NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087786

Metagenome / Metatranscriptome Family F087786

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087786
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 43 residues
Representative Sequence GAIIGVIMSITMPWEGWSDPQAFVDMFERIDQALNLLEAGLPL
Number of Associated Samples 97
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.91 %
% of genes near scaffold ends (potentially truncated) 91.82 %
% of genes from short scaffolds (< 2000 bps) 96.36 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(25.455 % of family members)
Environment Ontology (ENVO) Unclassified
(20.909 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.091 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.85%    β-sheet: 0.00%    Coil/Unstructured: 59.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF10011DUF2254 14.55
PF12831FAD_oxidored 10.91
PF00652Ricin_B_lectin 6.36
PF03358FMN_red 6.36
PF00440TetR_N 2.73
PF13302Acetyltransf_3 1.82
PF00296Bac_luciferase 1.82
PF00920ILVD_EDD 1.82
PF00072Response_reg 0.91
PF02627CMD 0.91
PF03795YCII 0.91
PF05598DUF772 0.91
PF01989AcnX_swivel_put 0.91
PF04978DUF664 0.91
PF13751DDE_Tnp_1_6 0.91
PF08241Methyltransf_11 0.91
PF07690MFS_1 0.91
PF01545Cation_efflux 0.91
PF02653BPD_transp_2 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0129Dihydroxyacid dehydratase/phosphogluconate dehydrataseCarbohydrate transport and metabolism [G] 3.64
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.82
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.91
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.91
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.91
COG1786Mevalonate 5-phosphate dehydratase subunit 2, swiveling domain (modified mevalonate pathway)Lipid transport and metabolism [I] 0.91
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.91
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.91
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.00 %
UnclassifiedrootN/A40.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559006|FI_contig05961All Organisms → cellular organisms → Bacteria → Terrabacteria group1309Open in IMG/M
2170459021|G14TP7Y02FYKLANot Available561Open in IMG/M
3300003368|JGI26340J50214_10141185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia605Open in IMG/M
3300004092|Ga0062389_102133547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria735Open in IMG/M
3300004152|Ga0062386_101206810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria629Open in IMG/M
3300005334|Ga0068869_101082901Not Available701Open in IMG/M
3300005434|Ga0070709_10656067Not Available813Open in IMG/M
3300005434|Ga0070709_11304935Not Available585Open in IMG/M
3300005434|Ga0070709_11732401Not Available510Open in IMG/M
3300005435|Ga0070714_101425110Not Available676Open in IMG/M
3300005437|Ga0070710_10737072Not Available698Open in IMG/M
3300005456|Ga0070678_100185319All Organisms → cellular organisms → Bacteria1707Open in IMG/M
3300005537|Ga0070730_10555874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales734Open in IMG/M
3300005540|Ga0066697_10673775Not Available568Open in IMG/M
3300005764|Ga0066903_104851500Not Available715Open in IMG/M
3300005843|Ga0068860_101958765Not Available607Open in IMG/M
3300006028|Ga0070717_10896007All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300006028|Ga0070717_11603703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300006163|Ga0070715_10928153Not Available538Open in IMG/M
3300006176|Ga0070765_100074445All Organisms → cellular organisms → Bacteria2860Open in IMG/M
3300006755|Ga0079222_10456346All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300006804|Ga0079221_11089449All Organisms → cellular organisms → Bacteria → Terrabacteria group610Open in IMG/M
3300006854|Ga0075425_100959284Not Available976Open in IMG/M
3300006893|Ga0073928_10742660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Clostridiales Family XVII. Incertae Sedis → Sulfobacillus → Sulfobacillus thermosulfidooxidans682Open in IMG/M
3300006893|Ga0073928_11198700Not Available511Open in IMG/M
3300009012|Ga0066710_104847536All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300009137|Ga0066709_100671502Not Available1486Open in IMG/M
3300009162|Ga0075423_11030523Not Available875Open in IMG/M
3300009176|Ga0105242_10231687All Organisms → cellular organisms → Bacteria1655Open in IMG/M
3300009525|Ga0116220_10196303All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300009698|Ga0116216_10480981All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300010371|Ga0134125_12346065Not Available580Open in IMG/M
3300010379|Ga0136449_100685336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1723Open in IMG/M
3300010858|Ga0126345_1161696Not Available694Open in IMG/M
3300010864|Ga0126357_1123881Not Available630Open in IMG/M
3300010880|Ga0126350_11835478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300012203|Ga0137399_11586259Not Available542Open in IMG/M
3300012929|Ga0137404_11195649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia699Open in IMG/M
3300012929|Ga0137404_11636869Not Available597Open in IMG/M
3300012986|Ga0164304_11116946Not Available632Open in IMG/M
3300013105|Ga0157369_12167467Not Available563Open in IMG/M
3300013306|Ga0163162_10226589All Organisms → cellular organisms → Bacteria1999Open in IMG/M
3300013306|Ga0163162_11617720Not Available739Open in IMG/M
3300015264|Ga0137403_11182640Not Available610Open in IMG/M
3300015374|Ga0132255_104344524Not Available601Open in IMG/M
3300016319|Ga0182033_10839257Not Available811Open in IMG/M
3300016404|Ga0182037_10906132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria765Open in IMG/M
3300017823|Ga0187818_10304107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia701Open in IMG/M
3300017926|Ga0187807_1029169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1708Open in IMG/M
3300017995|Ga0187816_10050772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1732Open in IMG/M
3300018034|Ga0187863_10434305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria733Open in IMG/M
3300018047|Ga0187859_10765620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia seriolae552Open in IMG/M
3300018085|Ga0187772_10600226Not Available783Open in IMG/M
3300020580|Ga0210403_10308300Not Available1297Open in IMG/M
3300020580|Ga0210403_10628758Not Available865Open in IMG/M
3300021180|Ga0210396_10246667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1588Open in IMG/M
3300021180|Ga0210396_11598100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300021401|Ga0210393_11173566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces619Open in IMG/M
3300021405|Ga0210387_10271441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1487Open in IMG/M
3300024249|Ga0247676_1006747All Organisms → cellular organisms → Bacteria1721Open in IMG/M
3300024317|Ga0247660_1016548All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300025134|Ga0207416_1197602All Organisms → cellular organisms → Bacteria → Terrabacteria group632Open in IMG/M
3300025898|Ga0207692_10129291All Organisms → cellular organisms → Bacteria1424Open in IMG/M
3300025904|Ga0207647_10301341Not Available913Open in IMG/M
3300025915|Ga0207693_10331531All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae1191Open in IMG/M
3300025915|Ga0207693_10859024Not Available697Open in IMG/M
3300025921|Ga0207652_10147048All Organisms → cellular organisms → Bacteria2109Open in IMG/M
3300025942|Ga0207689_11417691Not Available582Open in IMG/M
3300026309|Ga0209055_1044629All Organisms → cellular organisms → Bacteria → Terrabacteria group1941Open in IMG/M
3300027047|Ga0208730_1009842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1015Open in IMG/M
3300027063|Ga0207762_1037931Not Available721Open in IMG/M
3300027812|Ga0209656_10042152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis taiwanensis2633Open in IMG/M
3300027882|Ga0209590_10097727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1748Open in IMG/M
3300027889|Ga0209380_10652501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300028863|Ga0302218_10154045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria729Open in IMG/M
3300029944|Ga0311352_10987572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria648Open in IMG/M
3300030056|Ga0302181_10399088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ncost-T10-10d593Open in IMG/M
3300030057|Ga0302176_10374954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300030399|Ga0311353_10533746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1035Open in IMG/M
3300030524|Ga0311357_11818256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia seriolae506Open in IMG/M
3300030739|Ga0302311_10401223Not Available965Open in IMG/M
3300030743|Ga0265461_10246763Not Available1172Open in IMG/M
3300031525|Ga0302326_10912401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1247Open in IMG/M
3300031549|Ga0318571_10453688Not Available509Open in IMG/M
3300031564|Ga0318573_10415258Not Available723Open in IMG/M
3300031680|Ga0318574_10024796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2971Open in IMG/M
3300031713|Ga0318496_10549259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia638Open in IMG/M
3300031723|Ga0318493_10811943All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300031747|Ga0318502_10739347Not Available595Open in IMG/M
3300031753|Ga0307477_10194936All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300031754|Ga0307475_10572453All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300031764|Ga0318535_10501796All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300031765|Ga0318554_10072125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1915Open in IMG/M
3300031805|Ga0318497_10455411All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300031805|Ga0318497_10544914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300031821|Ga0318567_10400454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria778Open in IMG/M
3300031831|Ga0318564_10136710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1092Open in IMG/M
3300031833|Ga0310917_10996980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae562Open in IMG/M
3300031896|Ga0318551_10190952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1130Open in IMG/M
3300031939|Ga0308174_11819005All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300031942|Ga0310916_11072127Not Available670Open in IMG/M
3300031954|Ga0306926_11739279Not Available710Open in IMG/M
3300031954|Ga0306926_12889919Not Available516Open in IMG/M
3300032009|Ga0318563_10280363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria901Open in IMG/M
3300032009|Ga0318563_10515190Not Available646Open in IMG/M
3300032066|Ga0318514_10700098Not Available539Open in IMG/M
3300032770|Ga0335085_10808159Not Available1031Open in IMG/M
3300032770|Ga0335085_12069161All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300033134|Ga0335073_11407779All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300033290|Ga0318519_10156596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1277Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.45%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.09%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa7.27%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.55%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.64%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.73%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring2.73%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.73%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil2.73%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.82%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.82%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.91%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.91%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.91%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.91%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559006Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembledEnvironmentalOpen in IMG/M
2170459021Litter degradation NP4EngineeredOpen in IMG/M
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010858Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010864Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300024249Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17EnvironmentalOpen in IMG/M
3300024317Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01EnvironmentalOpen in IMG/M
3300025134Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027063Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FI_006205702166559006Grass SoilMSITMPWEGWSSDRQAIVDMFERIDQALNLLEAGLPL
4NP_040665302170459021Switchgrass, Maize And Mischanthus LitterVAGAIIGVIMSITMPWEGWSSDQQIVDMFARIDQALALLEAGLPL
JGI26340J50214_1014118523300003368Bog Forest SoilMGDAVVGVIMSVTMPWEGWTERTSVEDTFGRIDEALGLLEAGLPL*
Ga0062389_10213354723300004092Bog Forest SoilAGAIIGVIMSITMPWDGWSDRQTIADTFARIDQALALLEVGLPL*
Ga0062386_10120681023300004152Bog Forest SoilIGVIMSITMPWDGWSDRQTMQSTFQRIDQALGLLEAGLPL*
Ga0068869_10108290123300005334Miscanthus RhizosphereDDLAVRTLAGAIIGVIMSITMPWEGWSDGQAFVDMFERVDQALNLLEAGLPL*
Ga0070709_1065606723300005434Corn, Switchgrass And Miscanthus RhizosphereIGVIMSITMPWEGWSDPQAFVYMFERVDQALNLLEAGLPL*
Ga0070709_1130493523300005434Corn, Switchgrass And Miscanthus RhizosphereADDLAVRTLAGAIIGVIMSITMPWEGWSDPQGFVDMFERVDQALNLLEAGLPL*
Ga0070709_1173240123300005434Corn, Switchgrass And Miscanthus RhizosphereADDLAVRTLAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL*
Ga0070714_10142511023300005435Agricultural SoilGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL*
Ga0070710_1073707223300005437Corn, Switchgrass And Miscanthus RhizospherePADDLAVRTLAGAIIGVIMSITMPWEGWSDPQAFADTFERIDQALNLLEAGLPL*
Ga0070678_10018531933300005456Miscanthus RhizospherePADDLAVRTLAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL*
Ga0070730_1055587413300005537Surface SoilVIMSITMPWEGWSEGRSFEDMFGRIDEALAFLEAGLPL*
Ga0066697_1067377513300005540SoilITMPWQGWSDPQAFEDMFERVDQALNLLEAGLPL*
Ga0066903_10485150013300005764Tropical Forest SoilAGAIIGVIMSITMPWEGWSSDRQTIVDMFERINQALGLLEDGLPL*
Ga0068860_10195876513300005843Switchgrass RhizosphereRPADDLAVRTLAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL*
Ga0070717_1089600733300006028Corn, Switchgrass And Miscanthus RhizosphereMMSITMPWHGWSSDMQTIEDVFGRIDQALALLEAGLPL*
Ga0070717_1160370323300006028Corn, Switchgrass And Miscanthus RhizosphereIIGVIMSVTMPWEGWSDGQSFEDMFGRIDQALALLEAGLPL*
Ga0070715_1092815313300006163Corn, Switchgrass And Miscanthus RhizosphereRTLAGAIIGVIMSITMPWEGWSDGQAFVDTFERIDQALNLLEAGLPL*
Ga0070765_10007444513300006176SoilGAIIGVIMSITLPWDGWSDPQNIKETFARIDTALGLLEAGLPL*
Ga0079222_1045634633300006755Agricultural SoilAGAIIGVIMSITMPWEGWTDPQAFMDTFERIDQALNLLEAGLPL*
Ga0079221_1108944913300006804Agricultural SoilAMAGGFIGVILSVTLPVEGWPGDDQSIIAMFERIDQALALLEAGLPL*
Ga0075425_10095928433300006854Populus RhizosphereLAVRTLAGAIIGVIMSITMPWEGWSDRQAIVDMFERIDQALNLLEAGLPL*
Ga0073928_1074266023300006893Iron-Sulfur Acid SpringVAGAIIGVIMSITIPWENWSDGTSFEDTFARIDEALALLEAGLPL*
Ga0073928_1119870013300006893Iron-Sulfur Acid SpringMSITIPWENWSDGTSFEDTFARIDEALALLEAGLPL*
Ga0066710_10484753613300009012Grasslands SoilIGVMMSLTMPWHGWASDMQTIEDLLGRIDQALALLEAGLPL
Ga0066709_10067150213300009137Grasslands SoilMCITMPWEGGSDPKAFVYMFEGVDQGLNLLEAGLPL*
Ga0075423_1103052313300009162Populus RhizosphereVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL*
Ga0105242_1023168733300009176Miscanthus RhizosphereIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL*
Ga0116220_1019630323300009525Peatlands SoilMSITMPWEDWSSDRRTIEDMFERIDQALALLEAGLPL*
Ga0116216_1048098123300009698Peatlands SoilVIMAITMPWEDWSERPSAFEDSFGRIDEALALLEAGLPL*
Ga0134125_1234606523300010371Terrestrial SoilAVRTLAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL*
Ga0136449_10068533613300010379Peatlands SoilRTVAGAIIGVIMAITLPWEGWSEQVSLEDTFARIDKALALLEAGLPL*
Ga0126345_116169613300010858Boreal Forest SoilGVIMSVTMPWEGWSDGKSFEDMFRRIDQALALLEAGLPL*
Ga0126357_112388123300010864Boreal Forest SoilVGVVMSVTMPWEGWSQAPNFEDMFVRIDEALALLEAGLPL*
Ga0126350_1183547823300010880Boreal Forest SoilSITLPWSGWADRRSMQDTFGRIDRALALLEAGLPL*
Ga0137399_1158625913300012203Vadose Zone SoilVIMSITMPWEGWSDPEAFVDMFERVDQALNLLEAGLPL*
Ga0137404_1119564913300012929Vadose Zone SoilIGVMMALTMPWDGWTTDRQAIADLFGRVDQALALLEAGLPL*
Ga0137404_1163686913300012929Vadose Zone SoilVRTLAGAIIGVIMSITMPWEGWSDPAAFVDMFERVDQALNLLEAGLPL*
Ga0164304_1111694623300012986SoilDDLAVRTLAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL*
Ga0157369_1216746723300013105Corn RhizosphereGAIIGVIMSITMPWEGWSDPQGFVDMFERVDQALNLLEAGLPL*
Ga0163162_1022658913300013306Switchgrass RhizosphereIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL*
Ga0163162_1161772023300013306Switchgrass RhizosphereVRTLAGAIIGVIMSITMPWEGWSDGQAFVDMFERVDQALNLLEAGLPL*
Ga0137403_1118264013300015264Vadose Zone SoilADDLAVRTLAGAIIGVIMSITMPWEGWSDPAAFVDMFERVDQALNLLEAGLPL*
Ga0132255_10434452423300015374Arabidopsis RhizosphereGAIIGVIMSITMPWEGWSDPQAFVDMFERIDQALNLLEAGLPL*
Ga0182033_1083925723300016319SoilVRVMAGAIIGVIMSTTIPWEGWSDRQTMEDTFGRIEQGLALLEAGLPL
Ga0182037_1090613233300016404SoilGVMMSLTMPWEGWSSDWQTFEDLFQHVDQALALLEAGLPL
Ga0187818_1030410713300017823Freshwater SedimentAIIGVIMSITMPWDGWSDRQTIGDTFERIDAALALLEAGLPL
Ga0187807_102916943300017926Freshwater SedimentAVRTAAGAIIGVIMAITMPWEGWSEGGVFEDSFRQIDEALALLEAGLPL
Ga0187816_1005077213300017995Freshwater SedimentRPADDLAVRTAAGAIIGVIMAITLPWEGWSEGTAFEDAFGGIDEALALLEAGLPL
Ga0187863_1043430513300018034PeatlandGAIVGVIMSITLPWDGWSDPQTMGVTFARIDTALGLLEAGLPL
Ga0187859_1076562013300018047PeatlandGRPADDLAVRTITGAIIGVIMSITLPWEGWSDRQNVEDMFVRIDRALTLLEAGLPL
Ga0187772_1060022613300018085Tropical PeatlandMAITIPWEGWSDGVRFEDTFGRIDEALALLEAGLPL
Ga0210403_1030830043300020580SoilGVIMSIAMPWEGWSSDRQAIVDMFERIDQALNLLEAGLPL
Ga0210403_1062875813300020580SoilDLAVRTVAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL
Ga0210396_1024666743300021180SoilGAVVGVIMSITIPWEGWSDRTSFEDTFARIDQALALLEAGLPL
Ga0210396_1159810023300021180SoilIMSITIPWEGWSDRTSFEDTFVRIDQALALLEAGLPL
Ga0210393_1117356623300021401SoilVIMAITLPWEGWSDQTSFEDTFNRIDEALALLEAGLPL
Ga0210387_1027144113300021405SoilVIMSITIPWEGWSDRTSFEDTFARIDQALALLEAGLPL
Ga0247676_100674713300024249SoilMSITMPWEGWSDPQAFVDLFERVDQALNLLEAGLPL
Ga0247660_101654813300024317SoilIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL
Ga0207416_119760213300025134Iron-Sulfur Acid SpringVRTVAGAIIGVVMSITIPWENWSDGTSFEDTFARIDEALALLEAGLPL
Ga0207692_1012929113300025898Corn, Switchgrass And Miscanthus RhizosphereLAVRTLAGAVIGVIMSITMPWEGWSDPQAFVYMFERVDQALNLLEAGLPL
Ga0207647_1030134123300025904Corn RhizosphereDDLAVRTLAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL
Ga0207693_1033153113300025915Corn, Switchgrass And Miscanthus RhizospherePADDLAVRTLAGAIIGVIMSITMPWEGWSDPQGFVDMFERVDQALNLLEAGLPL
Ga0207693_1085902433300025915Corn, Switchgrass And Miscanthus RhizospherePADDLAVRTLAGAIIGVIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL
Ga0207652_1014704813300025921Corn RhizosphereIMSITMPWEGWSDPQAFVDMFERVDQALNLLEAGLPL
Ga0207689_1141769113300025942Miscanthus RhizosphereLAGAIIGVIMSITMPWEGWSDGQAFVDMFERVDQALNLLEAGLPL
Ga0209055_104462923300026309SoilMSITMPWEGWSDPQAFVYMFERVDQALNLLEAGLPL
Ga0208730_100984213300027047Forest SoilQYTVIAIIGVIMAITIPWEGWSDRARFEDTFTRIDQALALLEAGLPL
Ga0207762_103793113300027063Tropical Forest SoilRPPEDLAVRVMAGAIIGVIMSLTIPWEGWSDRQTLEDTFGRIEQGLALLEAGLPL
Ga0209656_1004215243300027812Bog Forest SoilMGDAVVGVIMSVTMPWEGWTERTSVEDTFGRIDEALGLLEAGLPL
Ga0209590_1009772753300027882Vadose Zone SoilMSITMPWEGWSSDRQTIEDTFQRIDQALALLEAGLPL
Ga0209380_1065250123300027889SoilAIIGVIMAITLPWEGWSDQTSFEDTFNRIDEALALLEAGLPL
Ga0302218_1015404513300028863PalsaVGVIMSITLPWDGWSDPQNMAETFGRIDTALGLLEAGLPL
Ga0311352_1098757223300029944PalsaLTVRTIAGAIIGVVMSITLPWDGWSDRQTIEETFGRIDTALGLLEAGLPL
Ga0302181_1039908813300030056PalsaRTTAGAIIGVIISITMPWEGEGWSDAKNIEETFRTIDQALAVLEAGLPI
Ga0302176_1037495413300030057PalsaIMSITLPWDGWSDPQNMAETFGRIDAALGLLEAGLPL
Ga0311353_1053374613300030399PalsaAIIGVIMSITLPWDGWSDPQNIKETFGRIDTALGLLEAGLPL
Ga0311357_1181825613300030524PalsaTVRTIAGAIIGVIMSITMPWDGWSDRQNIEDTFGRIDTALGVLEAGLPL
Ga0302311_1040122313300030739PalsaVMSITMPWDGWSEGHGFEDAFGRIDEALALLEAGLPL
Ga0265461_1024676323300030743SoilAGAVIGVIMAITIPWEGWSDRTRFEDTFARIDQALALLEAGLPL
Ga0302326_1091240113300031525PalsaVIMSITLPWDGWSDPQNMAETFGRIDAALGLLEAGLPL
Ga0318571_1045368813300031549SoilSITMPWEGWSSDRQTIVDMFERIDQALSLLEDGLPL
Ga0318573_1041525823300031564SoilVGAIMSITMPWEGWSDQQTLEGTFQRIEQGLALLEAGLPL
Ga0318574_1002479613300031680SoilMAGAIIGVIMSTTIPWEGWSDRQTMEDTFGRIEQGLALLEAGLPL
Ga0318496_1054925913300031713SoilVIMSVTMPWEGWSEGTSFEDTFGRIDEALGLLEAGLPL
Ga0318493_1081194323300031723SoilIMSITMPWEGWSSDRQTIVDMFERINQALGLLEDGLPL
Ga0318502_1073934713300031747SoilIGVIMSVTMPWEGWSEGHAFEHSFERIDEALGLLEAGLPL
Ga0307477_1019493623300031753Hardwood Forest SoilMSITIPWEGWSDRTRFEDTFVRIDQALALLEAGLPL
Ga0307475_1057245323300031754Hardwood Forest SoilMSITIPWEGWSDRTRFEDTFVRIDQALALLEACLPL
Ga0318535_1050179623300031764SoilSITMPWAGWSSDRQIIMDMFERIDQALALLEAGLPL
Ga0318554_1007212513300031765SoilSITMPWEGWSSDRQTIVDMFERINQALGLLEDGLPL
Ga0318497_1045541123300031805SoilGVIMSITMPWEGWSSDRQTIVDMFERINQALGLLEDGLPL
Ga0318497_1054491423300031805SoilSITMPWEGWSDQQTLEGTFQRIEQGLALLEAGLPL
Ga0318567_1040045433300031821SoilVIMSVTLPWSDWTSESATDDMFARIDEALALLESGLPL
Ga0318564_1013671033300031831SoilLVVRVMAGAIIGVIMSTTMPWEGWSDRQTMEDTFGRIEQGLALLEAGLPL
Ga0310917_1099698023300031833SoilAIIGVIMSVTMPWEGWSEGHAFEHSFERIDEALGLLEAGLPL
Ga0318551_1019095213300031896SoilGVIMSVTMPWEGWSEGTSFEETFGRIDEALGLLEAGLPL
Ga0308174_1181900513300031939SoilGVMMSITMPWHGWSSDMQTIEDVFGRIDQALALLEAGLPL
Ga0310916_1107212723300031942SoilIMSTTIPWEGWSDRQTMEDTFGRIEQGLALLEAGLPL
Ga0306926_1173927913300031954SoilSLTMPWEGWSSHLQTFEDVFQQIDQALALLEAGLPL
Ga0306926_1288991913300031954SoilGAIIGVIMSITMPWEGWSSDRQTIVDMFERINQALGLLEDGLPL
Ga0318563_1028036313300032009SoilIMSITMPWEGWSSDRQTVEDMFERIDQALALLEAGLPL
Ga0318563_1051519023300032009SoilIGVIMSITMPWEGWSSDRQTIVDMFERINQALGLLEDGLPL
Ga0318514_1070009823300032066SoilGVIMSITMPWEGWSSDRQIVDMFARIDEALALLEAGLPL
Ga0335085_1080815923300032770SoilVRTVAGAIIGVIMSITMPWEGWSSDRQVIVDMFERIDQALGLLEDGLPL
Ga0335085_1206916123300032770SoilMSITMPWEGWSSDRRTLEDMFGRIEQALALLEAGLPL
Ga0335073_1140777913300033134SoilITMPWEGWSSDRQAIVDMFERIDQALNLLEAGLPL
Ga0318519_1015659633300033290SoilADDLAVRTVAGAIIGVIMSITMPWEGWSSDRQTIVDMFERIDQALSLLEDGLPL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.