NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F087646

Metagenome Family F087646

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087646
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 46 residues
Representative Sequence PTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK
Number of Associated Samples 97
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.91 %
% of genes near scaffold ends (potentially truncated) 94.55 %
% of genes from short scaffolds (< 2000 bps) 92.73 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.182 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.454 % of family members)
Environment Ontology (ENVO) Unclassified
(24.545 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.32%    β-sheet: 0.00%    Coil/Unstructured: 75.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF01557FAA_hydrolase 44.55
PF00903Glyoxalase 11.82
PF13343SBP_bac_6 1.82
PF00355Rieske 1.82
PF00596Aldolase_II 0.91
PF01370Epimerase 0.91
PF13449Phytase-like 0.91



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.18 %
UnclassifiedrootN/A11.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig515474All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria607Open in IMG/M
2170459021|G14TP7Y02JZFY2All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium555Open in IMG/M
3300000443|F12B_10214213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria594Open in IMG/M
3300000580|AF_2010_repII_A01DRAFT_1043014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria698Open in IMG/M
3300000837|AP72_2010_repI_A100DRAFT_1011941All Organisms → cellular organisms → Bacteria → Proteobacteria1224Open in IMG/M
3300001991|JGI24743J22301_10119860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria576Open in IMG/M
3300002155|JGI24033J26618_1059707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria559Open in IMG/M
3300002459|JGI24751J29686_10025328Not Available1231Open in IMG/M
3300002914|JGI25617J43924_10002748All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales4938Open in IMG/M
3300004114|Ga0062593_102891841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria549Open in IMG/M
3300004463|Ga0063356_100084829All Organisms → cellular organisms → Bacteria → Proteobacteria3366Open in IMG/M
3300004463|Ga0063356_104906152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria575Open in IMG/M
3300004633|Ga0066395_10302095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria875Open in IMG/M
3300005332|Ga0066388_100494769All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1859Open in IMG/M
3300005338|Ga0068868_101328627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria668Open in IMG/M
3300005365|Ga0070688_100396411All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1021Open in IMG/M
3300005439|Ga0070711_101427700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria603Open in IMG/M
3300005540|Ga0066697_10475914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria713Open in IMG/M
3300005548|Ga0070665_101367044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria717Open in IMG/M
3300005560|Ga0066670_10787064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria576Open in IMG/M
3300005564|Ga0070664_100836685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria861Open in IMG/M
3300005764|Ga0066903_102427005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha11_Bin11014Open in IMG/M
3300005764|Ga0066903_102786533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha11_Bin1948Open in IMG/M
3300005764|Ga0066903_105706048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria654Open in IMG/M
3300005764|Ga0066903_105737764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria652Open in IMG/M
3300006173|Ga0070716_100668706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria790Open in IMG/M
3300006186|Ga0075369_10545443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria553Open in IMG/M
3300006195|Ga0075366_10529637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria729Open in IMG/M
3300006755|Ga0079222_12273006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria541Open in IMG/M
3300006796|Ga0066665_10128206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1900Open in IMG/M
3300007255|Ga0099791_10660804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria513Open in IMG/M
3300009089|Ga0099828_10383718All Organisms → cellular organisms → Bacteria → Proteobacteria1267Open in IMG/M
3300009792|Ga0126374_10243685Not Available1169Open in IMG/M
3300010046|Ga0126384_10324293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1275Open in IMG/M
3300010046|Ga0126384_10544337Not Available1008Open in IMG/M
3300010047|Ga0126382_10450918Not Available1020Open in IMG/M
3300010159|Ga0099796_10121254Not Available1005Open in IMG/M
3300010336|Ga0134071_10526542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria612Open in IMG/M
3300010359|Ga0126376_10993011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria839Open in IMG/M
3300010359|Ga0126376_12735384All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300010360|Ga0126372_12890740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria532Open in IMG/M
3300010361|Ga0126378_11952582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria668Open in IMG/M
3300010398|Ga0126383_11275831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria824Open in IMG/M
3300012207|Ga0137381_10986368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria727Open in IMG/M
3300012208|Ga0137376_10077244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2784Open in IMG/M
3300012469|Ga0150984_108162257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria558Open in IMG/M
3300012908|Ga0157286_10126139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria787Open in IMG/M
3300012917|Ga0137395_10516900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha11_Bin1860Open in IMG/M
3300012924|Ga0137413_10107183All Organisms → cellular organisms → Bacteria → Proteobacteria1755Open in IMG/M
3300012948|Ga0126375_10239776Not Available1220Open in IMG/M
3300012960|Ga0164301_10067064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1927Open in IMG/M
3300012971|Ga0126369_10355673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1488Open in IMG/M
3300012971|Ga0126369_12007756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria666Open in IMG/M
3300012971|Ga0126369_13346857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria525Open in IMG/M
3300014150|Ga0134081_10302663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria574Open in IMG/M
3300016294|Ga0182041_11263197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria675Open in IMG/M
3300016341|Ga0182035_11065704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria718Open in IMG/M
3300016357|Ga0182032_12047599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300018028|Ga0184608_10060385All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1516Open in IMG/M
3300018433|Ga0066667_10980951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria729Open in IMG/M
3300018433|Ga0066667_11637161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria575Open in IMG/M
3300018468|Ga0066662_10217679Not Available1528Open in IMG/M
3300018476|Ga0190274_10829045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria985Open in IMG/M
3300018482|Ga0066669_11275859All Organisms → cellular organisms → Bacteria → Proteobacteria664Open in IMG/M
3300019873|Ga0193700_1058496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria594Open in IMG/M
3300022756|Ga0222622_10289864Not Available1123Open in IMG/M
3300025321|Ga0207656_10080142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1466Open in IMG/M
3300025903|Ga0207680_10803424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria674Open in IMG/M
3300025930|Ga0207701_10215287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1684Open in IMG/M
3300025960|Ga0207651_10037060All Organisms → cellular organisms → Bacteria3191Open in IMG/M
3300026088|Ga0207641_11897124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300026320|Ga0209131_1086565Not Available1679Open in IMG/M
3300026499|Ga0257181_1077907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria573Open in IMG/M
3300026552|Ga0209577_10413348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria964Open in IMG/M
3300026552|Ga0209577_10592081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria672Open in IMG/M
3300027383|Ga0209213_1011971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1582Open in IMG/M
3300027616|Ga0209106_1148310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria523Open in IMG/M
3300027663|Ga0208990_1042699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1389Open in IMG/M
3300027671|Ga0209588_1021430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2030Open in IMG/M
3300027738|Ga0208989_10061711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1291Open in IMG/M
3300027846|Ga0209180_10144089Not Available1371Open in IMG/M
3300027882|Ga0209590_10294618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha11_Bin11041Open in IMG/M
3300027909|Ga0209382_10200909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2285Open in IMG/M
3300028047|Ga0209526_10586592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria716Open in IMG/M
3300028380|Ga0268265_12449021All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria528Open in IMG/M
3300028790|Ga0307283_10130445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria680Open in IMG/M
3300028793|Ga0307299_10386892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria524Open in IMG/M
3300031446|Ga0170820_14834510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria697Open in IMG/M
3300031469|Ga0170819_13312132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria759Open in IMG/M
3300031549|Ga0318571_10100926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha11_Bin1944Open in IMG/M
3300031564|Ga0318573_10170058Not Available1148Open in IMG/M
3300031564|Ga0318573_10417266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria721Open in IMG/M
3300031736|Ga0318501_10050272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1945Open in IMG/M
3300031736|Ga0318501_10517702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria651Open in IMG/M
3300031748|Ga0318492_10392050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria730Open in IMG/M
3300031769|Ga0318526_10272406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria692Open in IMG/M
3300031819|Ga0318568_10857371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria562Open in IMG/M
3300031879|Ga0306919_10093842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2096Open in IMG/M
3300031880|Ga0318544_10039309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1676Open in IMG/M
3300031890|Ga0306925_11417832All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. KK5684Open in IMG/M
3300031892|Ga0310893_10546727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria524Open in IMG/M
3300031893|Ga0318536_10006888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-484661Open in IMG/M
3300031897|Ga0318520_10594711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria687Open in IMG/M
3300031946|Ga0310910_10167461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1690Open in IMG/M
3300031946|Ga0310910_10591962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria879Open in IMG/M
3300032051|Ga0318532_10069424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1225Open in IMG/M
3300032094|Ga0318540_10134472Not Available1179Open in IMG/M
3300032261|Ga0306920_101071258Not Available1170Open in IMG/M
3300033290|Ga0318519_10348810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria874Open in IMG/M
3300033550|Ga0247829_10298591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1307Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.82%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.45%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.45%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.55%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.64%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.73%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.82%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.82%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.82%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.82%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.91%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.91%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.91%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.91%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2170459021Litter degradation NP4EngineeredOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000837Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100EnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300002155Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7Host-AssociatedOpen in IMG/M
3300002459Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6Host-AssociatedOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006186Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4Host-AssociatedOpen in IMG/M
3300006195Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027616Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027663Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_068431902124908045SoilGRIPTRHDVPVNPTYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK
4NP_025083202170459021Switchgrass, Maize And Mischanthus LitterADVPVNPSDVSERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR
F12B_1021421323300000443SoilKRGRMPARSDVPINPAHVSDRLKDRKIIATIFGGDEQRKWQGLFKEIFTPK*
AF_2010_repII_A01DRAFT_104301413300000580Forest SoilPAYVSDRLKDRKIIATIFGGQEQKKWQGLFKDIFRXR*
AP72_2010_repI_A100DRAFT_101194113300000837Forest SoilDVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK*
JGI24743J22301_1011986023300001991Corn, Switchgrass And Miscanthus RhizosphereLSRRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR*
JGI24033J26618_105970713300002155Corn, Switchgrass And Miscanthus RhizosphereMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR*
JGI24751J29686_1002532823300002459Corn, Switchgrass And Miscanthus RhizosphereLTRRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR*
JGI25617J43924_1000274813300002914Grasslands SoilVNPTYVSERLKDRKIIATIFAGEEQRKWQGLFKVIFKPR*
Ga0062593_10289184123300004114SoilLTKRGRMPTRADVPVNPSDVSERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR*
Ga0063356_10008482933300004463Arabidopsis Thaliana RhizosphereVPVNPPHVTDVLKDRKIIATIFAGDEQKKWQGLFKEIFRAR*
Ga0063356_10490615213300004463Arabidopsis Thaliana RhizospherePVNPTYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPR*
Ga0066395_1030209523300004633Tropical Forest SoilHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKSK*
Ga0066388_10049476933300005332Tropical Forest SoilDVPVNPADITDRLKDRKIIATIFSGEDQKKWQGLFKNIFKPK*
Ga0068868_10132862723300005338Miscanthus RhizosphereFLTRRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR*
Ga0070688_10039641123300005365Switchgrass RhizosphereMPTRADVPVNPSDVSERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR*
Ga0070711_10142770023300005439Corn, Switchgrass And Miscanthus RhizosphereDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK*
Ga0066697_1047591413300005540SoilKRGRMPTRADVPVNPADVTDRLKDRTIIATIFAGEEQKKWQGLFKDIFKPK*
Ga0070665_10136704413300005548Switchgrass RhizosphereAEQFLTRRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR*
Ga0066670_1078706423300005560SoilPHVQDLLQGKKIVATIFAGEEQKKWQGLFREIFKPR*
Ga0070664_10083668513300005564Corn RhizospherePAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR*
Ga0066903_10242700513300005764Tropical Forest SoilLTTRGRIPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK*
Ga0066903_10278653313300005764Tropical Forest SoilVAEMLKERKIIATIFAGEEQKKWQGLFKDIFKQR*
Ga0066903_10570604823300005764Tropical Forest SoilTRQDVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKEIFKPK*
Ga0066903_10573776423300005764Tropical Forest SoilPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKEIFKPK*
Ga0070716_10066870623300006173Corn, Switchgrass And Miscanthus RhizosphereQFLTRRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR*
Ga0075369_1054544313300006186Populus EndosphereVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR*
Ga0075366_1052963723300006195Populus EndosphereFLTRRGRMPTRTDVPVNPAHMSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR*
Ga0079222_1227300613300006755Agricultural SoilKRGRMPTRADVPVNPSDVSERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR*
Ga0066665_1012820633300006796SoilPTRADVPVNPADVTDRLKDRTIIATIFAGEEQKKWQGLFKDIFKPK*
Ga0099791_1066080423300007255Vadose Zone SoilKRGRMPTRTDVPVNPAEVTDRLKDRTIIATIFAGEEQKKWQGLFKDIFKPK*
Ga0099828_1038371833300009089Vadose Zone SoilVTDVLKDRKIIATIFAGEEQKKWQGLFKEIFRSR*
Ga0126374_1024368523300009792Tropical Forest SoilPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK*
Ga0126384_1032429333300010046Tropical Forest SoilDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKEIFKPK*
Ga0126384_1054433713300010046Tropical Forest SoilMPTRTDVPVNPPAVAEMLKERKIIATIFAGEEQKKWQGLFKDIFKAR*
Ga0126382_1045091823300010047Tropical Forest SoilVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK*
Ga0099796_1012125423300010159Vadose Zone SoilPTYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPR*
Ga0134071_1052654213300010336Grasslands SoilMPTRHDVTVNPPSVSEALKGKEIIATIFAGEEQKKWQGLFKEIFRPR*
Ga0126376_1099301113300010359Tropical Forest SoilRQDVPVNPAYVSERLKDRKIIATIFAGDGQKKWQGLFKDIFKPK*
Ga0126376_1273538433300010359Tropical Forest SoilPHVSEMLKGRKIIATIFAGEEQKKWQGLFKDIFKPR*
Ga0126372_1289074023300010360Tropical Forest SoilAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKSK*
Ga0126378_1195258213300010361Tropical Forest SoilHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK*
Ga0126383_1127583123300010398Tropical Forest SoilMTTRGRMPTRHDVRVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFRPK*
Ga0137381_1098636813300012207Vadose Zone SoilRGRMPTRADVPVNPADITDRLKERTIIATIFSGEEQKKWQGLFKDIFKPK*
Ga0137376_1007724413300012208Vadose Zone SoilDVPVNPTYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPR*
Ga0150984_10816225713300012469Avena Fatua RhizospherePVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR*
Ga0157286_1012613913300012908SoilRADVPVNPSDVSERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR*
Ga0137395_1051690013300012917Vadose Zone SoilPGVTEILMERKIIATIFAGEEQKKWQGLFKQIFKSR*
Ga0137413_1010718323300012924Vadose Zone SoilVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR*
Ga0126375_1023977623300012948Tropical Forest SoilLTKRGRMPTRQDVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK*
Ga0164301_1006706413300012960SoilTRTDVPVNPAHVSERLKERKIVATIFAGEEQKKWQGLFKEIFKPR*
Ga0126369_1035567333300012971Tropical Forest SoilQLLTRRGRMPTRLDVPVNPAHVGDMLKERKIIATIFAGDEQKKWQGLFKDIFKPR*
Ga0126369_1200775623300012971Tropical Forest SoilPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK*
Ga0126369_1334685723300012971Tropical Forest SoilEQFLTTRGRMPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK*
Ga0134081_1030266313300014150Grasslands SoilVTDRLKDRTIIATIFAGEEQKKWQGLFKDIFKPK*
Ga0182041_1126319713300016294SoilNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFRPK
Ga0182035_1106570413300016341SoilTMRGRMPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFRPK
Ga0182032_1204759923300016357SoilRGRMPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKSK
Ga0184608_1006038513300018028Groundwater SedimentRMPTRADVQVNPAGVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR
Ga0066667_1098095113300018433Grasslands SoilPVNPADVTDRLKDRTIIATIFSGQEQKKWQGLFKDVFKPN
Ga0066667_1163716123300018433Grasslands SoilVPINPTYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK
Ga0066662_1021767913300018468Grasslands SoilNPPHVSDVLKGRQIIATIFAGEEQKKWQGLFREIFKPR
Ga0190274_1082904523300018476SoilPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR
Ga0066669_1127585933300018482Grasslands SoilMPTRADVPVNPADITDRLKERTIIATIFSGEEQKKWQGLFKDVFKPK
Ga0193700_105849623300019873SoilGVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR
Ga0222622_1028986423300022756Groundwater SedimentELFLTKRGRMPTREDVPINPPQVGDMLKERKIVATIFAGEEQKKWQGLFKDIFRPR
Ga0207656_1008014213300025321Corn RhizosphereTRTDEPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR
Ga0207680_1080342423300025903Switchgrass RhizosphereTRADVPVNPSDVSERLNDRKIIATIFAGDAQKKWQGLFKEIFRPR
Ga0207701_1021528713300025930Corn, Switchgrass And Miscanthus RhizosphereRRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR
Ga0207651_1003706013300025960Switchgrass RhizosphereEQFLTGRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR
Ga0207641_1189712423300026088Switchgrass RhizosphereMPTRADVPVNPSDVSERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR
Ga0209131_108656523300026320Grasslands SoilTDVPVNPAEVTDRLKDRTIIATIFAGEEQKKWQGLFKDIFRPK
Ga0257181_107790723300026499SoilYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK
Ga0209577_1041334813300026552SoilQFLTKSGRMPTRRDVAINPPHVQDLLQGKKIVATIFAGEEQKKWQGLFREIFKPR
Ga0209577_1059208123300026552SoilDVPVNPADVTDRLKDRTIIATIFAGEEQKKWQGLFKDIFKPK
Ga0209213_101197133300027383Forest SoilFLTRRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFRPR
Ga0209106_114831023300027616Forest SoilRMPTREDVPVNPPQVGDMLKERKIVATIFAGEEQKRWQGLFKDIFRPR
Ga0208990_104269933300027663Forest SoilTKRGRMPTRTDVPINPPHVSERLKERKIIATIFAGEEQKKWQGLFKEIFRPR
Ga0209588_102143013300027671Vadose Zone SoilFREFLTTRGRMPTRHDVPVNPTYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK
Ga0208989_1006171113300027738Forest SoilTREDVPVNPPQVGDMLKERKIVATIFAGEEQKRWQGLFKDIFRPR
Ga0209180_1014408913300027846Vadose Zone SoilQFLTQRGRMPTRPDVPVNPPAAAERLKGKKIIATIFAGEEQKRWQGLFKEIFKQR
Ga0209590_1029461823300027882Vadose Zone SoilFLTRRGRMPTRPDVPVNPPHVTDVLKDRKIIATIFAGEEQKKWQGLFKEIFRSR
Ga0209382_1020090913300027909Populus RhizosphereVNPSDVSERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR
Ga0209526_1058659223300028047Forest SoilMPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKPK
Ga0268265_1244902123300028380Switchgrass RhizospherePVNPSDVGERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR
Ga0307283_1013044523300028790SoilADVQVNPAGVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR
Ga0307299_1038689213300028793SoilGRMPTREDVPVNPPQVGDMLKERKIVATIFAGEEQKKWQGLFKDIFRPR
Ga0170820_1483451013300031446Forest SoilRGRMPTRADVQVNPADVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR
Ga0170819_1331213223300031469Forest SoilEAEQFLTRRGRMPTRTDVPVNPAHVSERLKERKIIATIFAGEEQKKWQGLFKEIFKPR
Ga0318571_1010092613300031549SoilVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK
Ga0318573_1017005813300031564SoilNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK
Ga0318573_1041726613300031564SoilVLVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK
Ga0318501_1005027213300031736SoilQFLTKRGRMPTRQNVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK
Ga0318501_1051770213300031736SoilLLTKRGRMPTRPDVPINPAYVSDRLKDRKIIATIFGGQEQKKWQGLFKDIFRPR
Ga0318492_1039205013300031748SoilMPTRQDVPVNPPYVQEVLKGREIIATIFAGEEQKKWQGLFKEIFKPR
Ga0318526_1027240623300031769SoilEQFLTKRGRMPTRHDVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK
Ga0318568_1085737113300031819SoilQFLTTRGRMPTRHDVRVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFRPK
Ga0306919_1009384213300031879SoilTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKSK
Ga0318544_1003930913300031880SoilKRGRMPTRQDVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK
Ga0306925_1141783233300031890SoilPDVPVNPPSVTEALLERKVIATIFTGEEQKKWQGLFKQIFKPR
Ga0310893_1054672713300031892SoilGRMPTRADVPVNPSDVSERLNDRKIIATIFAGEAQKKWQGLFKEIFRPR
Ga0318536_1000688873300031893SoilYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK
Ga0318520_1059471123300031897SoilGNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFRPK
Ga0310910_1016746133300031946SoilDVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK
Ga0310910_1059196223300031946SoilMPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIF
Ga0318532_1006942433300032051SoilQDVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK
Ga0318540_1013447213300032094SoilFLTTRGRMPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQKKWQGLFKDIFKSK
Ga0306920_10107125823300032261SoilRIPTRHDVPVNPAYVSERLKDRKIIATIFAGEEQRKWQGLFKDIFKSK
Ga0318519_1034881023300033290SoilQFLTKRGRMPTRQDVPVNPAYVSERLKDRKIIATIFAGDEQKKWQGLFKDIFKPK
Ga0247829_1029859113300033550SoilDVPVNPAHVSERLKERKIVATIFAGEEQKKWQGLFKEIFKPR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.