMTWFMVFAAIAAASSSYSAYKTYSMTDGK
Ga0075370_109151032	3300006353	Populus Endosphere	MPRWMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPV
Ga0066653_100944222	3300006791	Soil	MPRWLRDRMTWLVILAAIAAASSSYSAYKIYLMTDARTPVTKAKR*
Ga0075428_1000277175	3300006844	Populus Rhizosphere	MRWITDKMTWLMVFAAIAAASSSYSAYKTYLMTDGKAVPTAVPTKGKR*
Ga0075428_1005445772	3300006844	Populus Rhizosphere	MPRWMKDKLTWILVLAFITAGSSGYSAYKIYLMTDGKAAPAKGRR*
Ga0075421_10000047713	3300006845	Populus Rhizosphere	MRWLRDKTLWVMLFAAIAAASSSYSAYKVYQMTDGKAAPTKAKGKR*
Ga0075430_1010292602	3300006846	Populus Rhizosphere	MRWLRDKMTWLAVLVAIAAASSSYSAYKIYLMTDGKAVPAKGKR*
Ga0075433_101418235	3300006852	Populus Rhizosphere	MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVAKGKR*
Ga0075433_101696782	3300006852	Populus Rhizosphere	MPRWLRDRMTWLVILAAIAAASSSYSAYKIYLMTDSKMPVTKAKR*
Ga0075433_108092502	3300006852	Populus Rhizosphere	MPRWMKDRLTWILVLALITAGSSGYSAYKIYLMTDGKAAPAKGRR*
Ga0075433_109478242	3300006852	Populus Rhizosphere	MRWIKDKMTWVVLFAAIAATSSAYSAYKLYQMTDGRPVPATKSKR*
Ga0075425_1016982932	3300006854	Populus Rhizosphere	MTWLVILAAIAAASSSYSAYKIYLMTDSKMPVTKAKR*
Ga0075435_1006061912	3300007076	Populus Rhizosphere	MPRWLTDRMTWLVIFAAIGAASSSYSAYKIYLMTDGKPPV
Ga0111538_101506901	3300009156	Populus Rhizosphere	RWMKDRLTWILVLALITAGSSGYSAYKIYLMTDGKAAPAKGRR*
Ga0111538_141135081	3300009156	Populus Rhizosphere	MPRWMKDKLTWILVLALITAGSSGYSAYKIYLMTDGKAAPAKGRR*
Ga0075423_110978252	3300009162	Populus Rhizosphere	MPRWMNNKLTWILVLALITAGSSGYSAYKIYLMTDGKAAPAKGRR*
Ga0105242_129756702	3300009176	Miscanthus Rhizosphere	MPRWFTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPSSVPVKSKR*
Ga0105058_11844981	3300009837	Groundwater Sand	MRWMRDKLTWIVLFAAIAAGSSSYSAYKIYLMTDGKPAPVKGKK*
Ga0126315_100613493	3300010038	Serpentine Soil	MREKLTWVVLFAGIAAASSAYSAYKLFQMTDGRLVASKSKR*
Ga0126310_115247982	3300010044	Serpentine Soil	MRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR*
Ga0126384_116086942	3300010046	Tropical Forest Soil	RSTSGVRRMPRWITDKLAWILVFAAIAAGSSSYCAYKIYLMTDGKLVPTKAKR*
Ga0126379_125694011	3300010366	Tropical Forest Soil	MRDKLTWIVVFAAVAAASSAYSAYKLYQMTDGRPVPTKSRK*
Ga0126379_132275912	3300010366	Tropical Forest Soil	MPRWITDKLAWILVFAAIAAGSSSYCAYKIYLMTDGKLVPTKAKR*
Ga0134124_123596201	3300010397	Terrestrial Soil	LVGKLLLQGRTKREDREMPRWLTDKMTWLVVFAAIAAASSSYSAYKIYQMTDGKPVPTKGKR*
Ga0134127_103194961	3300010399	Terrestrial Soil	MRDKLTWIVVFAAVAAASSSYSAYKVYLMTDGKAVPTKGKR*
Ga0134122_111439542	3300010400	Terrestrial Soil	MPRWIRDKLTWIVVFAAIAAASSAYSAYKLYQMTDGRPVPTKSKR*
Ga0105246_108334422	3300011119	Miscanthus Rhizosphere	MRDKLTWIVVFAAIAAASSAYSAYKLYQMTDGRPVPTKSKR*
Ga0137433_10127044	3300011440	Soil	MPRWMRDKLTWIVVFAAIAAASSSYSAYKIYLMTDGKAVPTKGRR*
Ga0154003_10974172	3300012081	Attine Ant Fungus Gardens	MRDKLTWILVFAFIAAGGSSYSAYKVYQMTDGRPAPTKNK
Ga0137387_107835901	3300012349	Vadose Zone Soil	MPRWLTDKLTWVLIFAAIAAASSSYGAYKIYLMTDGK
Ga0137407_110536342	3300012930	Vadose Zone Soil	MIWLLLLAAIAAASSSYSAYKVYLMTDGRPVPTKGKR*
Ga0137410_103773053	3300012944	Vadose Zone Soil	MTWLVILAAIAAASSSYSAYKIYLMTDAKTPVTKAKR*
Ga0126375_108623751	3300012948	Tropical Forest Soil	MPRWITDKLTWILVFAAIAAGSSSYCAYKIYLMTDGKLVPTKAKR*
Ga0164303_104519091	3300012957	Soil	MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVTKGKR*
Ga0164302_101090703	3300012961	Soil	MPRGLTDRLTWILVFAAIAAASSSYAAYKIYLMTDARPVPTKAKR*
Ga0164307_104853362	3300012987	Soil	MPRWFTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVTKGKR*
Ga0163163_132935451	3300014325	Switchgrass Rhizosphere	MPRWLTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPS
Ga0157380_115986402	3300014326	Switchgrass Rhizosphere	MSRWLTDKLTWILILAAIAAASSSYGAYKIYLMTDGKPA
Ga0157379_107268542	3300014968	Switchgrass Rhizosphere	MPRWLTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPSSVSVKSKR*
Ga0167654_10447452	3300015084	Glacier Forefield Soil	MPRWIRDKLTWIVVFAAIAAASSAYSAYKLYQMTDGRPVPTKGKR*
Ga0167658_10054943	3300015195	Glacier Forefield Soil	MPRWLRDKLTWILVFAAVAAVSSTYSAYKTYQMTDGRQVPAKSRR*
Ga0167658_10097934	3300015195	Glacier Forefield Soil	MTWLVILAAIAAASSSYSAYKIYLMTDAKTPVTKARR*
Ga0132258_133143201	3300015371	Arabidopsis Rhizosphere	MPRWLTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPSSVPVKSKR*
Ga0132257_1000998486	3300015373	Arabidopsis Rhizosphere	MPRWLIDRMTWLLIFAAIAAASSSYSAYKIYLMTDGKPPVAKGKR*
Ga0163161_115499521	3300017792	Switchgrass Rhizosphere	MPRWLTDRMTWLVIFATIAAASSSYSAYKIYLMTDGKPPVAKGKR
Ga0184610_10319942	3300017997	Groundwater Sediment	MRDKLTWIVLFAAIAAGSSSYSAYKIYLMTDGKPAPVKGKK
Ga0184626_100970221	3300018053	Groundwater Sediment	GSDAPMRWMRDKLTWIVLFAAIAAGSSSYSAYKIYLMTDGKPAPVKGKK
Ga0184623_100344162	3300018056	Groundwater Sediment	MRWMRDKLTWIVLFAAIAAGSSSYSAYKIYLMTDGKPAPVKGKK
Ga0190265_127865461	3300018422	Soil	MPRWLTDKLTWILILAAISAASSSYGAYKIYLMTDGKPVPARGKR
Ga0190272_103970981	3300018429	Soil	MRWIRDKMTWLVVFAAIAAATSSYNAYKIYLMTDGKPVPAAAKAKR
Ga0190272_110696293	3300018429	Soil	MPRWLTDKMTWILVFAAIAAASSSYGAYKTYLMTDGK
Ga0190272_114529461	3300018429	Soil	MPRWMKDKLTWILVLAFISAASSGYSAYKIYLMTDGKPAPAKGRR
Ga0190272_114534741	3300018429	Soil	MTWLVVFAAIAATSSSYSAYKIYLMTDGKAAPAAKGRR
Ga0066667_103119502	3300018433	Grasslands Soil	MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVAKGKR
Ga0190274_110442742	3300018476	Soil	MRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR
Ga0066669_101451182	3300018482	Grasslands Soil	MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPIAKGKR
Ga0190264_107430081	3300019377	Soil	MRWFRDKMTWLVVFAAIAATSSSYSAYKIYLMTDGKAAPPVKGKR
Ga0126371_113676812	3300021560	Tropical Forest Soil	MPRWITDKLTWILVFAAIAAGSSSYCAYKIYLMTDGKLVPTKAKR
Ga0207642_110989152	3300025899	Miscanthus Rhizosphere	MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTGGKPPVV
Ga0207662_103725502	3300025918	Switchgrass Rhizosphere	MRDKLTWILVFAVIAAGGSSYSAYKAYQMTDGRPAPTKSKR
Ga0207659_118647762	3300025926	Miscanthus Rhizosphere	MRDKLTWILVFAVIAAGGSSYSAYKAYQMTDGRPAPTKSK
Ga0207670_111593032	3300025936	Switchgrass Rhizosphere	MPRWLTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPSSVPVKSKR
Ga0207668_120453762	3300025972	Switchgrass Rhizosphere	MRDKLTWVVVFAGIAAASSAYSAYKLYQMTDGRPMATKSKR
Ga0207668_120674861	3300025972	Switchgrass Rhizosphere	MPRWLRDRMTWLVILAAIAAASSSYSAYKIYLMTDAKTPLTKAKR
Ga0207703_118467961	3300026035	Switchgrass Rhizosphere	MPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKP
Ga0207678_119368822	3300026067	Corn Rhizosphere	MRDKLTWILVFAVIAAGGSSYSAYKAYQMTDGRPAP
Ga0207708_107419742	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MTAEDESMPRWIRDKLTWIVVFAAIAAASSVYSAYKLYQMTDGRPVPTKSKR
Ga0207675_1022224982	3300026118	Switchgrass Rhizosphere	MPRWMRDKLTWVVLFVGIAAASSAYSAYKLFQMTDGRLVASKSKR
Ga0257171_10790681	3300026377	Soil	PRWLRDRMTWLVVLAAIAAASSSYSAYKIYLMTDAKTPVTKVKR
Ga0209813_100224664	3300027866	Populus Endosphere	MPRWIRDKLTWIAVFAAIAAASSAYSAYKLYQMTDGRPVPAKSKR
Ga0209813_101338312	3300027866	Populus Endosphere	MRWIKDKMTWVVLFAAIAATSSAYSAYKLYLMTDGRPVPASKSKR
Ga0209382_1000422710	3300027909	Populus Rhizosphere	MRWLRDKTLWVMLFAAIAAASSSYSAYKVYQMTDGKAAPTKAKGKR
Ga0137415_102683562	3300028536	Vadose Zone Soil	MTWLVLFAAIAAASSSYSAYKIYLMTDGKPVLTKAKR
Ga0310813_108693841	3300031716	Soil	MRWIKDKMTWVVLFAAIAATSSAYSAYKLYQMTDGRPVPATKSKR
Ga0307469_112003662	3300031720	Hardwood Forest Soil	MRWIRDKMTWVVVFAAIAATSSAYSAYKLYQMTDGRPAPTTKSKR
Ga0307471_1002883004	3300032180	Hardwood Forest Soil	MRWITDKMTWLMVFAAIAAASSSYSAYKTYLMTDGKAVPTAVPTKGKR
Ga0370497_0035668_211_354	3300034965	Untreated Peat Soil	MPRWLTDKMTWLIVLAAITAASSSYSAYKLYLMTDGKPAAASTKSKR

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.50
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.50
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F087452

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign