Metagenome Family F087981

Basic Information
Family ID	F087981
Family Type	Metagenome
Number of Sequences	109
Average Sequence Length	42 residues
Representative Sequence	KRNINKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Number of Associated Samples	18
Number of Associated Scaffolds	109

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	1.85 %
% of genes near scaffold ends (potentially truncated)	52.29 %
% of genes from short scaffolds (< 2000 bps)	58.72 %
Associated GOLD sequencing projects	18
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.54

Most Common Taxonomy
Group	Unclassified (42.202 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (83.486 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (77.982 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 109 Family Scaffolds
PF14111	DUF4283	1.83
PF00612	IQ	0.92
PF08284	RVP_2	0.92
PF00254	FKBP_C	0.92
PF13952	DUF4216	0.92
PF14432	DYW_deaminase	0.92
PF09337	zf-H2C2	0.92
PF03732	Retrotrans_gag	0.92
PF03641	Lysine_decarbox	0.92
PF07727	RVT_2	0.92
PF02992	Transposase_21	0.92
PF00069	Pkinase	0.92

COG ID	Name	Functional Category	% Frequency in 109 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	3.67
COG1611	Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family	Nucleotide transport and metabolism [F]	0.92

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	57.80 %
Unclassified	root	N/A	42.20 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	55.96 %
Unclassified	root	N/A	42.20 %
Viruses	superkingdom	All Organisms → Viruses	1.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	35.78 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	20.18 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	35.78 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	19.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	35.78 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	19.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	33.94 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.92 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	33.94 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Sphingobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia	0.92 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	26.61 %
Methylomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Klebsiella/Raoultella group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group	0.92 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	26.61 %
unclassified Methylomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Klebsiella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella	0.92 %
Sphingobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	26.61 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %
unclassified Sphingobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	26.61 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	26.61 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	26.61 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	26.61 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	26.61 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	26.61 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	25.69 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	24.77 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	0.92 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	24.77 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	0.92 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	24.77 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	0.92 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	21.10 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.92 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	0.92 %
Salix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	18.35 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.92 %
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	0.92 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	18.35 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	0.92 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.92 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	18.35 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	0.92 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.92 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	18.35 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Glycine	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine	0.92 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.92 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	18.35 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Glycine subgen. Soja	subgenus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja	0.92 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.92 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	18.35 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	18.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.83 %
Glycine max	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	0.92 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.92 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.92 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.92 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.92 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300028786\|Ga0307517_10008020	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	15232	Open in IMG/M
3300028786\|Ga0307517_10010492	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	12962	Open in IMG/M
3300028786\|Ga0307517_10014123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	10766	Open in IMG/M
3300028786\|Ga0307517_10025811	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7159	Open in IMG/M
3300028786\|Ga0307517_10050659	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4214	Open in IMG/M
3300028786\|Ga0307517_10057100	Not Available	3790	Open in IMG/M
3300028786\|Ga0307517_10126365	Not Available	1863	Open in IMG/M
3300028786\|Ga0307517_10148926	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1613	Open in IMG/M
3300028786\|Ga0307517_10159351	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1520	Open in IMG/M
3300028786\|Ga0307517_10191505	Not Available	1297	Open in IMG/M
3300028786\|Ga0307517_10196844	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1267	Open in IMG/M
3300028786\|Ga0307517_10299183	Not Available	903	Open in IMG/M
3300028786\|Ga0307517_10361770	Not Available	783	Open in IMG/M
3300028786\|Ga0307517_10454691	Not Available	662	Open in IMG/M
3300028786\|Ga0307517_10581253	Not Available	555	Open in IMG/M
3300028794\|Ga0307515_10022337	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	11155	Open in IMG/M
3300028794\|Ga0307515_10046438	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	6637	Open in IMG/M
3300028794\|Ga0307515_10085928	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4018	Open in IMG/M
3300028794\|Ga0307515_10179026	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	2078	Open in IMG/M
3300028794\|Ga0307515_10201829	Not Available	1861	Open in IMG/M
3300028794\|Ga0307515_10241947	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1573	Open in IMG/M
3300028794\|Ga0307515_10274987	Not Available	1399	Open in IMG/M
3300028794\|Ga0307515_10412855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	972	Open in IMG/M
3300028794\|Ga0307515_10592966	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	718	Open in IMG/M
3300030521\|Ga0307511_10016043	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7236	Open in IMG/M
3300030521\|Ga0307511_10028288	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5094	Open in IMG/M
3300030521\|Ga0307511_10042228	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3834	Open in IMG/M
3300030521\|Ga0307511_10051464	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3302	Open in IMG/M
3300030521\|Ga0307511_10071210	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	2538	Open in IMG/M
3300030521\|Ga0307511_10127279	All Organisms → Viruses → Predicted Viral	1548	Open in IMG/M
3300030521\|Ga0307511_10282600	Not Available	766	Open in IMG/M
3300030521\|Ga0307511_10347995	Not Available	638	Open in IMG/M
3300030522\|Ga0307512_10012450	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	8031	Open in IMG/M
3300030522\|Ga0307512_10030132	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4727	Open in IMG/M
3300030522\|Ga0307512_10112680	Not Available	1783	Open in IMG/M
3300030522\|Ga0307512_10159816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1323	Open in IMG/M
3300030522\|Ga0307512_10181477	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	1181	Open in IMG/M
3300030522\|Ga0307512_10210230	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1036	Open in IMG/M
3300030522\|Ga0307512_10211229	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1031	Open in IMG/M
3300030522\|Ga0307512_10269153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	827	Open in IMG/M
3300030522\|Ga0307512_10413476	Not Available	560	Open in IMG/M
3300030522\|Ga0307512_10415090	Not Available	558	Open in IMG/M
3300031456\|Ga0307513_10023865	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7133	Open in IMG/M
3300031456\|Ga0307513_10042255	Not Available	5021	Open in IMG/M
3300031456\|Ga0307513_10070254	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3660	Open in IMG/M
3300031456\|Ga0307513_10746341	Not Available	684	Open in IMG/M
3300031507\|Ga0307509_10036161	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5411	Open in IMG/M
3300031507\|Ga0307509_10221312	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1705	Open in IMG/M
3300031507\|Ga0307509_10275204	Not Available	1448	Open in IMG/M
3300031507\|Ga0307509_10312612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1312	Open in IMG/M
3300031507\|Ga0307509_10594674	Not Available	779	Open in IMG/M
3300031507\|Ga0307509_10667316	Not Available	707	Open in IMG/M
3300031616\|Ga0307508_10055061	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3524	Open in IMG/M
3300031616\|Ga0307508_10062113	Not Available	3298	Open in IMG/M
3300031616\|Ga0307508_10076251	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	2930	Open in IMG/M
3300031616\|Ga0307508_10150451	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	1932	Open in IMG/M
3300031616\|Ga0307508_10193124	Not Available	1637	Open in IMG/M
3300031616\|Ga0307508_10196455	Not Available	1618	Open in IMG/M
3300031616\|Ga0307508_10200476	Not Available	1596	Open in IMG/M
3300031616\|Ga0307508_10337214	Not Available	1099	Open in IMG/M
3300031616\|Ga0307508_10413904	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	939	Open in IMG/M
3300031616\|Ga0307508_10448085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	883	Open in IMG/M
3300031616\|Ga0307508_10579197	Not Available	722	Open in IMG/M
3300031616\|Ga0307508_10739968	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	595	Open in IMG/M
3300031649\|Ga0307514_10056377	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3016	Open in IMG/M
3300031649\|Ga0307514_10065063	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	2763	Open in IMG/M
3300031649\|Ga0307514_10137964	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1664	Open in IMG/M
3300031649\|Ga0307514_10312229	Not Available	870	Open in IMG/M
3300031649\|Ga0307514_10551638	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	531	Open in IMG/M
3300031730\|Ga0307516_10017908	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7377	Open in IMG/M
3300031730\|Ga0307516_10239756	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1512	Open in IMG/M
3300031730\|Ga0307516_10377913	Not Available	1078	Open in IMG/M
3300031730\|Ga0307516_10450482	Not Available	943	Open in IMG/M
3300031730\|Ga0307516_10637451	Not Available	720	Open in IMG/M
3300031730\|Ga0307516_10742462	Not Available	640	Open in IMG/M
3300031838\|Ga0307518_10066796	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	2608	Open in IMG/M
3300031838\|Ga0307518_10180175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1429	Open in IMG/M
3300032354\|Ga0325403_1000274	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	32553	Open in IMG/M
3300032354\|Ga0325403_1003050	Not Available	15123	Open in IMG/M
3300032354\|Ga0325403_1035732	Not Available	3978	Open in IMG/M
3300032354\|Ga0325403_1070891	Not Available	1961	Open in IMG/M
3300032355\|Ga0325401_1033719	All Organisms → Viruses → Predicted Viral	4399	Open in IMG/M
3300032355\|Ga0325401_1033827	Not Available	4388	Open in IMG/M
3300032355\|Ga0325401_1130985	Not Available	1113	Open in IMG/M
3300032374\|Ga0325400_1017506	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6778	Open in IMG/M
3300032374\|Ga0325400_1030188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	4900	Open in IMG/M
3300032374\|Ga0325400_1040009	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4059	Open in IMG/M
3300032374\|Ga0325400_1045031	Not Available	3720	Open in IMG/M
3300032374\|Ga0325400_1197742	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	907	Open in IMG/M
3300032389\|Ga0325405_1001557	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	23342	Open in IMG/M
3300032389\|Ga0325405_1033841	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	3803	Open in IMG/M
3300032389\|Ga0325405_1074560	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1419	Open in IMG/M
3300032390\|Ga0325404_1029269	Not Available	4368	Open in IMG/M
3300032390\|Ga0325404_1065796	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1656	Open in IMG/M
3300033179\|Ga0307507_10010419	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	12020	Open in IMG/M
3300033179\|Ga0307507_10162395	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1647	Open in IMG/M
3300033179\|Ga0307507_10179395	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1517	Open in IMG/M
3300033179\|Ga0307507_10205591	Not Available	1353	Open in IMG/M
3300033179\|Ga0307507_10238905	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1192	Open in IMG/M
3300033179\|Ga0307507_10240519	Not Available	1185	Open in IMG/M
3300033179\|Ga0307507_10325262	Not Available	922	Open in IMG/M
3300033179\|Ga0307507_10471920	Not Available	685	Open in IMG/M
3300033179\|Ga0307507_10529264	Not Available	627	Open in IMG/M
3300033179\|Ga0307507_10585572	Not Available	580	Open in IMG/M
3300033180\|Ga0307510_10033141	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5806	Open in IMG/M
3300033180\|Ga0307510_10111903	Not Available	2469	Open in IMG/M
3300033180\|Ga0307510_10373361	Not Available	872	Open in IMG/M
3300034389\|Ga0325419_012614	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	8518	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.54
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.54
Powered by PDBe Molstar

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	83.49%
Wood	Host-Associated → Plants → Wood	15.60%
Phylloplane	Host-Associated → Plants → Phylloplane	0.92%

Habitat	Taxonomy	Distribution
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	83.49%
Xylem	Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem	15.60%
Leaf	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf	0.92%

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0307517_100080201	3300028786	Ectomycorrhiza	RNINKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307517_1001049210	3300028786	Ectomycorrhiza	MNKRNINRLDKNIVMMKNVNKRLMKAELKHYKITKKENKSKILMXKQICLHVWKMPPFIG
Ga0307517_100141234	3300028786	Ectomycorrhiza	MNKRNINRLDKNIVTIKNINKRLMKAELKHYKITKKENKSKILI
Ga0307517_100258111	3300028786	Ectomycorrhiza	NKLDKNIVMIKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307517_100506597	3300028786	Ectomycorrhiza	INKLDKNIVMMKNINKRLMKAKLKHYKNIKKESKNMILI
Ga0307517_100571004	3300028786	Ectomycorrhiza	MNKRNINRLDKNIVMMKNINKRLMKAELKHYKITKKENKSKILILKPRCPNA
Ga0307517_101263651	3300028786	Ectomycorrhiza	MNKRNINKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307517_101489261	3300028786	Ectomycorrhiza	MIKKRNINKLDKNIFMMKIINKILMRAKLKHYKNIKRESKNMILIGKL
Ga0307517_101593511	3300028786	Ectomycorrhiza	MIKKRNINEVDKNIFMMKSIKKRLMRAQLKHYKNTKKESKNMILI
Ga0307517_101915051	3300028786	Ectomycorrhiza	MNKININKLDKNIVMMKNINKRLMKEKLKHYKNTKKESKNMILI
Ga0307517_101968441	3300028786	Ectomycorrhiza	MIKKRNINKLDKNIVMMKGINKRLMIAKLKHYKNTKKESKNMILI
Ga0307517_102991832	3300028786	Ectomycorrhiza	LNIMKKKNINKLDKNIVMMKSINKRLMKAKLKHYKI
Ga0307517_103617701	3300028786	Ectomycorrhiza	RNINKLHKNIVMMKSINKRLMKAKLKQYKNTKKESKNMILI
Ga0307517_104546911	3300028786	Ectomycorrhiza	KRNINKLDKNIVMMKSINKRLMKAKLKHYKTTKKESKNMILI
Ga0307517_105812531	3300028786	Ectomycorrhiza	VNKRNINKLDKNIVMIKSINKRLIKAKLKHYKNTKKEELRRLIHQ
Ga0307515_100223371	3300028794	Ectomycorrhiza	MIKKRNINKLDKNIVMMKSINKRLMRAKLKHYKNIKKESKNMILI
Ga0307515_1004643813	3300028794	Ectomycorrhiza	MIKKRNINKLDKNIVMMKIINKILMRAKLKYYKNIKKESKNMILI
Ga0307515_100859284	3300028794	Ectomycorrhiza	MIKKRNINKLDKNIVMMKIINKILMRAKLKHYKNIKRESKNMILIGKL
Ga0307515_101790263	3300028794	Ectomycorrhiza	MNKRNINKLDKNIVIMKSINKILMKAKLKHYKNTKKESKNMILI
Ga0307515_102018291	3300028794	Ectomycorrhiza	MNKRNINRLDKNIVMMKNINNRLMKAKLKHYKNTKKESKNMILI
Ga0307515_102419471	3300028794	Ectomycorrhiza	KRNINKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307515_102749871	3300028794	Ectomycorrhiza	IVKKRNINKLDKNIVIMKSINKRLIIKTKLKHYKNIKKESKYMILI
Ga0307515_104128551	3300028794	Ectomycorrhiza	MIKKRNINKLDKNIVMMKIINKILMRAKLKHYKNIKRERART
Ga0307515_105929661	3300028794	Ectomycorrhiza	KKLDKNIVMMKSINKRLIRAKLKHYKNTKKESKCMILI
Ga0307511_100160432	3300030521	Ectomycorrhiza	MKKININKLDKNIIMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307511_100282881	3300030521	Ectomycorrhiza	MNKRNINRLDKNIVMMKNVNKRLMKAELKHYKITKKENKSKILK
Ga0307511_100422285	3300030521	Ectomycorrhiza	KLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307511_100514641	3300030521	Ectomycorrhiza	NINKQDKNIVMMKSINKRLMKAKLKHYKNIKKESKNMILI
Ga0307511_100712101	3300030521	Ectomycorrhiza	INKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307511_101272791	3300030521	Ectomycorrhiza	MKKININKLDKNIVMMKSINKRLMKAKLKHYKNTKKE
Ga0307511_102826001	3300030521	Ectomycorrhiza	MKKKNINKLDKNIVMMKSINKRLMKAKLRHYRNIKKESKNIILI
Ga0307511_103479951	3300030521	Ectomycorrhiza	MNKRNINRLDKNIVMMKNINKRLMKAELKHYKITKKENKSKILILK
Ga0307512_100124501	3300030522	Ectomycorrhiza	MKKKNINELDKNIVMIKSINKRLMKAKLKHYKNSD
Ga0307512_100301321	3300030522	Ectomycorrhiza	VNKRNINKLDKNIVMMKSINKRLMKAKLKHYKNAKKKS
Ga0307512_101126801	3300030522	Ectomycorrhiza	NINKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307512_101598161	3300030522	Ectomycorrhiza	DKNIVMIKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307512_101814771	3300030522	Ectomycorrhiza	KKNINKLDKNIVMMKSINKRLMKAKLKHYKNIKKEELSVVG
Ga0307512_102102302	3300030522	Ectomycorrhiza	MKKKNINKLDMNIVMMKSINKRLMKAKLKHYKNIKKESKNMILI
Ga0307512_102112291	3300030522	Ectomycorrhiza	MNKRNINRLDKNIVMMKNINKRLLKAKLKHYKITKKKNKS
Ga0307512_102691531	3300030522	Ectomycorrhiza	LDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307512_104134762	3300030522	Ectomycorrhiza	MKKNNINKLDKNIVMMKSINKRLMKVKLKHYKNIKKESKNMILI
Ga0307512_104150901	3300030522	Ectomycorrhiza	KNINKLDKNIVMMKIINKRLMKAELKHYKDIKKESKNMILI
Ga0307513_100238659	3300031456	Ectomycorrhiza	MEKRNINKLDKNIVMMKSINKRLMKAKLKHYKNIKKESKNMILI
Ga0307513_100422552	3300031456	Ectomycorrhiza	MKKININKLDKNIVMMKSINKRLIKVKLKHYKNTKKESKNMILI
Ga0307513_100702541	3300031456	Ectomycorrhiza	DKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307513_107463411	3300031456	Ectomycorrhiza	VKKRNINKLDMNIVMMKSINKRLMKARLKHYKNTK
Ga0307509_100361614	3300031507	Ectomycorrhiza	MNKRNINRLDKNIVMMKNVNKRLMKAELKHYKITKKENKSKILM
Ga0307509_102213123	3300031507	Ectomycorrhiza	INKLDKNIVMMKSINKRLMRAKLKHYKNIKKESKNMILI
Ga0307509_102752041	3300031507	Ectomycorrhiza	KQDKNIVMMKSINKRLMKAKLKHYKNIKKESKNMILI
Ga0307509_103126123	3300031507	Ectomycorrhiza	MIKKRIINKLDKNIVMMKGINKRLMKAKLMHYKNIKKESKNMIWI
Ga0307509_105946741	3300031507	Ectomycorrhiza	NKLDKNIVMMKNINKRLMKAKLKHYKNTKKESKNMILI
Ga0307509_106673161	3300031507	Ectomycorrhiza	NINKLDKNIVMMKNINKRLMKAKLKHYKNIKKESKNMILI
Ga0307508_100550613	3300031616	Ectomycorrhiza	MNKRNINRLDKNIVMMKNINKRLMKTKLKHYKITKKENKSKILI
Ga0307508_100621132	3300031616	Ectomycorrhiza	MNKRNINRLDKNIVKMKNINKRLMKAELKHYKITKKENKSNILI
Ga0307508_100762517	3300031616	Ectomycorrhiza	LNIVKKRNINKLDMNIVMMKSINKRLMKARLKHYKNTKKENKNMILI
Ga0307508_101504511	3300031616	Ectomycorrhiza	MNKRNINKLDKNIVVMKSINKILMKAKHKHYKNTKKESKNMILI
Ga0307508_101931241	3300031616	Ectomycorrhiza	MIKNRNINKLDKNIVMMKNINKRLMRAKLKHYKNTKK
Ga0307508_101964551	3300031616	Ectomycorrhiza	MKKKNINELDKNIVMMKSINKRLMKAKLNHYKNIKKESKNMILI
Ga0307508_102004761	3300031616	Ectomycorrhiza	QEKNIVMMKSINKRLMKAKFKHYKNIKKESKNMILISKPR
Ga0307508_103372142	3300031616	Ectomycorrhiza	KININKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNVILI
Ga0307508_104139041	3300031616	Ectomycorrhiza	MKKININKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNVIL
Ga0307508_104480851	3300031616	Ectomycorrhiza	MNKRNINRLDKNIVKMKNINKRLMKTELKHYKITKKVNKSNILI
Ga0307508_105791971	3300031616	Ectomycorrhiza	RNMNKLDKNIVMMKSINKRLMKAKLKHYKNTNKESKNMILI
Ga0307508_107399681	3300031616	Ectomycorrhiza	MIKKRNINKLDKNIVMMKSINKRLMRAKLEHYKSTKKESNNMILI
Ga0307514_100563771	3300031649	Ectomycorrhiza	MNKRNINRLDKNVVMMKNVNKRLMKAELKHYKITKKENKSKILI
Ga0307514_100650632	3300031649	Ectomycorrhiza	MNKRNINRLNKNIVTIKNINKRLMKAELKHYKIIKKENKSKILI
Ga0307514_101379641	3300031649	Ectomycorrhiza	MIKKRNINKLDRNIVTMKSINKRLMRAKLKHYKNTKKESKNMILI
Ga0307514_103122292	3300031649	Ectomycorrhiza	KLDKNIVMMKSINKRLMKTKLKHYKNRKKESKNMILI
Ga0307514_105516382	3300031649	Ectomycorrhiza	NKLDKNIVMIKSINKRLMKAKLKHYKNTKKKSKNMILI
Ga0307516_100179081	3300031730	Ectomycorrhiza	MIKKRNINKLDKNIVIMKSINKRLMGAKLKHYKNIKKESKNMILI
Ga0307516_100675532	3300031730	Ectomycorrhiza	MIKKRIINKLDKNIVMMKSINKRLLXAQLKHYKNIKKKRARTXSXSENQDA
Ga0307516_102397562	3300031730	Ectomycorrhiza	KIDMNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307516_103779132	3300031730	Ectomycorrhiza	KLDKNIVMMKNINKRLMKAKLKHYKNTKKESKNMILI
Ga0307516_104504823	3300031730	Ectomycorrhiza	MKKKNINKLDKNIVMMTSINKRLMKAKLKHYKNIKKESKNMILI
Ga0307516_106374511	3300031730	Ectomycorrhiza	INKLDKNIVMMKSINKRLMKAKLKHYKNTRKKARI
Ga0307516_107424621	3300031730	Ectomycorrhiza	VKKRNINKLDKNIVMMKNINKRLMKAKLKHYKNTKKES
Ga0307518_100667962	3300031838	Ectomycorrhiza	LNMIKKRNINKLDKNIVMMKIINKILMRAKLKHYKNIKRESKNMILIGKL
Ga0307518_101801751	3300031838	Ectomycorrhiza	DKNIVMMKGINKRLMIAKLKHYKNTKKESKNMILI
Ga0325403_10002747	3300032354	Xylem	MKKININKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0325403_10030504	3300032354	Xylem	MKKKNINKLDKNIVMMKDINKRLMKGKLKYYKNIMKESKNMILILKPR
Ga0325403_10357321	3300032354	Xylem	MNKRNINKLDKNIVMIKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0325403_10708911	3300032354	Xylem	MNKRNINRLDKNIVMMKNINKRLRKAELKHYKITKKENKSKILI
Ga0325401_10337191	3300032355	Xylem	MNKRNINRLDKNIVMMKNINKRLRKAELKHYKITKKENK
Ga0325401_10338271	3300032355	Xylem	MKKININKLDKNIVMMKIINKRLVKAKLKHYKNTRKESKNMILI
Ga0325401_11309851	3300032355	Xylem	LKIMNKRNINRLDKNIVMMKNINKRLRKAELKHYKITKKENKSKILI
Ga0325400_10175068	3300032374	Xylem	MKKININKLDKNIVMMKSINKRLMKAKIKHYKNTKKESKNMILI
Ga0325400_10301881	3300032374	Xylem	MSSVTNMIKKRNINKLDKNIIMMKSINKRLMRANLKHYKNTKKESKNMILI
Ga0325400_10400091	3300032374	Xylem	VNKRNINKLDKNIVMMKSINKRLMKAKLKHYKNTKK
Ga0325400_10450314	3300032374	Xylem	MNKRNINKLDKNIVMIKSINKRLIKAKLKHYKNTKKESKNMILI
Ga0325400_11977421	3300032374	Xylem	MIKKRNIHKLDKNIVMMKSINKRLIRAKLKHNRNIKKESKNMILI
Ga0325405_10015575	3300032389	Xylem	MTKRNINRLDKNIVMMKNINKRIMKAELKHNKITKKENKRKILI
Ga0325405_10338414	3300032389	Xylem	NINKLDKNIVMMKSINKRLMKAKLKHYKNIKKESKNMILI
Ga0325405_10745601	3300032389	Xylem	NKLDKNIVTMKNINKRLMKAKLKHYKNIKKERKNMILI
Ga0325404_10292694	3300032390	Xylem	MKKININKLNKNIVMMKSINNRLMKAKLKHYKNTKKESKNMS
Ga0325404_10657962	3300032390	Xylem	MIKKRNIHKLDKNIVMMKSINKRLIRAKLKHYKNIKKESKNMILI
Ga0307507_100104192	3300033179	Ectomycorrhiza	MNKRNINRLDKNVVMMKNVNKRLMKAELKHYKITKKENKSKILM
Ga0307507_101623952	3300033179	Ectomycorrhiza	INKLHKNIVMMKSINKRLMKAKLKQYKNTKKESKNMILI
Ga0307507_101793951	3300033179	Ectomycorrhiza	MIKKRNINKLDKNIVMMKSINKRLMRAKLKHYKSTKKESNNMILI
Ga0307507_102055911	3300033179	Ectomycorrhiza	DKNIVIMKSINKRLMGAKLKHYKNIKKESKNMILI
Ga0307507_102389051	3300033179	Ectomycorrhiza	MIKKININKLDKNIVMMKSINKRLMRAKLKYYKNTKKESKNMILI
Ga0307507_102405192	3300033179	Ectomycorrhiza	MIKNRNINKLDNNIVMMKSINKRLMRAKLKHYKHTKKESKNMILI
Ga0307507_103252621	3300033179	Ectomycorrhiza	NIMKKININKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNVILI
Ga0307507_104719202	3300033179	Ectomycorrhiza	KNINKLDKNIVMMKSINKRLMKAKLKHYKNIKKESKNMILI
Ga0307507_105292641	3300033179	Ectomycorrhiza	NIMKKININKLDKNIVMMKSINKRLMKAKLKHYKNTKKESKNMILI
Ga0307507_105855721	3300033179	Ectomycorrhiza	NKRNINRLDKNIVMMKNINKRLMKAELKHYKITKKENKSKILI
Ga0307510_100331419	3300033180	Ectomycorrhiza	NMIKKRNINKLDKNIVMMKSINKRLMKAKLKHYIYIYRERESKNMILI
Ga0307510_101119035	3300033180	Ectomycorrhiza	KNIVMMKSINKRLMKAKLKHYKNIKKESKNMILISKPR
Ga0307510_103733611	3300033180	Ectomycorrhiza	DKNIVMMKSINKRLMKAKLKHYKNIKKESKNMILI
Ga0325419_012614_3251_3388	3300034389	Leaf	MIKKRNINKLDKNIVMMKSTNKRLMGAKLKHYKNIKKESKNMILI

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F087981

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated	Open in IMG/M
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated	Open in IMG/M
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated	Open in IMG/M
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated	Open in IMG/M
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated	Open in IMG/M
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated	Open in IMG/M
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated	Open in IMG/M
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated	Open in IMG/M
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated	Open in IMG/M
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated	Open in IMG/M
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated	Open in IMG/M
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated	Open in IMG/M
3300032374	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1	Host-Associated	Open in IMG/M
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated	Open in IMG/M
3300032390	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1	Host-Associated	Open in IMG/M
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated	Open in IMG/M
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated	Open in IMG/M
3300034389	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign