NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087667

Metagenome / Metatranscriptome Family F087667

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087667
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 51 residues
Representative Sequence QARDPFRDFERDFELKTALSQKLMTLAADGVTDPIELREWALEGLLLR
Number of Associated Samples 102
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.96 %
% of genes near scaffold ends (potentially truncated) 78.18 %
% of genes from short scaffolds (< 2000 bps) 90.91 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.66

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.636 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.454 % of family members)
Environment Ontology (ENVO) Unclassified
(25.455 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.818 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.68%    β-sheet: 0.00%    Coil/Unstructured: 51.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.66
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF09361Phasin_2 29.09
PF04773FecR 8.18
PF00571CBS 6.36
PF12244DUF3606 2.73
PF00313CSD 1.82
PF00171Aldedh 1.82
PF12625Arabinose_bd 1.82
PF00072Response_reg 0.91
PF00118Cpn60_TCP1 0.91
PF08386Abhydrolase_4 0.91
PF00574CLP_protease 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 1.82
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.82
COG0740ATP-dependent protease ClpP, protease subunitPosttranslational modification, protein turnover, chaperones [O] 1.82
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 1.82
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 1.82
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.91
COG1030Membrane-bound serine protease NfeD, ClpP classPosttranslational modification, protein turnover, chaperones [O] 0.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.64 %
UnclassifiedrootN/A26.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_17497182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1381Open in IMG/M
3300000559|F14TC_100433312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1155Open in IMG/M
3300001904|JGI24736J21556_1043697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales688Open in IMG/M
3300001976|JGI24752J21851_1025658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales773Open in IMG/M
3300002120|C687J26616_10122707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria825Open in IMG/M
3300003994|Ga0055435_10255964All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales516Open in IMG/M
3300004019|Ga0055439_10305977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales525Open in IMG/M
3300004058|Ga0055498_10060788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales690Open in IMG/M
3300004062|Ga0055500_10074884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales718Open in IMG/M
3300004067|Ga0055485_10040229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1018Open in IMG/M
3300004145|Ga0055489_10307341Not Available510Open in IMG/M
3300004156|Ga0062589_100316290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.1217Open in IMG/M
3300004463|Ga0063356_105477292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium545Open in IMG/M
3300004803|Ga0058862_11078176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium574Open in IMG/M
3300005093|Ga0062594_100030327All Organisms → cellular organisms → Bacteria → Proteobacteria2468Open in IMG/M
3300005290|Ga0065712_10220392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1043Open in IMG/M
3300005330|Ga0070690_100853576Not Available709Open in IMG/M
3300005338|Ga0068868_101220823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium696Open in IMG/M
3300005339|Ga0070660_100433101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1090Open in IMG/M
3300005339|Ga0070660_101011110Not Available702Open in IMG/M
3300005355|Ga0070671_102129912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium500Open in IMG/M
3300005439|Ga0070711_100262747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1359Open in IMG/M
3300005439|Ga0070711_101288337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales634Open in IMG/M
3300005444|Ga0070694_101599452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales553Open in IMG/M
3300005546|Ga0070696_100756637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales796Open in IMG/M
3300005578|Ga0068854_102048258Not Available528Open in IMG/M
3300005614|Ga0068856_102323165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium544Open in IMG/M
3300005719|Ga0068861_102283343Not Available543Open in IMG/M
3300005841|Ga0068863_101187083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales769Open in IMG/M
3300006173|Ga0070716_100142158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1532Open in IMG/M
3300006755|Ga0079222_12467378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium522Open in IMG/M
3300006845|Ga0075421_101479264Not Available744Open in IMG/M
3300006954|Ga0079219_10978469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales698Open in IMG/M
3300009011|Ga0105251_10657881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales501Open in IMG/M
3300009094|Ga0111539_10198195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2342Open in IMG/M
3300009101|Ga0105247_10946073Not Available669Open in IMG/M
3300009148|Ga0105243_10818966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium919Open in IMG/M
3300009153|Ga0105094_10605713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales640Open in IMG/M
3300009156|Ga0111538_13621976Not Available535Open in IMG/M
3300009157|Ga0105092_10035456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter2655Open in IMG/M
3300009168|Ga0105104_10272667All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter926Open in IMG/M
3300009168|Ga0105104_10443017Not Available726Open in IMG/M
3300009174|Ga0105241_11733716Not Available608Open in IMG/M
3300009818|Ga0105072_1048361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales807Open in IMG/M
3300012901|Ga0157288_10018220All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1303Open in IMG/M
3300012904|Ga0157282_10107216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales793Open in IMG/M
3300012958|Ga0164299_10104396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium1480Open in IMG/M
3300012960|Ga0164301_11111065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales629Open in IMG/M
3300012964|Ga0153916_11899156All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300012984|Ga0164309_11950931Not Available503Open in IMG/M
3300012987|Ga0164307_10596675Not Available851Open in IMG/M
3300012987|Ga0164307_11005584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales679Open in IMG/M
3300013096|Ga0157307_1061193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales727Open in IMG/M
3300013306|Ga0163162_13185265Not Available527Open in IMG/M
3300014271|Ga0075326_1202904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium596Open in IMG/M
3300014325|Ga0163163_10410700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1412Open in IMG/M
3300014325|Ga0163163_12496040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium575Open in IMG/M
3300014326|Ga0157380_12734374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium560Open in IMG/M
3300014745|Ga0157377_10867850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.672Open in IMG/M
3300015077|Ga0173483_10042342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1709Open in IMG/M
3300015374|Ga0132255_103271338Not Available690Open in IMG/M
3300016270|Ga0182036_10703664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales817Open in IMG/M
3300018422|Ga0190265_11692449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria743Open in IMG/M
3300018920|Ga0190273_12428661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium500Open in IMG/M
3300019356|Ga0173481_10723882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium540Open in IMG/M
3300019362|Ga0173479_10106701All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300023064|Ga0247801_1085138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium520Open in IMG/M
3300025119|Ga0209126_1034078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1543Open in IMG/M
3300025900|Ga0207710_10746515Not Available514Open in IMG/M
3300025912|Ga0207707_11608439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium511Open in IMG/M
3300025916|Ga0207663_10519110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.927Open in IMG/M
3300025921|Ga0207652_11772912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium522Open in IMG/M
3300025930|Ga0207701_11202732All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium625Open in IMG/M
3300025932|Ga0207690_10282986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1292Open in IMG/M
3300025933|Ga0207706_11714407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium505Open in IMG/M
3300025939|Ga0207665_10240880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.1333Open in IMG/M
3300025939|Ga0207665_10720546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales785Open in IMG/M
3300026075|Ga0207708_11650087Not Available563Open in IMG/M
3300026088|Ga0207641_11279107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales734Open in IMG/M
3300026494|Ga0257159_1079252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales569Open in IMG/M
3300026872|Ga0207785_1015288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium676Open in IMG/M
3300026945|Ga0207743_1028843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium563Open in IMG/M
3300027787|Ga0209074_10106366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales956Open in IMG/M
3300027955|Ga0209078_1215587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales512Open in IMG/M
3300030019|Ga0311348_10429571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales987Open in IMG/M
3300030114|Ga0311333_10247421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1402Open in IMG/M
3300031232|Ga0302323_100995634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales931Open in IMG/M
3300031255|Ga0315554_1094285All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1115Open in IMG/M
3300031276|Ga0307441_1184514Not Available599Open in IMG/M
3300031368|Ga0307429_1162464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales590Open in IMG/M
3300031424|Ga0308179_1017277Not Available764Open in IMG/M
3300031545|Ga0318541_10493636Not Available685Open in IMG/M
3300031847|Ga0310907_10089439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1303Open in IMG/M
3300031890|Ga0306925_12165167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales518Open in IMG/M
3300031910|Ga0306923_11097203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales857Open in IMG/M
3300031941|Ga0310912_11124971Not Available599Open in IMG/M
3300031943|Ga0310885_10622965Not Available600Open in IMG/M
3300031944|Ga0310884_10244488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium978Open in IMG/M
3300031946|Ga0310910_10634826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium846Open in IMG/M
3300031949|Ga0214473_10028854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6504Open in IMG/M
3300032205|Ga0307472_100391115Not Available1159Open in IMG/M
3300033417|Ga0214471_10213107Not Available1584Open in IMG/M
3300033475|Ga0310811_10327803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1738Open in IMG/M
3300034692|Ga0373917_0019546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium895Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.45%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.18%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands5.45%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.73%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.73%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.73%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.73%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.82%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.82%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.82%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.82%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.91%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment0.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.91%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.91%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.91%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.91%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.91%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.91%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300001904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2Host-AssociatedOpen in IMG/M
3300001976Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7Host-AssociatedOpen in IMG/M
3300002120Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2EnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004062Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004067Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004145Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300025119Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026872Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 (SPAdes)EnvironmentalOpen in IMG/M
3300026945Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027955Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031255Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-70EnvironmentalOpen in IMG/M
3300031276Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-20EnvironmentalOpen in IMG/M
3300031368Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-230EnvironmentalOpen in IMG/M
3300031424Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034692Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.3EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_031775702088090014SoilVEVQARDPFRDFERDSELKTAIGQKLSMLAADGVTDPIELREWALEGFLLR
F14TC_10043331213300000559SoilWVEVQARDPFRDFERDSELKTAIGQKLSMLAVDGVTDPIELREWALEGFLLR*
JGI24736J21556_104369713300001904Corn RhizosphereEATWTALQARDPFRDFERDYELKATLRRKLMGLAVDGVTDPIELREWALEGLPR*
JGI24752J21851_102565813300001976Corn, Switchgrass And Miscanthus RhizosphereVEQAFEATWTALQARDPFRDFERDYELKATLRRKLMGLAVDGVTDPIELREWALEGLPR*
C687J26616_1012270723300002120SoilRAFDATWTVLQARDPFRDFDTDNELKTELSHKLSALAADGVTDAIELREWALEGLSGHR*
Ga0055435_1025596413300003994Natural And Restored WetlandsRDPLRDFEQDYELKTALSRKLMGLAADGVTDPIELREWALEGLPR*
Ga0055439_1030597713300004019Natural And Restored WetlandsWTVLQASDPFRDFEQNHELKTALSRKLMGLAADGVTDPIELREWALEGLPR*
Ga0055498_1006078823300004058Natural And Restored WetlandsALGEAFDATWVVLQARDPFRDFERAYELRTALSQKLMTLAADGVTDPIELREWALESLPLN*
Ga0055500_1007488413300004062Natural And Restored WetlandsTVEQAFDAAWTVLQARDPLRDFEQDYELKTALSRKLMGLAADGVTDPIELREWALEGLPR
Ga0055485_1004022933300004067Natural And Restored WetlandsSSWVMLQARNPFRDFERDLDLKSTLSLKLTALAADGVTDPVELREWALESLPLR*
Ga0055489_1030734113300004145Natural And Restored WetlandsLDATWTVLQARDPLRDLEQDYELKTALSRKLIGLAADGVTDRIELREWALEGLPR*
Ga0062589_10031629023300004156SoilVQARDPFRDFERDSELKTAISQKLSMLAVDGVTDPIELREWALEGFLLR*
Ga0063356_10547729213300004463Arabidopsis Thaliana RhizosphereDATWVEVQVRDPFRDFERDSELKTAIDQKLLTLAADGVTDPVELREWALEGLSLR*
Ga0058862_1107817613300004803Host-AssociatedQAFDATWVVVQARDPFRDFERDFELKTALSQKLMMLAAEGVTDPIELREWALEGLLLR*
Ga0062594_10003032713300005093SoilVVLQARDPFRDFERDSELRTALNQKLMTLAADGVTDPIELREWALESILLS*
Ga0065712_1022039233300005290Miscanthus RhizosphereWTALQARDPFRDFERDYELKATLRRKLMGLAVDGVTDPIELREWALEGLPR*
Ga0070690_10085357623300005330Switchgrass RhizosphereFERDLELKTAINQKLCAFARDGVTDPVELREWALESLRLR*
Ga0068868_10122082313300005338Miscanthus RhizosphereDATWVVLQARDPFRDFERIYELRTALSQKLVALAADGVTDPIELREWALEGLPG*
Ga0070660_10043310113300005339Corn RhizosphereLQARDPFRDFERDYELKATLRRKLMGLAVDGVTDPIELREWALEGLPR*
Ga0070660_10101111023300005339Corn RhizosphereVQARDPFRDFERDSELKTAISQKLSMLAVDGVTDPIELRECALECFLLR*
Ga0070671_10212991213300005355Switchgrass RhizosphereFRDFERDLELKTAINQKLCALARDGVTDPVELREWALESLRLR*
Ga0070711_10026274723300005439Corn, Switchgrass And Miscanthus RhizosphereVQARDPFRDFERDSELKTAISQKLSMLAVNGVTDPIELREWALEGFLLR*
Ga0070711_10128833723300005439Corn, Switchgrass And Miscanthus RhizosphereRYPFRDFERDSELKTALGQKLFTLATEGVTDPIELREWALESTLLR*
Ga0070694_10159945223300005444Corn, Switchgrass And Miscanthus RhizosphereQARDPFRDFERDFELKTALSQKLMTLAADGVTDPIELREWALEGLLLR*
Ga0070696_10075663723300005546Corn, Switchgrass And Miscanthus RhizosphereLTQAFDATWVVVQARDPFRDFERDFELKTALSQKLMTLAADGVTDPIELREWALEGLLLR
Ga0068854_10204825823300005578Corn RhizosphereWVEVQARDSFRDFERDLELKTAINQKLCALARDGVTDPVELREWALESLRLR*
Ga0068856_10232316523300005614Corn RhizosphereASWTALQARDPFRDFDRDNELKTDLSQRLAALVADGVTDPIELREWSLESLPLTQ*
Ga0068861_10228334323300005719Switchgrass RhizosphereATWLEVQARDPFRDFERDSELKTAISQKLSMLAVDGVTDPIELREWALEGFLLR*
Ga0068863_10118708323300005841Switchgrass RhizosphereVVQARDPFRDFERDFELKTALSQKLMTLAADGVTDPIELREWALEGLLLR*
Ga0070716_10014215843300006173Corn, Switchgrass And Miscanthus RhizosphereVQARDPFRDFESDSELKTAISQKLSMLAVDGVTDPIELREWALEGFLLR*
Ga0079222_1246737813300006755Agricultural SoilALQARDPFRDFERDYELKTTLRRKLMGLAIDGVTDPIELREWALEGLPR*
Ga0075421_10147926423300006845Populus RhizosphereATWVVLQARDPFRDFDRDSELRTALNQKLRTLVADGVRDPIELREWALESLLLS*
Ga0079219_1097846913300006954Agricultural SoilDRDGRDRFRDFEWDYELKTTLRRKLMGLPVDGVTDPIELGQWALEGLPR*
Ga0105251_1065788123300009011Switchgrass RhizosphereVVVQARDPFRDFERDFELKTALSQKLMTLAADGVTDPIELREWALEGLLLR*
Ga0111539_1019819533300009094Populus RhizosphereVQARDPFRDFERDSELKTAIGQKLSMLAVDGVTDPIELREWALEGFLLR*
Ga0105247_1094607323300009101Switchgrass RhizosphereVQARDPFRDFERDSELKTATSQKLSMLAVDGVTDPIELREWALEGFLLR*
Ga0105243_1081896643300009148Miscanthus RhizosphereQARDPFRDFERDSELRTALNRKLMTLAVDGVTDPIELREWALEGLPR*
Ga0105094_1060571313300009153Freshwater SedimentMLQARDPFRDFERAYELRTALSQKLMTLAADGVTDPIELREWALESLPLN*
Ga0111538_1362197613300009156Populus RhizosphereVEVQARDSFRDFERDLELKTAINQKLCALARDGVTDPVELREWALENLRLR*
Ga0105092_1003545663300009157Freshwater SedimentMVQARDPLRDFERDSELRTALNRKLMTLVANGVTDPVELREWALESLLLS*
Ga0105104_1027266733300009168Freshwater SedimentMVQARDPFRDFDRDSELRTALNRKLMTLVADGVTDPTELREWALESLLLS*
Ga0105104_1044301713300009168Freshwater SedimentMTDAIKEAFEATWVVVQARDPFRDFERDFELRAALSRKLKMLSSEGVSEPVELREWALESLPLN*
Ga0105241_1173371613300009174Corn RhizosphereHLGGVQARDPFRDFERDSELKTAISQKLSMLAVDGVTDPIELREWALEGFLLR*
Ga0105072_104836113300009818Groundwater SandRAFDATWIVLQARDPFRDFDTDNELKTELSHELSALAADGVTDAVELREWALEGLSGHR*
Ga0134127_1107587713300010399Terrestrial SoilPKTAINQKLCALARDGVTDPVELREWALEGLRLR*
Ga0157288_1001822013300012901SoilTWTALQARDPFRDFERDYELKTTLRRKLMGLAVDGVTDPIELREWALEGLPR*
Ga0157282_1010721613300012904SoilWTALQARDPFRDFERDYEWKTTLRRKLMGLAVDGVTDPIELREWALEGLPR*
Ga0164299_1010439633300012958SoilPFRDFERDLELKTAINQRLCALTRDGVTDPVELREWTLEGLRLR*
Ga0164301_1111106513300012960SoilFDSSWVVLQARYPFRDFERDSELKTALGQKLFTLATEGVTDPIELREWALESTLLR*
Ga0164301_1123604713300012960SoilVRDPFRDFDKDNDVKSELSHELMGLAAEGVTDPIELREWALESLGGYR*
Ga0153916_1189915613300012964Freshwater WetlandsARDPFGDFERVYELRTALSQKLVALAADGVTDPIELREWALEGLPR*
Ga0164309_1195093113300012984SoilLRQAFNATWVEVQARDPFRDFERDLELKTAINQRLCALTRDGVTDPVELREWTLEGLRLR
Ga0164307_1059667523300012987SoilQAFNAAWVEVQARDSFRDFERDLELKTAINQKLCALARDGVTDPVELREWTLEGLRLR*
Ga0164307_1100558413300012987SoilQWKALQACDPFRDFERGYELKATLRRKLMGLAVDGVTDPIELREWALEGLPR*
Ga0157307_106119313300013096SoilARDPFRDFERDYELKATLRRKLMGLAVDGVTDPIELREWALEGLPR*
Ga0157374_1051071333300013296Miscanthus RhizosphereRDFERDSELKTAIGQKLSMLAADGVTDPIELREWALEGFLLR*
Ga0163162_1318526523300013306Switchgrass RhizosphereARRIMEAEQARDSFRDFERDLELKTAINQKLCALARDGVTDPVELREWALESLRLR*
Ga0075326_120290413300014271Natural And Restored WetlandsMLQTRDPFRDFERDSELKTDIGLKLMALAADGVTDPVELREWALESLPPR*
Ga0163163_1041070043300014325Switchgrass RhizosphereLDALGEAFDAIWVVLHVRDPFRDFERVYELRTALSQKLVALAADGVTDPVELREWALEGLPR*
Ga0163163_1249604013300014325Switchgrass RhizosphereFDATWVVLQARDPFRDFERDSELRTALNQKLMTLAADGVTDPIELREWALESLLLS*
Ga0157380_1273437423300014326Switchgrass RhizosphereRDFERDLELKTAINQKLCALARDGVTDPVELREWALESLRLR*
Ga0157377_1086785013300014745Miscanthus RhizosphereRDPFRDFERDSELKTAIRQKLSMLAVDGVTDPIELREWALEGFLLR*
Ga0173483_1004234213300015077SoilEQAFEATWTALQARDPFRDFERDYELKTTLRRKLKGLAVDGVTDPIELREWALEGLPR*
Ga0132255_10327133813300015374Arabidopsis RhizosphereQARDPFRDFERDSELKIAINQKLWALAMDGVTDAVELREWALEGLRLR*
Ga0182036_1070366423300016270SoilDPFRDLERDSELKTAINQKLWALARDGVTDPVELREWALESLRLR
Ga0190265_1169244923300018422SoilFRDFERDFELRAALSRKLKMLSSEGVSDPVELREWALENLLLS
Ga0190273_1242866123300018920SoilFNATWTALQARDPLRDFEQDYELKIALNRKLMGLAADGVTDPIELREWALEGLPR
Ga0173481_1072388223300019356SoilFNATWTVLQARDPLRDFEQDYELKIALNRKLMGLAADGVTDPIELQEWALEGLPR
Ga0173479_1010670133300019362SoilLQARDPFRDFERDYELKATLRRKLMGLAVDGVTDPIELREWALEGLPR
Ga0173479_1077848923300019362SoilQAFNATWVEVQARDPFRDLERDSALKTAINQKLWALARDGVTDPVELRGP
Ga0247801_108513813300023064SoilVLQAREPLRDFEQDYELKIALNRKLMGLAADGVTDPIELQEWALEGLPR
Ga0209126_103407863300025119SoilFNATWTVLQARDPLRDFEQDYELKIALNRKLMGLAADGVTDPIELREWALEGLPR
Ga0207710_1074651513300025900Switchgrass RhizosphereVQARDPFRDFERDSELKTAISQKLSMLAVDGVTDPIELREWALEGFLLR
Ga0207707_1160843913300025912Corn RhizosphereRDPFRDFERIYELRTALSQKLVALAADGVTDPIELREWALEGLPG
Ga0207663_1051911023300025916Corn, Switchgrass And Miscanthus RhizosphereEVQARDPFRDFERDSELKTAISQKLSMLAVNGVTDPIELREWALEGFLLR
Ga0207652_1177291213300025921Corn RhizosphereGGVQARDPFRDFERDSELKTAISQKLSMLAVDGVTDPIELREWALEGFLLR
Ga0207701_1120273213300025930Corn, Switchgrass And Miscanthus RhizosphereTVLQARDPLHDFEQDYELKIALNRKLMGLAADGVTDPIELQEWALEGLPR
Ga0207690_1028298653300025932Corn RhizosphereARDPFRDFDRDNELKTDLSQRLAALVADGVTDPIELREWSLESLPLTQ
Ga0207706_1171440713300025933Corn RhizosphereADALREAFDATWVVLQARDPFRDFERDSELRTALNQKLMTLAADGVTDPIELREWALESLLLS
Ga0207665_1024088043300025939Corn, Switchgrass And Miscanthus RhizosphereWVEVQARDPFRDFERDSELKTAIGQKLSMLAADGVTDPIELREWALEGFLLR
Ga0207665_1072054613300025939Corn, Switchgrass And Miscanthus RhizosphereEALTQAFDATWVVVQARDPFRDFERDFELKTALSQKLMTLAADGVTDPIELREWALEGLLLR
Ga0207708_1165008723300026075Corn, Switchgrass And Miscanthus RhizosphereLEVQARDPFRDFERDSELKTAISQKLSMLAVDGVTDPIELREWALEGFLLR
Ga0207641_1127910723300026088Switchgrass RhizosphereWVVVQARDPFRDFERDFELKTALSQKLMTLAADGVTDPIELREWALEGLLLR
Ga0257159_107925223300026494SoilVEQAFDATWTVLQARDPLRDFEQDYELKTALSRKLMGLAADGVTDPIELREWALEGLPR
Ga0207785_101528823300026872Tropical Forest SoilTWVKVQARDPFRDFERDSELKTAINQKLWALARDGVTDPVELREWALESLRLR
Ga0207743_102884323300026945Tropical Forest SoilATWVEVQARDPFRDLERDSELKIAINQKLWALARDGVTDPAELREWALESLRLR
Ga0209074_1010636613300027787Agricultural SoilWRALQARDPFRDFERDYELKTTLRRKLMGLAIDGVTDPIELREWALEGLPR
Ga0209078_121558713300027955Freshwater SedimentDPFRDFERAYELRTALSQKLMTLAADGVTDPIELREWALESLPLN
Ga0311348_1042957113300030019FenAALEQAFDATWTVLQARNAFRDFDRDNELQTALSQTLATLAMEGVTDPLELREWALESLPRS
Ga0311333_1024742133300030114FenQARNAFRDFDRDNELQSALSQTLATLAVEGVTDPIELREWALESLPRS
Ga0302323_10099563413300031232FenLQARNAFRDFDRDNELQTALSQTLATLAMEGVTDPLELREWALESLPRS
Ga0315554_109428513300031255Salt Marsh SedimentTFEATWVALQTRDPFRDFESDLELRNALSLKLAALAEDGVTDPVELLERALESLALR
Ga0307441_118451423300031276Salt MarshARDPFRDFESDSDLKATLSRKLLALAANGVTDAVELREGAVEG
Ga0307429_116246413300031368Salt MarshEQAFDATWTVLQARDPLRDFEQDYELKTALNRKLMGLAADGVTDPIELREWALEGLPR
Ga0308179_101727713300031424SoilARDPFRDFDTDNELKTELSHKLSALAADGVTDAIELREWALEGLSGHR
Ga0318541_1049363613300031545SoilDATWVEVQARDPFRDFERDLDLKTALNQKLVALANDGVTDPIELREWALESLLLR
Ga0318521_1063505923300031770SoilLERDSELKTAINQKLWALARDGVTDPVELREWALESLRLR
Ga0310907_1008943933300031847SoilSFRDFERDLELKTAINQKLCALARDGVTDPVELREWALESLRLR
Ga0306925_1216516723300031890SoilQARDPFRDLERDSELKTAINQKLWALARDGVTDPVELREWALESLRLR
Ga0306923_1109720333300031910SoilVEVQARDPFRDLERDSELKTAINQKLWALARDGVTDPVELREWALESLRLR
Ga0310912_1112497123300031941SoilVEVQARDPFRDLERDSELKTAINQKLWALARDGVTDPVELREWALESLQLR
Ga0310885_1062296523300031943SoilRDSFRDFERDLELKTAINQKLCALARDGVTDPVELREWALESLRLR
Ga0310884_1024448813300031944SoilRDPFRDLERDSELKTAINQKLWALARDGVTDPVELREWALESLRLR
Ga0310910_1063482623300031946SoilNATWVEVQARDPFRDLERDSELKTAINQKLWALARDGVTDPVELREWALESLRLR
Ga0214473_1002885473300031949SoilVVLQACNPFRDFESDSELKTALSRKLTTLAADGVTDPVELREWALESLLPDA
Ga0306926_1171947913300031954SoilVEVQARDPFRDLERDSELKTEKLWALARDGVTDPVELR
Ga0307472_10039111513300032205Hardwood Forest SoilQAFNATWVEVQARDSFRDFERDLELKTAINQKLCALARDGVTDPVELREWALESLRLR
Ga0214471_1021310713300033417SoilLQARDPFRDFDTDNELKTELSHKLSALAADGVTDAIELREWALEGLSGHR
Ga0310811_1032780363300033475SoilQARDPFRDFERDYELKTTLRRKLMGLAVDGVTDPIELREWALEGLPR
Ga0373917_0019546_2_1903300034692Sediment SlurryDALREAFDATWVVLQARDPFRDFDRDSELRTALNQRLMTLVADGVTDPVELREWALESLLLS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.