NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087525

Metagenome / Metatranscriptome Family F087525

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087525
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 47 residues
Representative Sequence LSGALQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV
Number of Associated Samples 94
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.64 %
% of genes near scaffold ends (potentially truncated) 94.55 %
% of genes from short scaffolds (< 2000 bps) 90.91 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (59.091 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.182 % of family members)
Environment Ontology (ENVO) Unclassified
(38.182 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(59.091 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.22%    β-sheet: 16.44%    Coil/Unstructured: 75.34%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF00999Na_H_Exchanger 4.55
PF01972SDH_sah 4.55
PF03358FMN_red 3.64
PF13462Thioredoxin_4 2.73
PF00578AhpC-TSA 2.73
PF06684AA_synth 2.73
PF13193AMP-binding_C 2.73
PF12680SnoaL_2 1.82
PF07992Pyr_redox_2 1.82
PF13668Ferritin_2 1.82
PF00196GerE 0.91
PF06224HTH_42 0.91
PF13561adh_short_C2 0.91
PF13458Peripla_BP_6 0.91
PF14833NAD_binding_11 0.91
PF06965Na_H_antiport_1 0.91
PF12802MarR_2 0.91
PF09423PhoD 0.91
PF01243Putative_PNPOx 0.91
PF07724AAA_2 0.91
PF02780Transketolase_C 0.91
PF03446NAD_binding_2 0.91
PF10011DUF2254 0.91
PF00482T2SSF 0.91
PF01965DJ-1_PfpI 0.91
PF01022HTH_5 0.91
PF14329DUF4386 0.91
PF02518HATPase_c 0.91
PF08241Methyltransf_11 0.91
PF12903DUF3830 0.91
PF10431ClpB_D2-small 0.91
PF10604Polyketide_cyc2 0.91
PF06803DUF1232 0.91
PF07366SnoaL 0.91
PF06772LtrA 0.91
PF12833HTH_18 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 9.09
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 5.45
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 4.55
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 4.55
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 4.55
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 4.55
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 0.91
COG3339Uncharacterized membrane protein YkvA, DUF1232 familyFunction unknown [S] 0.91
COG4292Low temperature requirement protein LtrA (function unknown)Function unknown [S] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms59.09 %
UnclassifiedrootN/A40.91 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725002|GPICC_F5MS3JC01DHAVLNot Available532Open in IMG/M
2170459007|GJ61VE201C0XEHAll Organisms → cellular organisms → Bacteria524Open in IMG/M
3300003319|soilL2_10047857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6181Open in IMG/M
3300003321|soilH1_10125090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4015Open in IMG/M
3300003322|rootL2_10029050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1280Open in IMG/M
3300004153|Ga0063455_101353850Not Available546Open in IMG/M
3300004157|Ga0062590_101393828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium697Open in IMG/M
3300004157|Ga0062590_102183018Not Available579Open in IMG/M
3300004157|Ga0062590_102659039All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300004479|Ga0062595_101878503Not Available573Open in IMG/M
3300004643|Ga0062591_102214185Not Available572Open in IMG/M
3300005093|Ga0062594_102748987Not Available546Open in IMG/M
3300005294|Ga0065705_10859292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300005329|Ga0070683_101322079Not Available693Open in IMG/M
3300005347|Ga0070668_100270735All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300005356|Ga0070674_101543850Not Available598Open in IMG/M
3300005438|Ga0070701_10139365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1385Open in IMG/M
3300005439|Ga0070711_100163695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1688Open in IMG/M
3300005441|Ga0070700_100020543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3827Open in IMG/M
3300005530|Ga0070679_101640819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300005535|Ga0070684_101992083Not Available548Open in IMG/M
3300005543|Ga0070672_101654083Not Available575Open in IMG/M
3300005615|Ga0070702_100912689Not Available689Open in IMG/M
3300005617|Ga0068859_100876996Not Available983Open in IMG/M
3300005718|Ga0068866_10919426Not Available617Open in IMG/M
3300005719|Ga0068861_100389403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1234Open in IMG/M
3300005842|Ga0068858_100382600Not Available1350Open in IMG/M
3300005874|Ga0075288_1019485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria951Open in IMG/M
3300006175|Ga0070712_101902563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300006581|Ga0074048_12974352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia689Open in IMG/M
3300006844|Ga0075428_101182148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia807Open in IMG/M
3300006846|Ga0075430_101558677All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300006853|Ga0075420_101641672Not Available551Open in IMG/M
3300006854|Ga0075425_100297723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1856Open in IMG/M
3300006854|Ga0075425_102549232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300006880|Ga0075429_101008935All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300006881|Ga0068865_100661754Not Available889Open in IMG/M
3300009094|Ga0111539_10445414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1508Open in IMG/M
3300009094|Ga0111539_11094536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria926Open in IMG/M
3300009094|Ga0111539_12113825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia653Open in IMG/M
3300009148|Ga0105243_12303639Not Available576Open in IMG/M
3300009156|Ga0111538_11268521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium930Open in IMG/M
3300009156|Ga0111538_13841986Not Available520Open in IMG/M
3300009176|Ga0105242_11464156All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300010371|Ga0134125_11802411All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300010373|Ga0134128_11455467Not Available754Open in IMG/M
3300010403|Ga0134123_10105650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis2252Open in IMG/M
3300010403|Ga0134123_11687534All Organisms → cellular organisms → Bacteria → Proteobacteria684Open in IMG/M
3300011439|Ga0137432_1309841Not Available504Open in IMG/M
3300012212|Ga0150985_115224123Not Available590Open in IMG/M
3300012897|Ga0157285_10083805All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300012897|Ga0157285_10086963All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300012898|Ga0157293_10105365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria733Open in IMG/M
3300012905|Ga0157296_10076267All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300012907|Ga0157283_10236162Not Available598Open in IMG/M
3300012910|Ga0157308_10134869Not Available770Open in IMG/M
3300012910|Ga0157308_10140307All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300012930|Ga0137407_11501242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300012938|Ga0162651_100047617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria669Open in IMG/M
3300013297|Ga0157378_11155371Not Available813Open in IMG/M
3300013306|Ga0163162_11408272Not Available793Open in IMG/M
3300013307|Ga0157372_11751801All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300013308|Ga0157375_11538704Not Available786Open in IMG/M
3300014326|Ga0157380_12409504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300014745|Ga0157377_11758118All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300014969|Ga0157376_11463194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082716Open in IMG/M
3300015053|Ga0137405_1321698All Organisms → cellular organisms → Bacteria2773Open in IMG/M
3300015077|Ga0173483_10579023Not Available613Open in IMG/M
3300015242|Ga0137412_10935319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300015371|Ga0132258_10529895All Organisms → cellular organisms → Bacteria2950Open in IMG/M
3300015371|Ga0132258_11596131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1647Open in IMG/M
3300015372|Ga0132256_100941373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria980Open in IMG/M
3300015373|Ga0132257_102909877Not Available624Open in IMG/M
3300015374|Ga0132255_103782003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300018066|Ga0184617_1148394Not Available685Open in IMG/M
3300018466|Ga0190268_10124450All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300018466|Ga0190268_10258457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1008Open in IMG/M
3300018469|Ga0190270_10052870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2837Open in IMG/M
3300018469|Ga0190270_12972978Not Available536Open in IMG/M
3300018476|Ga0190274_11724360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria720Open in IMG/M
3300018481|Ga0190271_10215933Not Available1924Open in IMG/M
3300018481|Ga0190271_11754944Not Available733Open in IMG/M
3300019356|Ga0173481_10217651All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300019361|Ga0173482_10572343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300021078|Ga0210381_10033343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1462Open in IMG/M
3300023261|Ga0247796_1088445Not Available582Open in IMG/M
3300025898|Ga0207692_10183278Not Available1221Open in IMG/M
3300025907|Ga0207645_10058458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2461Open in IMG/M
3300025920|Ga0207649_11599282Not Available516Open in IMG/M
3300025928|Ga0207700_11706298Not Available555Open in IMG/M
3300025932|Ga0207690_10914190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria728Open in IMG/M
3300025933|Ga0207706_10024006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei5471Open in IMG/M
3300025935|Ga0207709_10854267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis737Open in IMG/M
3300025937|Ga0207669_10162940All Organisms → cellular organisms → Bacteria1578Open in IMG/M
3300025941|Ga0207711_10151112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2095Open in IMG/M
3300025944|Ga0207661_11390367Not Available644Open in IMG/M
3300026067|Ga0207678_11549870Not Available584Open in IMG/M
3300028381|Ga0268264_12282884Not Available548Open in IMG/M
3300028589|Ga0247818_10874394Not Available631Open in IMG/M
3300028754|Ga0307297_10090984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium993Open in IMG/M
3300028810|Ga0307294_10410688Not Available510Open in IMG/M
3300028885|Ga0307304_10541269Not Available536Open in IMG/M
3300030336|Ga0247826_10489626All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300030336|Ga0247826_10911954Not Available694Open in IMG/M
3300030336|Ga0247826_11377401Not Available569Open in IMG/M
3300030336|Ga0247826_11392605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300031731|Ga0307405_11034645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium702Open in IMG/M
3300031740|Ga0307468_101031120Not Available727Open in IMG/M
3300031908|Ga0310900_10476516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria965Open in IMG/M
3300032002|Ga0307416_101019011All Organisms → cellular organisms → Bacteria931Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.18%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.45%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.64%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.64%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.64%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.73%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.82%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.82%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.91%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.91%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.91%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.91%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.91%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.91%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.91%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725002Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
2170459007Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cmEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003322Sugarcane root Sample L2Host-AssociatedOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300023261Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPICC_031600702067725002SoilGALQSDDRIRVDYDDVQLTFDVDKGAAEAMEEVEEPESQPAHV
L02_032022602170459007Grass SoilALQTHDRVRVDYDDVQLTFDVDKGAEEVEEPHSQPAHV
soilL2_10047857113300003319Sugarcane Root And Bulk SoilENEVSRLLLRGALQPDDRVRVDYDDVQLTLDVDKGAAEAMEEVEEPESQPAHV*
soilH1_1012509013300003321Sugarcane Root And Bulk SoilQRELENEVSRLLLRGALQPDDRVRVDYDDVQLTLDVDKGAAEAMEEVEEPESQPAHV*
rootL2_1002905013300003322Sugarcane Root And Bulk SoilSRLLLSGALQPDDRVRVDFQLTFDIDKGAAEAMEEVEEPEPQPANV*
Ga0063455_10135385023300004153SoilALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPESQPAHV*
Ga0062590_10139382823300004157SoilIEPGDRVRVDYDDVQLTFDVEKGAEADEKVEQPERQPAHA*
Ga0062590_10218301813300004157SoilLRGALQPDDRVHVDYDDVQLTFDIDKGAAEAIETQELQPAQV*
Ga0062590_10265903923300004157SoilRELENEVSRLLLSGALQPDDRLRVDYDDVQLTFEIEKEAAETIEEVDEPESQPAHV*
Ga0062595_10187850313300004479SoilPDDRVRVDYDDVQLTFDVDKGAAEEMEEVEEPESQPAHV*
Ga0062591_10221418513300004643SoilENELSRLLLSGALQPDDRVRIDYDDVQLTFEIDKGAAEAIEEVEDPESQPAQV*
Ga0062594_10274898723300005093SoilRLLLGGSIEPGDRVRVDYDGVQLTFDVEKGAAEADEQVEQPERQPAHA*
Ga0065705_1085929213300005294Switchgrass RhizosphereRGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPESQPAHV*
Ga0070683_10132207923300005329Corn RhizosphereLSGALQPDDRVRVDHDGVQLTFEVDKGAAEAMEEVEEPEPQPAHV*
Ga0070668_10027073513300005347Switchgrass RhizosphereLRGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPESQPAHV*
Ga0070674_10154385033300005356Miscanthus RhizosphereSGALQPDDRVRVDYDDVQLTFDIDRGAVEAMEEVEEPEPQPAHV*
Ga0070701_1013936533300005438Corn, Switchgrass And Miscanthus RhizosphereIEPGDRVRVDYDGVQLTFDVEKGAAEADEQVEQPERQPAHA*
Ga0070711_10016369533300005439Corn, Switchgrass And Miscanthus RhizosphereRLLLSGALQPDDRVRVDYDDVQLTFDVEKGAAEAMEEVEEPELQPAHV*
Ga0070700_10002054343300005441Corn, Switchgrass And Miscanthus RhizosphereVTSDSTSSSSSDRRELENEVSRLLLSRALQPDDRVRVDFDDVQLTFDIDKGGAESMEEVEEPESQLAHV*
Ga0070679_10164081923300005530Corn RhizosphereLQPDDRVRVDYDDVQLTFDVDKGAAEAMEEVDEPEPQPAPV*
Ga0070684_10199208323300005535Corn RhizosphereSRLLLSGALQPDDRVRVDHDGVQLTFDIDKGPEEATEEEVIEPESPAYV*
Ga0070672_10165408313300005543Miscanthus RhizosphereRVRVDYDDVQLTFDIDKGAVEAMEEVEESEPQPAHV*
Ga0070702_10091268933300005615Corn, Switchgrass And Miscanthus RhizosphereALQPDDRVRVDYDDVQLTFDIDKGGAEAMEEVEEPEPQPAHV*
Ga0068859_10087699613300005617Switchgrass RhizosphereLSGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPEPQPAHV*
Ga0068866_1091942613300005718Miscanthus RhizospherePDDRVRVDYDDVQLTFDVDKGAAEAMEEVEEPEAQPAHV*
Ga0068861_10038940313300005719Switchgrass RhizosphereIQRELENEVSRLLLSGALQPDDRLRVDYDDVQLTFEIEKEAAETIEEVDEPESQPAHV*
Ga0068858_10038260013300005842Switchgrass RhizospherePDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPEPQPAHV*
Ga0075288_101948543300005874Rice Paddy SoilRVDYDDVQLTFDIDKGGAEAMEEVEEPEPQPAHV*
Ga0070712_10190256323300006175Corn, Switchgrass And Miscanthus RhizosphereIQRELENEVSRLLLSGALQPDDRVRVDYDDVQLTLDVDKGAAEAMEAVEEPESQPAHV*
Ga0074048_1297435213300006581SoilENEVSRLLLSGALQPDDRVRADFDDVQLTFDVEKGAAEQIEEVEEPESEPAHV*
Ga0075428_10118214813300006844Populus RhizosphereRAIQRELENEVSRLLLSGALQSDDRVRVDYDDIQLTFDVDKGAAEALEEVDEPESQPAHV
Ga0075430_10155867723300006846Populus RhizosphereLLSGALQPDDRVRVDYDDVQLTFDIDKGGAEAIDEVEEPEPQPAHV*
Ga0075420_10164167223300006853Populus RhizosphereLQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPESEPAHV*
Ga0075425_10029772343300006854Populus RhizosphereSGALQPDDRIRVDYDDVQLTFDVEKEAAEAMEEVEEPELQPAHA*
Ga0075425_10254923213300006854Populus RhizosphereQPDDRVRVDYDDVQLTFDIDKGAAEAIEEVEEPEPQPAHV*
Ga0075429_10100893513300006880Populus RhizosphereLQPDDRVRVDYDDVQLTFDIDKGAAEALEEVEEPEPAHV*
Ga0068865_10066175413300006881Miscanthus RhizosphereDRVRVDYDDVQLTFDVEKGAAEADEQVEQPERQPAHA*
Ga0111539_1044541413300009094Populus RhizosphereIQRELENEVSRLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV*
Ga0111539_1109453633300009094Populus RhizosphereLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV*
Ga0111539_1211382513300009094Populus RhizosphereVIEEGLEVSRLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAIEEVEEPEPQPAHV*
Ga0105243_1230363913300009148Miscanthus RhizosphereLRGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPESQPARV*
Ga0111538_1126852113300009156Populus RhizosphereLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV*
Ga0111538_1384198623300009156Populus RhizosphereRAIQRELENEVSRLLLSGALQPDDRVRVDFDDVQLTFDVDKGAAEAMEEVEEPESQPAHA
Ga0105242_1146415633300009176Miscanthus RhizosphereEPDDRVRVDYDDVQLTFDVEKGAAEAMEEVEEPELQPSHV*
Ga0134125_1180241123300010371Terrestrial SoilVRVDYDDVQLTFDIDKGAAEAIEEVEEPESQPAHV*
Ga0134128_1145546723300010373Terrestrial SoilQRELENEVSRLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAIEEVEEPEPQPQPAHV*
Ga0134123_1010565013300010403Terrestrial SoilLENEVSRLLLSRALQPDDRVRVDFDDVQLTFDIDKGGAESMEEVEEPESQLAHV*
Ga0134123_1168753413300010403Terrestrial SoilRRAIQRELENEVSRLHLSGALQTDDRVRVDYDDVQLTFDVEKGAAEEVEEPESQLAHA*
Ga0137432_130984123300011439SoilRAIQRELENEVSRLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV
Ga0150985_11522412323300012212Avena Fatua RhizosphereENELSRLLLSGALQPDDRVRVDYDDVQLFFDVEKGAAEAMEEVEEPELEAAHV*
Ga0157285_1008380513300012897SoilPGDRVRVDYDGVQLTFDVEKGAAEADEQVEQPERQPAHA*
Ga0157285_1008696323300012897SoilGALQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEESEPAHV*
Ga0157293_1010536523300012898SoilLSGALQPDDRVRVDYDDIQLTFDVDKGAAEAMEEVDEPESQPAHV*
Ga0157296_1007626733300012905SoilRVRIDYDDVQLTFEVDKGAAEAMEEVDEPESEPAHA*
Ga0157283_1023616213300012907SoilLQPDDRVRVDYDDVQLTFDVEKGAAEAMEEVEEPELESAHV*
Ga0157308_1013486913300012910SoilELENEVSRLLLSGGLQPDDRVRVDYDDVQLSFDIDKGAAEAMEEVEEPEPQPAHV*
Ga0157308_1014030723300012910SoilRLVLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAIEEVEESEPAHV*
Ga0137407_1150124223300012930Vadose Zone SoilENELSRLLLRGSIEPGDRVRVDYDEVELKFDVEKGAAEADQKVDQPERERAHAS*
Ga0162651_10004761723300012938SoilIQRELENEVSRLLLSGALQPDDRVRVDYDDVQLTFDVDKGAAEQMEKVEEPESQPAHA*
Ga0157378_1115537123300013297Miscanthus RhizosphereQRELENEVSRLLLSGALQPDDRLRVDYDDVQLTFEIEKEAAETIEEVDEPESQPAHV*
Ga0163162_1140827213300013306Switchgrass RhizosphereQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV*
Ga0157372_1175180133300013307Corn RhizosphereLRVDYDDVQLTFEIEKEAAETIEEVDEPESQPAHV*
Ga0157375_1153870423300013308Miscanthus RhizosphereDYDDVQLTFDIDKGAAEAMEEVEEPEPQPQPQPAHV*
Ga0157380_1240950423300014326Switchgrass RhizosphereAIQRELENEVSRLLLSGALQPDDRVRVDYDDVQLTFDVDKGAAEAMEEVDEPEPQPAPV*
Ga0157377_1175811823300014745Miscanthus RhizosphereGALQPDDRVRVDYDDVQLTFDVDKGAAEAMEEVEEPEAQPAHV*
Ga0157376_1146319423300014969Miscanthus RhizosphereVSRLLLRGALQPDDRVRVDYDDVQLTFDVEKGAAEAMEEVEEPESQLAHV*
Ga0137405_132169853300015053Vadose Zone SoilLASDYDEVELTFDVEKGAAESDQKVEQTERQPAHAS*
Ga0173483_1057902313300015077SoilRRAIQRELENEVSRLVLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEESEPAHV*
Ga0137412_1093531933300015242Vadose Zone SoilRVRVDYDDVQLTFDVEKGAAEADEKVEQPEREPAYAS*
Ga0132258_1052989513300015371Arabidopsis RhizosphereSGALQPDDRVRVDYDDVQLTFDIDKGAAEETEEVEEPEPQPAHV*
Ga0132258_1159613133300015371Arabidopsis RhizosphereRAIQRELENEVSRLLLSGALQPDDRVRVDYGDVQLTFDIDKGAAEEMEEVEEPEPQPAHV
Ga0132256_10094137323300015372Arabidopsis RhizosphereVTIVHGTARGALLLSGALQPDDRVRVDYDDVQLTFDIGKGAAEAIEEVEEPDSQPAHV*
Ga0132257_10290987713300015373Arabidopsis RhizosphereVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV*
Ga0132255_10378200323300015374Arabidopsis RhizosphereLSGALQPDDRVRVDYDDVQLTFDIDRGAVEAMEEVEESEPQPAHV*
Ga0184617_114839423300018066Groundwater SedimentELENEVSRLLLSGALQPDDRVRVDYDDVQLTFDVEKGAAEAMEEVEEPESQPAHA
Ga0190268_1012445033300018466SoilENEVSRLLLSGAVQPDDRVRVDYDHVQLTFDVDKGAAEAMEEVEEPESQPAHA
Ga0190268_1025845723300018466SoilLQPDDRVRVDYDDVQLTFDIDKGAAEAIEEVEEPEPQPAHV
Ga0190270_1005287063300018469SoilENEVSRLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEEMEEVEEPESQPAHV
Ga0190270_1297297823300018469SoilENELSRLLLSGALQPDDRVRVDYDDVQLIFDVEKGAAEAMEEVEEPEPQPAHA
Ga0190274_1172436023300018476SoilLESEVSRLLLSGALQPDDRVRVDYDDVQFTFDVDKGAAEAMEEVEEPQSQPAHV
Ga0190271_1021593313300018481SoilQRELENEVSRLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEEMEEVEEPESQPAHV
Ga0190271_1175494423300018481SoilVRVDYDDVQLTFDVEKGAAEAMEEVEEPESQPAHV
Ga0173481_1021765123300019356SoilLLLGGSIEPSDRVRVDYDDVQLTFDVEKGAAEADEEVEQPEREPAHAS
Ga0173482_1057234313300019361SoilRAIQRELENEVSRLLLRGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPESQPAHV
Ga0210381_1003334313300021078Groundwater SedimentEVSRLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAIEEVEEPEPQPAHV
Ga0247796_108844513300023261SoilDDRVRVDYDDVQLTFDIDKGAAEAMEEVEESEPAHV
Ga0207692_1018327813300025898Corn, Switchgrass And Miscanthus RhizosphereQPDDRVRVDYDEVQLTFDIDKGGAEAMEEVEEPEPQPAHV
Ga0207645_1005845833300025907Miscanthus RhizosphereDRVRVDYDDVQLTFDVDKGAAEAMEEVDEPEPQPAPV
Ga0207649_1159928213300025920Corn RhizosphereDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPEPQPAHV
Ga0207700_1170629813300025928Corn, Switchgrass And Miscanthus RhizosphereLLLSGALQPDDRVRVDYDEVQLTFDIDKGGAEAMEEVEEPEPQPAHV
Ga0207690_1091419013300025932Corn RhizosphereLLSGALQPDDRVRVDYDDVQLTFDVDKGAAEEMEEVEEPESQPAHV
Ga0207706_1002400613300025933Corn RhizosphereVSRLLLRGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPEPQPAHV
Ga0207709_1085426723300025935Miscanthus RhizosphereLVTSDSTSSSSSDRRELENEVSRLLLSRALQPDDRVRVDFDDVQLTFDIDKGGAESMEEVEEPESQLAHV
Ga0207669_1016294033300025937Miscanthus RhizosphereSRLLLSGALQPDDRLRVDYDDVQLTFEIEKEAAETIEEVDEPESQPAHV
Ga0207711_1015111213300025941Switchgrass RhizosphereLLLSGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPEPQPAHV
Ga0207661_1139036713300025944Corn RhizosphereIQRELENEVSRLLLSGALQPDDRVRVDHDGVQLTFEVDKGAAEAMEEVEEPEPQPAHV
Ga0207678_1154987023300026067Corn RhizosphereQPDDRVRVDYDDVQLTFDVEKGAAEAMDEVEEPESQLAHV
Ga0268264_1228288413300028381Switchgrass RhizospherePDDRVRVDYDDVQLTFDIDKGAVEAMEEVEEPEPQPAHV
Ga0247818_1087439423300028589SoilRLLLSGALQPDDRVRVDYDGVQLTFEVGKGGAEEREEVEEPESQPAHV
Ga0307297_1009098413300028754SoilENEVSRLLLSGALQPDDRVRVDYDDVQLTFDVEKGAAEAMEEVEEPESQPAHI
Ga0307294_1041068823300028810SoilRLLLRGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPESQPAHI
Ga0307304_1054126913300028885SoilELENEVSRLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV
Ga0247826_1048962613300030336SoilRVRVDYDDVQLTFDVEKGAEAMEEVEEPESQPAHV
Ga0247826_1091195423300030336SoilRLLLRGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPESQPAHV
Ga0247826_1137740113300030336SoilGDRVRVDYDGVQLTFDVEKGAAEADEQVEQPERQPAHA
Ga0247826_1139260523300030336SoilLLGGALQPDDRVRVDYDDVQLTFDVDKDAAEAMEEVDEPESQPAHV
Ga0307405_1103464523300031731RhizosphereDDRVRVDYDDVQLTFDIDKGAAEEMEEVEEPESQPAHV
Ga0307468_10103112023300031740Hardwood Forest SoilDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV
Ga0310900_1047651613300031908SoilENEVSRLLLSGALQPDDRVRVDYDDVQLTFDVEKGAAEAMEEVEEPESQPAHV
Ga0307416_10101901113300032002RhizosphereSDDRVRVDYDDVQLTFDIDKGAAEEMEEVEEPESQPAHV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.