NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F087632

Metagenome Family F087632

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087632
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 38 residues
Representative Sequence MKRVLIATSNAGKLRDFAGAAAPHGIEIASIPNFTSL
Number of Associated Samples 106
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 67.27 %
% of genes near scaffold ends (potentially truncated) 99.09 %
% of genes from short scaffolds (< 2000 bps) 89.09 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.636 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(13.636 % of family members)
Environment Ontology (ENVO) Unclassified
(26.364 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.636 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.54%    β-sheet: 15.38%    Coil/Unstructured: 63.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.62
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF10131PTPS_related 9.09
PF07238PilZ 4.55
PF13899Thioredoxin_7 1.82
PF07690MFS_1 0.91
PF15780ASH 0.91
PF00158Sigma54_activat 0.91
PF07589PEP-CTERM 0.91
PF13183Fer4_8 0.91
PF02254TrkA_N 0.91
PF13751DDE_Tnp_1_6 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.64 %
UnclassifiedrootN/A6.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004091|Ga0062387_100464369All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter873Open in IMG/M
3300005526|Ga0073909_10141153All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium995Open in IMG/M
3300005563|Ga0068855_102460980All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005591|Ga0070761_10704224All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter632Open in IMG/M
3300005842|Ga0068858_100574462All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300005938|Ga0066795_10153341All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300005950|Ga0066787_10146047All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae533Open in IMG/M
3300006173|Ga0070716_101040315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae650Open in IMG/M
3300006176|Ga0070765_100198571All Organisms → cellular organisms → Bacteria1819Open in IMG/M
3300006176|Ga0070765_100292826All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1503Open in IMG/M
3300009524|Ga0116225_1035806All Organisms → cellular organisms → Bacteria2442Open in IMG/M
3300009635|Ga0116117_1221998All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300009641|Ga0116120_1066362All Organisms → cellular organisms → Bacteria1219Open in IMG/M
3300009762|Ga0116130_1128906All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300010048|Ga0126373_11164960All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium837Open in IMG/M
3300010048|Ga0126373_13146763All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7514Open in IMG/M
3300010379|Ga0136449_100242202All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3362Open in IMG/M
3300012096|Ga0137389_11634231All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300012203|Ga0137399_10173636All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1736Open in IMG/M
3300012205|Ga0137362_10553594All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300012357|Ga0137384_11355999All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300012362|Ga0137361_11047495All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium736Open in IMG/M
3300012532|Ga0137373_11296438All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300012582|Ga0137358_10005292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7751Open in IMG/M
3300012683|Ga0137398_10755758All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium678Open in IMG/M
3300012917|Ga0137395_10847403All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300012929|Ga0137404_11361997All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300012930|Ga0137407_12236128Not Available523Open in IMG/M
3300012944|Ga0137410_10014139All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5429Open in IMG/M
3300012958|Ga0164299_10297107All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium990Open in IMG/M
3300012989|Ga0164305_11925791All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300013296|Ga0157374_12742490All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300014489|Ga0182018_10160622All Organisms → cellular organisms → Bacteria → Acidobacteria1279Open in IMG/M
3300015195|Ga0167658_1088157All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis689Open in IMG/M
3300015245|Ga0137409_10028525All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5434Open in IMG/M
3300015374|Ga0132255_103389509All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300016294|Ga0182041_10906470All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium793Open in IMG/M
3300017934|Ga0187803_10016908All Organisms → cellular organisms → Bacteria2910Open in IMG/M
3300017935|Ga0187848_10223171All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300017937|Ga0187809_10399579All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300017942|Ga0187808_10022779All Organisms → cellular organisms → Bacteria → Acidobacteria2547Open in IMG/M
3300017970|Ga0187783_10858169All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300017974|Ga0187777_11420138All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300017975|Ga0187782_10512306All Organisms → cellular organisms → Bacteria → Acidobacteria918Open in IMG/M
3300017998|Ga0187870_1079061All Organisms → cellular organisms → Bacteria1316Open in IMG/M
3300018002|Ga0187868_1163335All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300018013|Ga0187873_1072590All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300018021|Ga0187882_1302871Not Available612Open in IMG/M
3300018024|Ga0187881_10180399All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300018026|Ga0187857_10557475All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300018038|Ga0187855_10535766All Organisms → cellular organisms → Bacteria → Acidobacteria682Open in IMG/M
3300018040|Ga0187862_10265792All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1096Open in IMG/M
3300018062|Ga0187784_10250803All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1440Open in IMG/M
3300018086|Ga0187769_10814389All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300018088|Ga0187771_10546145All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300018088|Ga0187771_11555661All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300018090|Ga0187770_10202678All Organisms → cellular organisms → Bacteria1528Open in IMG/M
3300018468|Ga0066662_10804378All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium912Open in IMG/M
3300019879|Ga0193723_1117191All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium741Open in IMG/M
3300021180|Ga0210396_10760820All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300021401|Ga0210393_10819998Not Available757Open in IMG/M
3300021404|Ga0210389_10205150All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1538Open in IMG/M
3300021405|Ga0210387_11367688All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300021433|Ga0210391_11006094All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis649Open in IMG/M
3300021478|Ga0210402_11350111All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300021479|Ga0210410_10410973All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1212Open in IMG/M
3300021559|Ga0210409_10039689All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4473Open in IMG/M
3300025507|Ga0208188_1078310All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300025903|Ga0207680_10593183All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300025914|Ga0207671_10766969All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium766Open in IMG/M
3300025945|Ga0207679_11134985All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300026040|Ga0208144_1004184All Organisms → cellular organisms → Bacteria → Acidobacteria1494Open in IMG/M
3300026281|Ga0209863_10235252All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300026480|Ga0257177_1088056Not Available508Open in IMG/M
3300026557|Ga0179587_10841154All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300027875|Ga0209283_10012845All Organisms → cellular organisms → Bacteria4997Open in IMG/M
3300027879|Ga0209169_10348447All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300027905|Ga0209415_10266332All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1520Open in IMG/M
3300027911|Ga0209698_10330341All Organisms → cellular organisms → Bacteria → Acidobacteria1202Open in IMG/M
3300028084|Ga0255356_1043331All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium830Open in IMG/M
3300028572|Ga0302152_10137920Not Available778Open in IMG/M
3300028572|Ga0302152_10168161All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300028651|Ga0302171_10013523All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2128Open in IMG/M
3300028780|Ga0302225_10201890All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300028792|Ga0307504_10303259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300028800|Ga0265338_10659066All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300028808|Ga0302228_10533423All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis516Open in IMG/M
3300029914|Ga0311359_10416481All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300029955|Ga0311342_10707316All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300030007|Ga0311338_11442021All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300030659|Ga0316363_10295371All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300031668|Ga0318542_10073821All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1602Open in IMG/M
3300031679|Ga0318561_10543677All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300031718|Ga0307474_10889119All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300031720|Ga0307469_10315279All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1295Open in IMG/M
3300031820|Ga0307473_10177994All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1241Open in IMG/M
3300031831|Ga0318564_10322653All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300031910|Ga0306923_10268982All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1949Open in IMG/M
3300032052|Ga0318506_10216724All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium846Open in IMG/M
3300032160|Ga0311301_12623215Not Available558Open in IMG/M
3300032174|Ga0307470_10658604All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium792Open in IMG/M
3300032180|Ga0307471_100528840All Organisms → cellular organisms → Bacteria → Acidobacteria1331Open in IMG/M
3300032205|Ga0307472_100070786All Organisms → cellular organisms → Bacteria2275Open in IMG/M
3300032421|Ga0310812_10031603All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1944Open in IMG/M
3300032783|Ga0335079_10292478All Organisms → cellular organisms → Bacteria → Acidobacteria1780Open in IMG/M
3300032893|Ga0335069_10230367All Organisms → cellular organisms → Bacteria → Acidobacteria2239Open in IMG/M
3300033158|Ga0335077_11848797All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300033433|Ga0326726_12356956All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300034124|Ga0370483_0276851All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300034177|Ga0364932_0110422Not Available1044Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.82%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland8.18%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland7.27%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.55%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.55%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.64%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.64%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.64%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.73%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.73%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.82%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.91%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.91%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.91%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.91%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.91%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.91%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.91%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.91%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.91%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.91%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.91%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300015195Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026040Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028084Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T100EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028651Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_2EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062387_10046436923300004091Bog Forest SoilMTSRLVLIATSNPGKLRDFAGAAAPLGVTIANIPNFSSLS
Ga0073909_1014115323300005526Surface SoilMIRILIATTNAGKLRDFAGIASPHGIEIESLPNFASIPTAVEDG
Ga0068855_10246098023300005563Corn RhizosphereMKHILIATSNQGKLRDFAGAAKSHGVEVRGVPGFSS
Ga0070761_1070422413300005591SoilMRRILIATSNRGKLRDFAGAASRHNVEITGIPDFSSF
Ga0068858_10057446213300005842Switchgrass RhizosphereMTTRIYLATSNAGKLRDFAGAAAVFGIELAALPGF
Ga0066795_1015334123300005938SoilMQRSVLVATSNAGKLRDLAGAAVPYGITIASIPNFSSLPQVIEDGT
Ga0066787_1014604723300005950SoilMIKRVLIATSNPGKLRDFSGVATSLGIEIVCIPNFSSLTAV
Ga0070716_10104031523300006173Corn, Switchgrass And Miscanthus RhizosphereMKKILIATSNPGKLRDFAGAAVAHDIEITAIPNLAALPV
Ga0070765_10019857113300006176SoilMRKILIATSNPGKLRDFGGAALRHGVEVAGIPGFSSL
Ga0070765_10029282623300006176SoilLRKILIATSNAGKLRDFAGAAGQHGVEIAGIPGFSSL
Ga0116225_103580613300009524Peatlands SoilMRGILIATSNPGKLRDFAGAALRHGVEIAGIPHFSSLPT
Ga0116117_122199823300009635PeatlandMQRSVLVATSNPGKLRDFAGAAATFGIRIANIPNFSSLP
Ga0116120_106636223300009641PeatlandMQRRVLVATSNAGKLRDFAGAAAPYGIPIANVPHFASLPEVVED
Ga0116130_112890613300009762PeatlandMQRRVLVATSNAGKLRDFAGAAAPYGIPIANVPHFASLPEVVEDG
Ga0126373_1116496013300010048Tropical Forest SoilVKKVLIATSNPGKLRDFAGAAAKYGIKTTIIPNFSS
Ga0126373_1314676313300010048Tropical Forest SoilVKRILIATSNAGKLRDFAGAAAVHGIEIGGIPNFSSLPLV
Ga0136449_10024220243300010379Peatlands SoilMKRILIATSNTGKLVDFAAAAGPHGIEVIPLPNFSSLPPVV
Ga0137389_1163423113300012096Vadose Zone SoilMMRHILIATSNSGKLRDFAGAASLHGIEIASVPDFP
Ga0137399_1017363623300012203Vadose Zone SoilMNFLAMRKVLIATSNPGKFRDFAGAASHYGIEVAP
Ga0137362_1055359423300012205Vadose Zone SoilMARRVLMATSNAGKLRDFAGAAAPYGITIANIPHFSSL
Ga0137384_1135599913300012357Vadose Zone SoilMQKILIATSNPGKLRDFAGAAAPLGIEIAGIPHFS
Ga0137361_1104749513300012362Vadose Zone SoilMKHILIATSNPGKLRDFAGAAAGYGIEVQTLPNFGSLPV
Ga0137373_1129643813300012532Vadose Zone SoilMKRVLVATSNAGKIRDFAGAASRFEVEIVPLPNLASFPA
Ga0137358_1000529213300012582Vadose Zone SoilMNFLAMRKALIATSNPGKFRDFAGAASHHGIEVAPIPNFASLPLAS*
Ga0137398_1075575823300012683Vadose Zone SoilMRRILIATSNPGKLRDFAGAASAQEIEVEPVPNFSS
Ga0137395_1084740313300012917Vadose Zone SoilMKRILVATSNAGKIRDFAGAASRYGIEVLPVPNFSSL
Ga0137404_1136199713300012929Vadose Zone SoilMQKILIATSNAGKLRDFAGAATRHGVEVQGLPGFAALA
Ga0137407_1223612813300012930Vadose Zone SoilMPTVLIATSNSGKLGDFAGAAKAFGIEIASLPNFSSLTPV
Ga0137410_1001413913300012944Vadose Zone SoilMKSRVLVATSNPGKLSDFAGAAEAHEVEIVPIPNFASL
Ga0164299_1029710713300012958SoilMTRVLIATSNAGKVRDFAGAAAQYGIVVEVIPNFA
Ga0164305_1192579123300012989SoilMIRILIATTNAGKLRDFAGIASPHGIEIESLPNFASIPTAVEDGL
Ga0157374_1274249023300013296Miscanthus RhizosphereMRRILIATSNPGKLRDFAGAASSLEIEVASVPNFASLE
Ga0182018_1016062213300014489PalsaMSQQRILIATSSPGKLRDFAGAAAAHGIEIASLPN
Ga0167658_108815713300015195Glacier Forefield SoilMRRILIATSNSGKLRDFAGAASQHGVEVAAIPDFA
Ga0137409_1002852563300015245Vadose Zone SoilMKSRVLVATSNPGKLSDFAGAAEAHEVEIVPIPNFASLP
Ga0132255_10338950913300015374Arabidopsis RhizosphereVSTKRILIATSNPGKLRDFAGAAASHGVAVAALPN
Ga0182041_1090647013300016294SoilMKKILVATSNPGKLRDFAGAAAAHGVAIAPIPSFSS
Ga0187803_1001690833300017934Freshwater SedimentMERRVLVATSNAGKLRDFAGAAAPYGIMIANIPHFAFQPEVVE
Ga0187848_1022317123300017935PeatlandMTARTVLLATSNSGKIRDFGGAAAPYGITVANIPHFASLPEVV
Ga0187809_1039957923300017937Freshwater SedimentMKRVLIATSNAGKLRDFAGAAAPHGIEIASIPNFTSL
Ga0187808_1002277913300017942Freshwater SedimentMRRVLIATSNPGKLRDFAGAAAAHGITVASLPNLDS
Ga0187783_1085816913300017970Tropical PeatlandMKRVLIATTNPGKLRDFQGAAAPFDLEIASLPNSL
Ga0187777_1142013813300017974Tropical PeatlandMTKTVLIATSNLGKLRDFAGAAASHGIEVEGLPGLASLPVVVE
Ga0187782_1051230613300017975Tropical PeatlandMKRVLVATSNPGKLRDFAGAAAALAIEVAPIPNFA
Ga0187870_107906113300017998PeatlandMTARTVLLATSNAGKLRDFAGAAAPFGITVANIPH
Ga0187868_116333513300018002PeatlandMSLRTVLLATSNPGKLRDFAGAAAPYGITIANIPHFSSLPEV
Ga0187873_107259013300018013PeatlandMQRRVLVATSNAGKLRDFAGAAAPYGIAIANVPHFASLPEV
Ga0187882_130287123300018021PeatlandMQRRVLVATSNAGKLRDFAGAAAPYGIPIANVPHFASLP
Ga0187881_1018039923300018024PeatlandMQRRVLVATSNAGKLRDFAGAAAPYGIPIANVPHFASLPEVVE
Ga0187857_1055747513300018026PeatlandMERRVLVATSNAGKLRDFAGAATPYGITISNLPHFASLPEV
Ga0187855_1053576613300018038PeatlandMHHPILLATSNPGKLRDFARAAASFGIDIANIPNFSSL
Ga0187862_1026579223300018040PeatlandMTSRTVLLATSNAGKLRDFAGAAAPYGITIANIPHFSSLP
Ga0187784_1025080313300018062Tropical PeatlandMTRHILIATSNQGKLRDFAGAAAAFAIEVRSIPDFAS
Ga0187769_1081438923300018086Tropical PeatlandMTSRTVLLATSNAGKLRDFAGAAARYGVTIANIPHFASL
Ga0187771_1054614523300018088Tropical PeatlandMKQHAVLVATSNAGKLRDFAGAAAACDITIAAIPGFSSLP
Ga0187771_1155566113300018088Tropical PeatlandMNLRRVLIATSNAGKLRDFAGAAAAHGVTVAGIPGFSTLAPVV
Ga0187770_1020267823300018090Tropical PeatlandMHLQILLATSNPGKLRDFAGAAAPYGITIANIPHFASLPKVV
Ga0066662_1080437813300018468Grasslands SoilMTRRVITIATSNPGKLRDFEGAAAAFGVEVRALAGFSALPP
Ga0193723_111719113300019879SoilMQRVLIATSNPGKLRDFAGAALPHGIEIVSLSNLASLPEV
Ga0210396_1076082023300021180SoilVMRKILIATSNPGKLRDFAGAALQHEVEIGAMSDFASLPAV
Ga0210393_1081999823300021401SoilMSKILIATSNSGKLRDFAGIAAPLQLEILPLPNFMSLPAV
Ga0210389_1020515023300021404SoilMRRILIATSNAGKLRDFAGAAAVHGIEIAGIPNFSS
Ga0210387_1136768823300021405SoilMTTNRILIATSNPGKLRDFAGAAAPLGIEIASIPN
Ga0210391_1100609413300021433SoilMRKILIATSNPGKLRDFAGAASRHNVEITGIPDFSS
Ga0210402_1135011113300021478SoilMTTHPVLIATSNPGKLREFAGVATAFGVPITSIPSFSSLSPVV
Ga0210410_1041097313300021479SoilMNRILIATSNAGKLRDFAGAAASLGIEIAPLPNFASL
Ga0210409_1003968913300021559SoilMNRILIATSNAGKLRDFAGAAASLGIEIAPLPNFASLP
Ga0208188_107831023300025507PeatlandMQRRVLVATSNAGKLRDFAGAAAPYGIPIANVPHFASLPE
Ga0207680_1059318313300025903Switchgrass RhizosphereMKDILIATSNPGKLRDFAVAASAHGLTVMGIPNFSSLPP
Ga0207671_1076696913300025914Corn RhizosphereVIADHFFMTRVLIATSNAGKVRDFAGAAAQYGIVVEVIPNFASMPAV
Ga0207679_1113498513300025945Corn RhizosphereMKHILIATSNQGKLRDFAGAAKSHGVEVRGVPGFSSIPPA
Ga0208144_100418423300026040Natural And Restored WetlandsMPRVLVATSNAGKLRDFAGVAALHGVQVEGVPDLDSLPP
Ga0209863_1023525223300026281Prmafrost SoilMIRVLIATTNPGKLRDFAGAASPLGIEIEALPNFAS
Ga0257177_108805613300026480SoilMLHRKMANRVLMATSNAGKLRDFAGAAVPYGITIANI
Ga0179587_1084115423300026557Vadose Zone SoilMDHILIATSNAGKLRDFVGAAAPLSIEIVPLPNFSSLPA
Ga0209283_1001284553300027875Vadose Zone SoilMLHRKMANRVLMATSNAGKLRDFAGAAVPHGITIANIAHFS
Ga0209169_1034844713300027879SoilMLCPMKRILIATSNAGKLRDFAGAAVGYGVEISGI
Ga0209415_1026633213300027905Peatlands SoilMRRVLIATSNPGKLRDFAGAAVAHGITVASLPDLDS
Ga0209698_1033034123300027911WatershedsMMKRVLVATSNAGKLRDLAGAALPFGIEIAGLPGFGSLEPVVED
Ga0255356_104333143300028084SoilMRVLIATSNKGKLRDFAGAANIYAIHVMELPNFASLPEA
Ga0302152_1013792023300028572BogMRVLIATSNPGKLRDFAGAGAVYEITIEGLQNFPALP
Ga0302152_1016816113300028572BogMTPISRTVLLATSNAGKLRDFAGAAQPVGIAVANIPHFASLPP
Ga0302171_1001352313300028651FenMTPRTVLVATSNAGKLRDFAGAAQAHGIKIASIPTFPSLPPVV
Ga0302225_1020189013300028780PalsaMTSPTVLLATSNPGKLRDFAGAASRYNVTVANIPH
Ga0307504_1030325923300028792SoilMKKILIATSNSGKLRDFAGAAASHGIEIAPIPNFAS
Ga0265338_1065906633300028800RhizosphereMAHCILVATSNAGKLRDFSGAAAAYGITIASIPYFSSLPEVV
Ga0302228_1053342323300028808PalsaMRRILIATSNSGKLRDFAGAALQHGVEIAGIPDFSSLP
Ga0311359_1041648113300029914BogMTVRVVLLATSNAGKLRDFAGAAEAFGVAVANIPGFA
Ga0311342_1070731623300029955BogMNRIFIATSNSGKLRDFAGAAKALGITIEALPGFS
Ga0311338_1144202113300030007PalsaVKRKILIATSNAGKLRDFAGAAARHGIEIAGIPEF
Ga0316363_1029537123300030659Peatlands SoilMQRRVLVATSNAGKLRDLAGAAAPYGIMIATIPNFSSLPQVVEDG
Ga0318542_1007382123300031668SoilMNLVLIATSNPGKLRDFAGAARNHGITVSGIPNFASLPA
Ga0318561_1054367723300031679SoilMSAVPQGTVKRVLIATSNAGKLRDFAGAAAAHGVEIA
Ga0307474_1088911923300031718Hardwood Forest SoilMKKIYVATSNPGKLRDFAGAAAAHHVVVASIPDFAKLDP
Ga0307469_1031527923300031720Hardwood Forest SoilMRKIQIATSNPGKLRDFAGAASAHNVEVAPIPNFASLQ
Ga0307473_1017799413300031820Hardwood Forest SoilMTARRVLVATSNPGKLRDFAGTAEAHGISIAAIPNFSSL
Ga0318564_1032265323300031831SoilMNLVLIATSNPGKLRDFAGAARNHGITVSGIPNFASLPAVVE
Ga0306923_1026898223300031910SoilMSAVPQGTVKRVLIATSNAGKLRDFAGAAAAHGVEI
Ga0318506_1021672423300032052SoilMSAVPQGTVKRVLIATSNAGKLRDFAGAAAAHGVE
Ga0311301_1262321523300032160Peatlands SoilMQRRVLVATSNAGKLRDFAGAAAPYGIPIANVPHFASLPEVV
Ga0307470_1065860413300032174Hardwood Forest SoilMKKILITTSNPGKLRDFAGAAVAHDIEITAIPNLAALPVV
Ga0307471_10052884023300032180Hardwood Forest SoilVKRVLIATSNPGKLRDFAGAAAAFGVEITSIPGMSSLP
Ga0307472_10007078613300032205Hardwood Forest SoilMVSPKMVNRVLMASSNAGKLRDFAGAAAPYGITIANIPHFSSLPQVLED
Ga0310812_1003160313300032421SoilMTRVLIATSNPGKLRDFAGAAAPLGITIESLPNFA
Ga0335079_1029247833300032783SoilMKHGWIATSNPGKLRDFSGAAAGFGIEVQGIPNFADLPPV
Ga0335069_1023036743300032893SoilVLIASSNSGKLRDFSAAAREHGVEVALIPNFAEIPE
Ga0335077_1184879713300033158SoilMRSVLIATSNSGKLRDFAGAAAALAIEIKTIPSFSSL
Ga0326726_1235695623300033433Peat SoilMKPAFIATSNPGKLRDFAGAARPYGIEVKSIPDFSSLPT
Ga0370483_0276851_469_5763300034124Untreated Peat SoilMPKMMRKILIATSNPGKLRDFAGAALRHGVEVAGIP
Ga0364932_0110422_938_10423300034177SedimentMQVLIATSNQGKLRDFAGAAAVHGIEVEGLRDFAG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.