Basic Information | |
---|---|
Family ID | F087918 |
Family Type | Metagenome |
Number of Sequences | 110 |
Average Sequence Length | 50 residues |
Representative Sequence | MVMVLPFLLGLVAALLAVGGRRNAALGLGLITVLVQVWWLVYHATDKLAVSL |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 79.09 % |
% of genes near scaffold ends (potentially truncated) | 28.18 % |
% of genes from short scaffolds (< 2000 bps) | 81.82 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.67 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (10.909 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.091 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.273 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.75% β-sheet: 0.00% Coil/Unstructured: 41.25% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF02600 | DsbB | 41.82 |
PF00496 | SBP_bac_5 | 30.91 |
PF00582 | Usp | 10.00 |
PF03129 | HGTP_anticodon | 1.82 |
PF04073 | tRNA_edit | 0.91 |
PF03597 | FixS | 0.91 |
PF07549 | Sec_GG | 0.91 |
PF00749 | tRNA-synt_1c | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG1495 | Disulfide bond formation protein DsbB | Posttranslational modification, protein turnover, chaperones [O] | 41.82 |
COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.82 |
COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 1.82 |
COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.82 |
COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.82 |
COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
COG0341 | Preprotein translocase subunit SecF | Intracellular trafficking, secretion, and vesicular transport [U] | 0.91 |
COG0342 | Preprotein translocase subunit SecD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.91 |
COG3197 | Cytochrome oxidase maturation protein, CcoS/FixS family | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.00 % |
Unclassified | root | N/A | 10.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886012|MBSR1b_contig_1491420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1092 | Open in IMG/M |
3300000550|F24TB_13219851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 757 | Open in IMG/M |
3300001431|F14TB_101184723 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
3300003995|Ga0055438_10005832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2311 | Open in IMG/M |
3300004072|Ga0055512_10071699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 659 | Open in IMG/M |
3300005093|Ga0062594_100387824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1120 | Open in IMG/M |
3300005328|Ga0070676_10098453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1803 | Open in IMG/M |
3300005330|Ga0070690_101529936 | Not Available | 539 | Open in IMG/M |
3300005331|Ga0070670_102185491 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
3300005347|Ga0070668_100415328 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1151 | Open in IMG/M |
3300005354|Ga0070675_100824670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 848 | Open in IMG/M |
3300005367|Ga0070667_100304522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1435 | Open in IMG/M |
3300005367|Ga0070667_100388934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1268 | Open in IMG/M |
3300005367|Ga0070667_102164581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
3300005440|Ga0070705_101588088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
3300005459|Ga0068867_100166963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1740 | Open in IMG/M |
3300005471|Ga0070698_100632439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1011 | Open in IMG/M |
3300005518|Ga0070699_101146373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 713 | Open in IMG/M |
3300005539|Ga0068853_100929169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
3300005549|Ga0070704_100474608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1081 | Open in IMG/M |
3300005719|Ga0068861_102396745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 530 | Open in IMG/M |
3300005841|Ga0068863_100055415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3754 | Open in IMG/M |
3300005937|Ga0081455_10986796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
3300006642|Ga0075521_10094182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1367 | Open in IMG/M |
3300006755|Ga0079222_10944573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 731 | Open in IMG/M |
3300006881|Ga0068865_101268787 | Not Available | 654 | Open in IMG/M |
3300006954|Ga0079219_10859027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
3300007521|Ga0105044_10111169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3031 | Open in IMG/M |
3300007799|Ga0105049_10734296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
3300009098|Ga0105245_12547992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 565 | Open in IMG/M |
3300009131|Ga0115027_10410191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 950 | Open in IMG/M |
3300009527|Ga0114942_1480608 | Not Available | 512 | Open in IMG/M |
3300009545|Ga0105237_10591399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1117 | Open in IMG/M |
3300009870|Ga0131092_10092715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3621 | Open in IMG/M |
3300009870|Ga0131092_10124261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2936 | Open in IMG/M |
3300009870|Ga0131092_10161891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2431 | Open in IMG/M |
3300009870|Ga0131092_10163924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2409 | Open in IMG/M |
3300010400|Ga0134122_10992772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 822 | Open in IMG/M |
3300011438|Ga0137451_1127912 | Not Available | 787 | Open in IMG/M |
3300012900|Ga0157292_10133660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 774 | Open in IMG/M |
3300013308|Ga0157375_10331289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1687 | Open in IMG/M |
3300014266|Ga0075359_1156895 | Not Available | 515 | Open in IMG/M |
3300014326|Ga0157380_11003117 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
3300015360|Ga0163144_10414339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1595 | Open in IMG/M |
3300015371|Ga0132258_10888090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2250 | Open in IMG/M |
3300015373|Ga0132257_102852030 | Not Available | 630 | Open in IMG/M |
3300015374|Ga0132255_105427045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 540 | Open in IMG/M |
3300017792|Ga0163161_10511898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 979 | Open in IMG/M |
3300017974|Ga0187777_10363531 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 996 | Open in IMG/M |
3300018052|Ga0184638_1031157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1923 | Open in IMG/M |
3300018075|Ga0184632_10270957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
3300018081|Ga0184625_10204977 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1033 | Open in IMG/M |
3300018469|Ga0190270_11956457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
3300018476|Ga0190274_10016039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4788 | Open in IMG/M |
3300018476|Ga0190274_11028559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
3300018476|Ga0190274_11976688 | Not Available | 679 | Open in IMG/M |
3300018476|Ga0190274_13155101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 554 | Open in IMG/M |
3300020057|Ga0163151_10136473 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1533 | Open in IMG/M |
3300020167|Ga0194035_1023249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2328 | Open in IMG/M |
3300020186|Ga0163153_10007486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 11739 | Open in IMG/M |
(restricted) 3300021517|Ga0224723_1061088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1290 | Open in IMG/M |
3300022213|Ga0224500_10328823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
3300022756|Ga0222622_10699233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 737 | Open in IMG/M |
3300025321|Ga0207656_10082324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1448 | Open in IMG/M |
3300025878|Ga0209584_10107840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1031 | Open in IMG/M |
3300025901|Ga0207688_10518033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 748 | Open in IMG/M |
3300025907|Ga0207645_10599870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 748 | Open in IMG/M |
3300025914|Ga0207671_11151762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
3300025925|Ga0207650_10768273 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300025925|Ga0207650_11843670 | Not Available | 511 | Open in IMG/M |
3300025926|Ga0207659_10276361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1372 | Open in IMG/M |
3300025926|Ga0207659_10302678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1314 | Open in IMG/M |
3300025938|Ga0207704_10959743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
3300025942|Ga0207689_10000421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 39749 | Open in IMG/M |
3300025945|Ga0207679_10490147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1095 | Open in IMG/M |
3300025986|Ga0207658_10016691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5053 | Open in IMG/M |
3300025986|Ga0207658_10104954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2221 | Open in IMG/M |
3300025986|Ga0207658_11332356 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
3300025986|Ga0207658_11985739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
3300026023|Ga0207677_10584314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 978 | Open in IMG/M |
3300026121|Ga0207683_11317457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 668 | Open in IMG/M |
3300026142|Ga0207698_11885220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
3300027775|Ga0209177_10433945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
3300027850|Ga0209591_10180292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1721 | Open in IMG/M |
3300027870|Ga0209023_10022650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5327 | Open in IMG/M |
3300027871|Ga0209397_10248091 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
3300027878|Ga0209181_10123390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2474 | Open in IMG/M |
3300027900|Ga0209253_10150184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1886 | Open in IMG/M |
3300028379|Ga0268266_10025166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5066 | Open in IMG/M |
3300028381|Ga0268264_10341715 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1422 | Open in IMG/M |
3300028587|Ga0247828_10091815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1419 | Open in IMG/M |
3300028587|Ga0247828_10511495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 716 | Open in IMG/M |
3300028870|Ga0302254_10174754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 790 | Open in IMG/M |
3300029987|Ga0311334_11329615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 605 | Open in IMG/M |
3300030294|Ga0311349_10960414 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
3300031521|Ga0311364_10760526 | Not Available | 973 | Open in IMG/M |
3300031938|Ga0308175_100109908 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2561 | Open in IMG/M |
3300031938|Ga0308175_102902853 | Not Available | 535 | Open in IMG/M |
3300031939|Ga0308174_11387818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
3300032164|Ga0315283_10695290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1096 | Open in IMG/M |
3300032256|Ga0315271_10435363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1103 | Open in IMG/M |
3300032456|Ga0335394_10029599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 6091 | Open in IMG/M |
3300032954|Ga0335083_10003728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 19615 | Open in IMG/M |
3300033408|Ga0316605_10989155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 807 | Open in IMG/M |
3300033418|Ga0316625_101330104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 668 | Open in IMG/M |
3300033807|Ga0314866_079436 | Not Available | 571 | Open in IMG/M |
3300034126|Ga0370486_013573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1803 | Open in IMG/M |
3300034156|Ga0370502_0060683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1193 | Open in IMG/M |
3300034195|Ga0370501_0255277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 626 | Open in IMG/M |
3300034281|Ga0370481_0121266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 891 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 10.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.45% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 4.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.55% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 3.64% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.64% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 3.64% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 2.73% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.73% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.73% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.73% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.73% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.82% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.82% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.82% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.82% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.82% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.91% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.91% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.91% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.91% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.91% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.91% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.91% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.91% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.91% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
3300004072 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
3300007799 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014266 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300020057 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2 | Environmental | Open in IMG/M |
3300020167 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m | Environmental | Open in IMG/M |
3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
3300021517 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR2_MetaG | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
3300027870 | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) | Environmental | Open in IMG/M |
3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027878 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032456 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly) | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
3300034126 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_16 | Environmental | Open in IMG/M |
3300034156 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18 | Environmental | Open in IMG/M |
3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
3300034281 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
MBSR1b_0798.00005220 | 2162886012 | Miscanthus Rhizosphere | MVMVLPFLLGFVAALLAVGGRRNAAVGLSLITVVVQVWWLVYHATDKLAVSL |
F24TB_132198512 | 3300000550 | Soil | MVMVLPFLLGFVAALLAVAGRRNAALGLSLVTVVVQVWWLVYHATDKLAVSL* |
F14TB_1011847232 | 3300001431 | Soil | MVMVLPFLLGFVAALLAVAGRRNAALGLSLVTVVVQVWWLVYHATDKLA |
Ga0055438_100058323 | 3300003995 | Natural And Restored Wetlands | MVMVLPFAMGLLAALLACYGRARGALILGLATVVVQVWWLVYHATSALQISL* |
Ga0055512_100716991 | 3300004072 | Natural And Restored Wetlands | VVMVLPFILGLLAAACALARKRNAAVALLLVTIVVQVWWLLYHATDKLAVSL |
Ga0062594_1003878242 | 3300005093 | Soil | MVMVLPFLLGFVAAVLAYLGARRAALGLGLATAAVQVWWLFYHATDKLAISL* |
Ga0070676_100984533 | 3300005328 | Miscanthus Rhizosphere | MVMVLPFLLGFVAALLAVGGRRNAAVGLSLITVVVQVWWLVYHATDKLAVSL* |
Ga0070690_1015299362 | 3300005330 | Switchgrass Rhizosphere | MVMVLPFLLGFAAALLAVGGRRNAAVGLSLITVVVQVWWLVYHATDKLAVSL* |
Ga0070670_1021854912 | 3300005331 | Switchgrass Rhizosphere | MVMVLPFALGLIVALLAVAGRRNTALGLGLATVLIQVWWLVYHATDKLAVSL* |
Ga0070668_1004153282 | 3300005347 | Switchgrass Rhizosphere | MIMVLPFALGLLVALLAVAGRRNTALGLGLVTVLIQVWWLVYHATDKLAVSL* |
Ga0070675_1008246702 | 3300005354 | Miscanthus Rhizosphere | MVMVLPFLLSFVAALLAVGGRRNAAVGLSLITVVVQVWWLVYHATDKLAVSL* |
Ga0070667_1003045221 | 3300005367 | Switchgrass Rhizosphere | MVMVLPFLLGFVAAVLAYLGARRAALGTGLATVAVQVWWLFYHATDKLAISL* |
Ga0070667_1003889342 | 3300005367 | Switchgrass Rhizosphere | MVMVLPFVLAFAAALLGVAGRRKAAIGVALVTVAIQVWWLFYHATDTLAISL* |
Ga0070667_1021645811 | 3300005367 | Switchgrass Rhizosphere | GFVAAVLAYVGARRAALGAGLATVAIQVWWLFYHATGKLAISL* |
Ga0070705_1015880882 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LLGFAAALLAVGGRRNAAVGLSLITVVVQVWWLVYHATDKLAVSL* |
Ga0068867_1001669631 | 3300005459 | Miscanthus Rhizosphere | MVMVLPFVLGFVAAVLAYVGARRAALGAGLATVAIQVWWLFYHATGKLAISL* |
Ga0070698_1006324392 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMVLPFLLGFVAAWLAVGGRRNAALGLSLITVVVQVWWLVYHATDKLAVSL* |
Ga0070699_1011463732 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MIMVLPFALGLIAALLAVAGRRNTALGLGLVTVLIQVWWLVYHATDKLAISL* |
Ga0068853_1009291692 | 3300005539 | Corn Rhizosphere | MVMVLPFLLGFVAAVLAYAGARRAALGAGLATIAVQVWWLFYHATDKLAISL* |
Ga0070704_1004746081 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | FVAALLAVGGRRNAAVGLSLITVVVQVWWLVYHATDKLAVSL* |
Ga0068861_1023967452 | 3300005719 | Switchgrass Rhizosphere | MVMVLPFLLGFVAAVLAYLGARRAALGLGLATVAVQVWWLFYHATDKLAISL* |
Ga0068863_1000554152 | 3300005841 | Switchgrass Rhizosphere | MIMVLPFALAFVAALLAVTGRRNAAIGVALATVAIQVWWLFYHATDTLAISL* |
Ga0081455_109867962 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MVMVLPFILGLVAAILAYAGARRPALAIGLATVAIQVWWLFYHATDTLAISL* |
Ga0075521_100941822 | 3300006642 | Arctic Peat Soil | MVMVLPFVMGLVATLLALGGRRQGALGVGLATVLVQVWWLVYHATDKLAVSL* |
Ga0079222_109445731 | 3300006755 | Agricultural Soil | MALPFVLGLVAAVLAYAGACRAALGTGLATVAIQVWWLFYHATDKLAISL* |
Ga0068865_1012687871 | 3300006881 | Miscanthus Rhizosphere | AAVLAYLGARRAALGLGLATAAVQVWWLFYHATDKLAISL* |
Ga0079219_108590272 | 3300006954 | Agricultural Soil | MVMVLPFLLAFVAALLALGRRRNAAIAVAIATVVIQVWWLFYHATSTLQISL* |
Ga0105044_101111694 | 3300007521 | Freshwater | MVLPFVMGLLAALLAMAGFRTGAMRVGLATVLIQVWWLVYHATDKLAVTL* |
Ga0105049_107342962 | 3300007799 | Freshwater | MVMVLPFVLALLAALLAMSGFRTGAMRVGLVTVLVQVWWLIYHATDKLAVTL* |
Ga0105245_125479922 | 3300009098 | Miscanthus Rhizosphere | AALLAVGGRRNAAVGLSLITVVVQVWWLVYHATDKLAVSL* |
Ga0115027_104101911 | 3300009131 | Wetland | TFTVVMVLPFVLALVAALLAMRGRRNAALGVGIVTVVVQVWWLVHHATDKLAIAL* |
Ga0114942_14806081 | 3300009527 | Groundwater | MVMVLPFVMGLLAALLAMSGHRTGALRMGVATVLVQVWWLLYHATDRLAVTL* |
Ga0105237_105913993 | 3300009545 | Corn Rhizosphere | LAVGGRRNAAVGLSLITVVVQVWWLVYHATDKLAVSL* |
Ga0131092_100927155 | 3300009870 | Activated Sludge | MVMVLPFVLALAAAVCALTRRRNAAIVLAIATVVIQVWWLFYHATDTLAISL* |
Ga0131092_101242613 | 3300009870 | Activated Sludge | MVMVLPFVLGLLAAVLAYAGARRAAIGTGLVTVGVQVWWLFYHATDKLAISL* |
Ga0131092_101618912 | 3300009870 | Activated Sludge | MALPFVLGLLAAVFAYFGRRNSALVAGAVTVAIQVWWLVYHATDKLSIGL* |
Ga0131092_101639244 | 3300009870 | Activated Sludge | MVMVLPFVLGFVAAVLAYAGARKAALAIGLATVAVQVWWLFYHATDKLAISL* |
Ga0134122_109927722 | 3300010400 | Terrestrial Soil | MVMVLPFALGLIVALLAVAGRRNAALGLGLVTVLIQVWWLVYHATD |
Ga0137451_11279122 | 3300011438 | Soil | MIMALPFVLGLVTALLAVGGRRNAALGLGVVTVVIQVWWLVYHATDTLAVSL* |
Ga0157292_101336601 | 3300012900 | Soil | MGFLAALLAFVGRRHAAIGLGLATVVVQVWWLFYHATDRLAISL* |
Ga0157375_103312893 | 3300013308 | Miscanthus Rhizosphere | MVLPFLLGFVAAVLAYLGARRAALGTGLATVAVQVWWLFYHATDKLAISL* |
Ga0075359_11568952 | 3300014266 | Natural And Restored Wetlands | MRRACGVVGELTVVMVLPFVLGLVAALFAMAGRRNAALGIGLVTVVVQVWWLVHHATDKLAITL* |
Ga0157380_110031172 | 3300014326 | Switchgrass Rhizosphere | MVMVLPFVLGFVAAVLAYVGARRAALGAALATVAIQVWWLFYHATGKLAISL* |
Ga0163144_104143394 | 3300015360 | Freshwater Microbial Mat | RTRIVVMVLPFVMGLLAALLAMSGFRTGAMRVGLATVLIQVWWLVYHATDKLAVTL* |
Ga0132258_108880903 | 3300015371 | Arabidopsis Rhizosphere | MVMALPFVLGLAAAVLAYAGARKAALAFGLATVAVQVWWLFYHATDKLAISL* |
Ga0132257_1028520302 | 3300015373 | Arabidopsis Rhizosphere | MIMVLPFLLGFVAAWLAFARQRNAALGVGLLTVVVQVWWLFYHATDKLAISL* |
Ga0132255_1054270452 | 3300015374 | Arabidopsis Rhizosphere | MALPFVLGLAAAVLAYAGARKAALAFGLATVAVQVWWLFYHATDKLAISL* |
Ga0163161_105118982 | 3300017792 | Switchgrass Rhizosphere | MVMVLPFVLGFVAAVLAYVGARRAALGAGLATVAIQVWCLFYHATGKLAISF |
Ga0187777_103635312 | 3300017974 | Tropical Peatland | MVMVLPFLLGFLAALLAVLGRRNAALGVGLLTVAVQGWWLFYHATDKLAISL |
Ga0184638_10311572 | 3300018052 | Groundwater Sediment | MVMVLPFLLGLVAALLAVGGRRNAALGLGLITVLVQVWWLVYHATDKLAVSL |
Ga0184632_102709572 | 3300018075 | Groundwater Sediment | MVMVLPFLLGLVAALLAVGGRRNAALGLGLITVVIQAWWLMYHATDKLAVSL |
Ga0184625_102049772 | 3300018081 | Groundwater Sediment | MVMVLPFLLGLVAALLAVGGRRNAALGLGLITVLVQVWWLIYHATDKLAVSL |
Ga0190270_119564572 | 3300018469 | Soil | MVMVLPFVLGLVAAVLAYAGARKTALGTGLLTVAVQVWWLFYHATDKLAISL |
Ga0190274_100160395 | 3300018476 | Soil | MVMVLPFLLGLVAALLAIGGRRNAALGLALITVVVQVWWLMYHATDKLAVSL |
Ga0190274_110285592 | 3300018476 | Soil | MVMVLPFVLGFVAALLAYAGARRAALATGLSTVAVQVWWLFYHATDKLAISL |
Ga0190274_119766882 | 3300018476 | Soil | AAVLAYIGARKAALATGLATVAVQVWWLFYHATDKLAISL |
Ga0190274_131551011 | 3300018476 | Soil | MVMVLPFAMGFLAALLAFMGRRYAAIGLGLATVVIQVWWLFYHATDSLAI |
Ga0163151_101364733 | 3300020057 | Freshwater Microbial Mat | MVLPFVMGLLAALLAMSGFRTGAMRVGLATVLIQVWWLVYHATDKLAVTL |
Ga0194035_10232492 | 3300020167 | Anoxic Zone Freshwater | MVMVLPFVMGLLAGLLAYLGWRRAAVGLCLATVVVQVWWLFYHATGKLGLSL |
Ga0163153_100074863 | 3300020186 | Freshwater Microbial Mat | MVLPFVMGWLAALLAMSGFRTGAMRVGLATVLIQVWWLVYHATDKLAVTL |
(restricted) Ga0224723_10610882 | 3300021517 | Freshwater Sediment | MVMVLPFVLALVAAVLALLGARKPALGVGLATVVLQVWWLFYHATDTLAIAL |
Ga0224500_103288232 | 3300022213 | Sediment | MVMVLPFVLGLLAAVLALARQRNAAVATALVAVLVQVWWLLYHATDRLPISL |
Ga0222622_106992331 | 3300022756 | Groundwater Sediment | MVMVLPFLLGLIAAFLAVGGRRNTALGLGLVTVLVQVWWLIYHATDKLAVSL |
Ga0207656_100823242 | 3300025321 | Corn Rhizosphere | MVMVLPFLLGFVAAVLAYLGARRAALGLGLATAAVQVWWLFYHATDKLAISL |
Ga0209584_101078402 | 3300025878 | Arctic Peat Soil | MVMVLPFVMGLVATLLALGGRRQGALGVGLATVLVQVWWLVYHGTDKLAVSL |
Ga0207688_105180332 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMVLPFLLGFVAAVLAYLGARRAALGTGLATVAVQVWWLFYHATDKLAISL |
Ga0207645_105998702 | 3300025907 | Miscanthus Rhizosphere | MVMVLPFLLGFVAAVLAYLGARRAALGLGLATVAVQVWWLFYHATDKLAISL |
Ga0207671_111517621 | 3300025914 | Corn Rhizosphere | LAVGGRRNAAVGLSLITVVVQVWWLVYHATDKLAVSL |
Ga0207650_107682732 | 3300025925 | Switchgrass Rhizosphere | MVMVLPFVLGFLAAILAYSGARRAALGTGLATVAVQVWWLFYHATDKLAISL |
Ga0207650_118436701 | 3300025925 | Switchgrass Rhizosphere | MVMVLPFAMGFLAALLAFAGQRHAAIGLGLATVVVQVWWLFYHATDRLAISL |
Ga0207659_102763613 | 3300025926 | Miscanthus Rhizosphere | MVLPFLLGFVAAVLAYLGARRAALGLGLATAAVQVWWLFYHATDKLAISL |
Ga0207659_103026781 | 3300025926 | Miscanthus Rhizosphere | MVMVLPFLLSFVAALLAVGGRRNAAVGLSLITVVVQVWWLVYHATDKLAVSL |
Ga0207704_109597432 | 3300025938 | Miscanthus Rhizosphere | PFVLAFLAALLAFARQRNAALGLALLTVVVQVWWLFYHATDKLAISL |
Ga0207689_1000042117 | 3300025942 | Miscanthus Rhizosphere | MVMVLPFLLGFAAALLAVGGRRNAAVGLSLITVVVQVWWLVYHATDKLAVSL |
Ga0207679_104901473 | 3300025945 | Corn Rhizosphere | LLGFVAAVLAYLGARRAALGTGLATVAVQVWWLFYHATDKLAISL |
Ga0207658_100166915 | 3300025986 | Switchgrass Rhizosphere | MVMVLPFLLGFVAALLAVGGRRNAAVGLSLITVVVQVWWLVYHATDKLAVS |
Ga0207658_101049544 | 3300025986 | Switchgrass Rhizosphere | LLSFVAALLAVGGRRNAAVGLSLITVVVQVWWLVYHATDKLAVSL |
Ga0207658_113323562 | 3300025986 | Switchgrass Rhizosphere | MVMVLPFVLAFAAALLGVAGRRKAAIGVALVTVAIQVWWLFYHATDTLAISL |
Ga0207658_119857392 | 3300025986 | Switchgrass Rhizosphere | LGFVAAVLAYVGARRAALGAGLATVAIQVWWLFYHATGKLAISL |
Ga0207677_105843141 | 3300026023 | Miscanthus Rhizosphere | FLLGFVAALLAVGGRRNAAVGLSLITVVVQVWWLVYHATDKLAVSL |
Ga0207683_113174571 | 3300026121 | Miscanthus Rhizosphere | LAYVGARRAALGAGLATVAIQVWWLFYHATGKLAISL |
Ga0207698_118852202 | 3300026142 | Corn Rhizosphere | MVLPFLLGFVAAVLAYLGARRAALGLGLATVAVQVWWLFYHATDKLAISL |
Ga0209177_104339452 | 3300027775 | Agricultural Soil | MVMVLPFLLAFVAALLALGRRRNAAIAVAIATVVIQVWWLFYHATSTLQISL |
Ga0209591_101802924 | 3300027850 | Freshwater | IARTRFMVMVLPFVLGLLAALLAMSGFRTGAMRVGLVTVLVQVWWLIYHATDKLAVTL |
Ga0209023_100226504 | 3300027870 | Freshwater And Sediment | MVLPFILGFLAAACALARKRNAAVALLLVTIVVQVWWLLYHATDKLAVSL |
Ga0209397_102480911 | 3300027871 | Wetland | FLLALVAALLAMRGRRDAALGVGIVTVVVQVWWLVHHATDKLAIAL |
Ga0209181_101233902 | 3300027878 | Freshwater | MVMVLPFVLGLLAALLAMSGFRTGAMRVGLVTVLVQVWWLIYHATDKLAVTL |
Ga0209253_101501843 | 3300027900 | Freshwater Lake Sediment | VVMVLPFVLGLVAALFALAGRRNAALGVGAVTVVVQVWWLYYHATDKLAITL |
Ga0268266_100251665 | 3300028379 | Switchgrass Rhizosphere | MVMVLPFVLGFVAAVLAYVGARRAALGAGLATVAIQVWWLFYHATGKLAISL |
Ga0268264_103417153 | 3300028381 | Switchgrass Rhizosphere | MIMVLPFALAFVAALLAVTGRRNAAIGVALATVAIQVWWLFYHATDTLAISL |
Ga0247828_100918154 | 3300028587 | Soil | LPFVLGFVAAVLAYVGARRAALGAGLATVAIQVWWLFYHATDKLAISL |
Ga0247828_105114952 | 3300028587 | Soil | MVMVLPFVLGFVAAVLAYVGARRAALGAGLATVAIQVWWLFYHATGK |
Ga0302254_101747542 | 3300028870 | Fen | MVMVLPFVLGLVGALLAVAGRRNAALGIGVATVIVQVWWLFYHATDKLAISL |
Ga0311334_113296152 | 3300029987 | Fen | MVLPFILALLAGLCAFARQRNAAIALSLATVVVQVWWLLYHATDRLAVSL |
Ga0311349_109604142 | 3300030294 | Fen | GMVMVLPFVLGLVGALLAVAGRRNAALGIGVATVIVQVWWLFYHATDKLAISL |
Ga0311364_107605261 | 3300031521 | Fen | MVMVLPFVLGLVGALLAVAGRRNAALGIGVATVIVQVWWLFYHATDKLA |
Ga0308175_1001099082 | 3300031938 | Soil | MVMVLPFVLGFVAAVLAYFGARRAALGTGLATVVVQVWWLFYHATDKLAISL |
Ga0308175_1029028531 | 3300031938 | Soil | MVMVAPFVLGFIAAALAFAGQRKAALGMGLVTVVVQVGWLFYHATDKLAIVL |
Ga0308174_113878182 | 3300031939 | Soil | MVMVLPFLLALAAALLAVTRRRNAAIGVALLTVVIQVWWLFHHATDSLAISL |
Ga0315283_106952901 | 3300032164 | Sediment | MVMALPFLLGLLAAVFAYFGRRNSALVVGAITVAFQVWWLVYHATDRL |
Ga0315271_104353632 | 3300032256 | Sediment | MVMVLPFVMGLLAALLALSGYRTGAMRLGLAAVVVQVWWLVYHATDKLAVTL |
Ga0335394_100295994 | 3300032456 | Freshwater | MVLPFVMGLLAALLAMAGFRTGAMRVGLATVLIQVWWLVYHATDKLAVTL |
Ga0335083_1000372811 | 3300032954 | Soil | MIMALPFLLGFLAALLAVLGRRNAAVGVGLLTVAVQVWWLFYHATDKLAISL |
Ga0316605_109891552 | 3300033408 | Soil | MVLPFVLALVAALLAMRRRRNAALGVGIVTVVVQVWWLVHHATDKLAIVL |
Ga0316625_1013301041 | 3300033418 | Soil | MVLPFVLALVAALLAMRGRRNAALGVGIVTVVVQVWWLVHHATDKLAIAL |
Ga0314866_079436_112_270 | 3300033807 | Peatland | MIMALPFLLGFLAALLAVLGRRNAALGVGLLTVAVQGWWLFYHATDKLAISL |
Ga0370486_013573_1297_1464 | 3300034126 | Untreated Peat Soil | MPAVVMVLPFVMGLLAALLALSGYRTGAMRVGIATVVVQVWWLVYHATDQLAVTL |
Ga0370502_0060683_31_198 | 3300034156 | Untreated Peat Soil | MPAVVMVLPFVMGLLAALLALSGYRTGAMRVGLATVVVQVWWLVYHATDQLAVTL |
Ga0370501_0255277_389_547 | 3300034195 | Untreated Peat Soil | MVMVLPFLMGLVATLLALGGRRQGALGVGLATVLVQVWWLVYHATDKLAVSL |
Ga0370481_0121266_295_447 | 3300034281 | Untreated Peat Soil | MVLPFILALLAGLCAFARQRNAAIALSLATVVVQVWWLLYHATDKLAVSL |
⦗Top⦘ |