Metagenome Family F087983

Basic Information
Family ID	F087983
Family Type	Metagenome
Number of Sequences	109
Average Sequence Length	39 residues
Representative Sequence	MKEKTNEEKEKKSESTGLNHQTWDPCHESLIIKQKKFNIKKL
Number of Associated Samples	18
Number of Associated Scaffolds	107

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.92 %
% of genes near scaffold ends (potentially truncated)	29.36 %
% of genes from short scaffolds (< 2000 bps)	43.12 %
Associated GOLD sequencing projects	18
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.39

Most Common Taxonomy
Group	Unclassified (57.798 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (77.982 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (78.899 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 107 Family Scaffolds
PF07727	RVT_2	2.80
PF08284	RVP_2	0.93
PF05938	Self-incomp_S1	0.93
PF00664	ABC_membrane	0.93
PF00931	NB-ARC	0.93
PF14223	Retrotran_gag_2	0.93
PF14226	DIOX_N	0.93
PF13833	EF-hand_8	0.93
PF00078	RVT_1	0.93
PF07859	Abhydrolase_3	0.93
PF03055	RPE65	0.93
PF00838	TCTP	0.93
PF02681	DUF212	0.93

COG ID	Name	Functional Category	% Frequency in 107 Family Scaffolds
COG0657	Acetyl esterase/lipase	Lipid transport and metabolism [I]	0.93
COG1963	Acid phosphatase family membrane protein YuiD	General function prediction only [R]	0.93
COG3670	Carotenoid cleavage dioxygenase or a related enzyme	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.93

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
All Organisms	root	All Organisms	42.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
cellular organisms	root	All Organisms → cellular organisms	42.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	23.85 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	18.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	22.94 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	18.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	22.94 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	18.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	22.02 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	18.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	22.02 %
Lactobacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales	18.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Lactobacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae	18.35 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	15.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Weissella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella	18.35 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	15.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	18.35 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	15.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	18.35 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	15.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	18.35 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	12.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	18.35 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	12.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	18.35 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	12.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	18.35 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	12.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	18.35 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	12.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	18.35 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	11.93 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	18.35 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	11.93 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	18.35 %
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	11.93 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	18.35 %
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	11.93 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	18.35 %
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	6.42 %
Salix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	3.67 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.80 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	18.35 %
Populus tomentosa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa	2.75 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1.83 %
Salix dunnii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix dunnii	0.92 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.92 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.92 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300028786\|Ga0307517_10001845	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	34744	Open in IMG/M
3300028786\|Ga0307517_10006509	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	17282	Open in IMG/M
3300028786\|Ga0307517_10029099	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6543	Open in IMG/M
3300028786\|Ga0307517_10035974	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	5586	Open in IMG/M
3300028786\|Ga0307517_10044280	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	4712	Open in IMG/M
3300028786\|Ga0307517_10047655	Not Available	4434	Open in IMG/M
3300028786\|Ga0307517_10053063	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	4046	Open in IMG/M
3300028786\|Ga0307517_10055636	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	3880	Open in IMG/M
3300028786\|Ga0307517_10066321	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	3323	Open in IMG/M
3300028786\|Ga0307517_10199904	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1251	Open in IMG/M
3300028786\|Ga0307517_10219841	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1156	Open in IMG/M
3300028786\|Ga0307517_10232216	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1105	Open in IMG/M
3300028794\|Ga0307515_10001435	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	53865	Open in IMG/M
3300028794\|Ga0307515_10029380	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	9293	Open in IMG/M
3300028794\|Ga0307515_10030666	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	9011	Open in IMG/M
3300028794\|Ga0307515_10041937	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7177	Open in IMG/M
3300028794\|Ga0307515_10086358	Not Available	4000	Open in IMG/M
3300028794\|Ga0307515_10124001	Not Available	2901	Open in IMG/M
3300028794\|Ga0307515_10184642	Not Available	2020	Open in IMG/M
3300028794\|Ga0307515_10185314	Not Available	2013	Open in IMG/M
3300028794\|Ga0307515_10202326	Not Available	1857	Open in IMG/M
3300028794\|Ga0307515_10237210	Not Available	1602	Open in IMG/M
3300028794\|Ga0307515_10277534	Not Available	1387	Open in IMG/M
3300030521\|Ga0307511_10009110	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa	9895	Open in IMG/M
3300030521\|Ga0307511_10138319	Not Available	1441	Open in IMG/M
3300030521\|Ga0307511_10171672	Not Available	1190	Open in IMG/M
3300030521\|Ga0307511_10281767	Not Available	768	Open in IMG/M
3300030521\|Ga0307511_10439143	Not Available	520	Open in IMG/M
3300030522\|Ga0307512_10332611	Not Available	682	Open in IMG/M
3300030522\|Ga0307512_10451166	Not Available	519	Open in IMG/M
3300031456\|Ga0307513_10034839	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	5641	Open in IMG/M
3300031456\|Ga0307513_10041270	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	5095	Open in IMG/M
3300031456\|Ga0307513_10050880	Not Available	4474	Open in IMG/M
3300031456\|Ga0307513_10056215	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix dunnii	4203	Open in IMG/M
3300031456\|Ga0307513_10089534	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3141	Open in IMG/M
3300031456\|Ga0307513_10151440	Not Available	2227	Open in IMG/M
3300031456\|Ga0307513_10173780	Not Available	2028	Open in IMG/M
3300031456\|Ga0307513_10602767	Not Available	807	Open in IMG/M
3300031456\|Ga0307513_10770544	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	667	Open in IMG/M
3300031507\|Ga0307509_10039410	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	5148	Open in IMG/M
3300031507\|Ga0307509_10043017	Not Available	4889	Open in IMG/M
3300031507\|Ga0307509_10048036	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	4586	Open in IMG/M
3300031507\|Ga0307509_10067146	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3758	Open in IMG/M
3300031507\|Ga0307509_10154032	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	2208	Open in IMG/M
3300031507\|Ga0307509_10156084	Not Available	2188	Open in IMG/M
3300031507\|Ga0307509_10181832	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1966	Open in IMG/M
3300031507\|Ga0307509_10350688	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1199	Open in IMG/M
3300031507\|Ga0307509_10461320	Not Available	962	Open in IMG/M
3300031507\|Ga0307509_10530848	Not Available	857	Open in IMG/M
3300031616\|Ga0307508_10164369	Not Available	1823	Open in IMG/M
3300031616\|Ga0307508_10419835	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	929	Open in IMG/M
3300031616\|Ga0307508_10513242	Not Available	794	Open in IMG/M
3300031616\|Ga0307508_10735888	Not Available	598	Open in IMG/M
3300031616\|Ga0307508_10791673	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	564	Open in IMG/M
3300031649\|Ga0307514_10096744	Not Available	2132	Open in IMG/M
3300031649\|Ga0307514_10165391	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1456	Open in IMG/M
3300031649\|Ga0307514_10212846	Not Available	1197	Open in IMG/M
3300031649\|Ga0307514_10311663	Not Available	872	Open in IMG/M
3300031649\|Ga0307514_10343539	Not Available	801	Open in IMG/M
3300031649\|Ga0307514_10372963	Not Available	746	Open in IMG/M
3300031649\|Ga0307514_10389682	Not Available	718	Open in IMG/M
3300031649\|Ga0307514_10392624	Not Available	713	Open in IMG/M
3300031649\|Ga0307514_10463665	Not Available	617	Open in IMG/M
3300031649\|Ga0307514_10522896	Not Available	556	Open in IMG/M
3300031730\|Ga0307516_10027606	All Organisms → cellular organisms → Eukaryota	5755	Open in IMG/M
3300031730\|Ga0307516_10033343	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	5181	Open in IMG/M
3300031730\|Ga0307516_10072128	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	3313	Open in IMG/M
3300031730\|Ga0307516_10092637	Not Available	2848	Open in IMG/M
3300031730\|Ga0307516_10155301	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	2044	Open in IMG/M
3300031730\|Ga0307516_10197512	Not Available	1733	Open in IMG/M
3300031730\|Ga0307516_10512620	Not Available	853	Open in IMG/M
3300031838\|Ga0307518_10020769	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa	4718	Open in IMG/M
3300031838\|Ga0307518_10127923	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1789	Open in IMG/M
3300031838\|Ga0307518_10227024	Not Available	1212	Open in IMG/M
3300031838\|Ga0307518_10267536	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1070	Open in IMG/M
3300032354\|Ga0325403_1001514	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	19472	Open in IMG/M
3300032354\|Ga0325403_1010141	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	8980	Open in IMG/M
3300032354\|Ga0325403_1010525	Not Available	8817	Open in IMG/M
3300032354\|Ga0325403_1015585	Not Available	7078	Open in IMG/M
3300032354\|Ga0325403_1015585	Not Available	7078	Open in IMG/M
3300032354\|Ga0325403_1019471	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa	6186	Open in IMG/M
3300032354\|Ga0325403_1026752	Not Available	4973	Open in IMG/M
3300032354\|Ga0325403_1027656	Not Available	4855	Open in IMG/M
3300032354\|Ga0325403_1039117	Not Available	3685	Open in IMG/M
3300032354\|Ga0325403_1049969	Not Available	2929	Open in IMG/M
3300032354\|Ga0325403_1088698	Not Available	1431	Open in IMG/M
3300032354\|Ga0325403_1088992	Not Available	1424	Open in IMG/M
3300032354\|Ga0325403_1089481	Not Available	1412	Open in IMG/M
3300032354\|Ga0325403_1146078	Not Available	658	Open in IMG/M
3300032355\|Ga0325401_1023272	Not Available	5703	Open in IMG/M
3300032355\|Ga0325401_1023272	Not Available	5703	Open in IMG/M
3300032389\|Ga0325405_1003299	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	16615	Open in IMG/M
3300032389\|Ga0325405_1032486	Not Available	3949	Open in IMG/M
3300032389\|Ga0325405_1033498	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	3841	Open in IMG/M
3300032389\|Ga0325405_1036687	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	3520	Open in IMG/M
3300032389\|Ga0325405_1058192	Not Available	2079	Open in IMG/M
3300032390\|Ga0325404_1006835	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	11948	Open in IMG/M
3300032741\|Ga0325414_1000800	Not Available	27923	Open in IMG/M
3300033179\|Ga0307507_10018785	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	7835	Open in IMG/M
3300033179\|Ga0307507_10056509	Not Available	3708	Open in IMG/M
3300033179\|Ga0307507_10071372	Not Available	3141	Open in IMG/M
3300033179\|Ga0307507_10100787	Not Available	2418	Open in IMG/M
3300033179\|Ga0307507_10265944	Not Available	1089	Open in IMG/M
3300033179\|Ga0307507_10295806	Not Available	997	Open in IMG/M
3300033180\|Ga0307510_10138048	Not Available	2090	Open in IMG/M
3300033180\|Ga0307510_10159865	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1852	Open in IMG/M
3300033180\|Ga0307510_10243858	Not Available	1289	Open in IMG/M
3300033180\|Ga0307510_10632684	Not Available	525	Open in IMG/M
3300034688\|Ga0325420_133970	Not Available	693	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.39
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.39
Powered by PDBe Molstar

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	77.98%
Wood	Host-Associated → Plants → Wood	20.18%
Phylloplane	Host-Associated → Plants → Phylloplane	1.83%

Habitat	Taxonomy	Distribution
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	77.98%
Xylem	Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem	20.18%
Leaf	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf	1.83%

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0307517_1000184532	3300028786	Ectomycorrhiza	MKKKTNEEKEKKSESTGLTHQTRLTRQTRDLCHESLIIKKKKFNIKKL
Ga0307517_100065091	3300028786	Ectomycorrhiza	MKKKTKEEKEKKSESIGLTSQTRLIHQTWDPCHESLIIKQKKFNIKKLN
Ga0307517_100290994	3300028786	Ectomycorrhiza	MKKTNEEKEKKSESTELTRQTWDLCHESLIIKQKKFNIKKLN
Ga0307517_100359741	3300028786	Ectomycorrhiza	MKKKTNEEKEKKYESTLLNYQTWDLYHESLIIKQKKVNMKKL
Ga0307517_100442801	3300028786	Ectomycorrhiza	MKKKKKKTESNGLTRQTWDPYHESLIIKQKKFNIKKLN
Ga0307517_100476551	3300028786	Ectomycorrhiza	LKKTIEEKEKKSESTELNHQTWDPCHESLIIKQKKFNIKKL
Ga0307517_100530633	3300028786	Ectomycorrhiza	MKKKKKKSESTGLTRQTWDSCHESLIIKQKKFNIKKLN
Ga0307517_100556363	3300028786	Ectomycorrhiza	MKKKKKKSESTGLNHQTWDPCHESMIIKQKKFNIKKL
Ga0307517_100663212	3300028786	Ectomycorrhiza	MKKKKSESTGLNHQTWDPCHESLIIKQKKFNVKKL
Ga0307517_101999041	3300028786	Ectomycorrhiza	REKNIQEEKGKKSESTGLNHQTWDPCHESLIIKQKI
Ga0307517_102198412	3300028786	Ectomycorrhiza	MKKTTIEEKEKKSESTRLNHQTWDPCHESLIIKQKKFNIKIL
Ga0307517_102322161	3300028786	Ectomycorrhiza	MKKKTNEEKEKKSESTGLTLQICDSCHESLIIKQKKFNIKKLN
Ga0307515_1000143513	3300028794	Ectomycorrhiza	MKKKKKKSESTGLNHQTWDPCHESLIIKQKKFNIKKL
Ga0307515_100293805	3300028794	Ectomycorrhiza	MKKKKKKSESTGLIRQTWDSYHESLIIKHKKFNIKKLN
Ga0307515_100306669	3300028794	Ectomycorrhiza	MKKKTNEEKEKKSELTRLTHQTWDSCHESLIIKQKKFNIKKLN
Ga0307515_100419371	3300028794	Ectomycorrhiza	MKKKKKKIESTGLNHQTWDPRHESLIIKQKNFNIKKL
Ga0307515_100863581	3300028794	Ectomycorrhiza	MKKKKKKSESTGLTHQTRLTRQTWDPCHESLIIKQKKFNIKKLN
Ga0307515_101240011	3300028794	Ectomycorrhiza	MKKRKKNSESTGLNHQTWDPCHESLIIKQKKFNIKKL
Ga0307515_101846422	3300028794	Ectomycorrhiza	MKKRKKNYESTGLNHQTWDPCHESLIIKQKKFNIKKL
Ga0307515_101853141	3300028794	Ectomycorrhiza	MKKKKKKSESTGLNHQTWDPYHESLIIKQKKFNIKKL
Ga0307515_102023261	3300028794	Ectomycorrhiza	MKKKKKKSKSTELTHQTRLTRQTWDPCHESLIIKQKKFNIK
Ga0307515_102372102	3300028794	Ectomycorrhiza	MKKKKKKSKSTELTHQTRLTRQTWDPCHESLIIKQKKFNIKKLN
Ga0307515_102775342	3300028794	Ectomycorrhiza	EEKEKKSESTGLNHQTWDPCHESLIIKQKKFNIKKL
Ga0307511_100091104	3300030521	Ectomycorrhiza	MKKKKKKSKSTGLNHQTWDPYHESLIIKQKKFNIKKL
Ga0307511_101383191	3300030521	Ectomycorrhiza	LMKKKKKKSELTGLTRQTWDPCHESLIIKQKTFNIKKL
Ga0307511_101716721	3300030521	Ectomycorrhiza	EKEKKSESTGLTRQTXDSCHESLIIKQKKFNINKLN
Ga0307511_102817671	3300030521	Ectomycorrhiza	MKEKTNEEKEKKSELTRLTHQTWDSCHESLIIKQKKFNIKKLN
Ga0307511_104391431	3300030521	Ectomycorrhiza	PNEEKEKKSELSGLTGQTWDSCHENLIIKQKKFNIKKLN
Ga0307512_103326111	3300030522	Ectomycorrhiza	EEKEKKSESTELTRQTWDLCHESLIIKQKKFNIKKLN
Ga0307512_104511662	3300030522	Ectomycorrhiza	KNKTNEEKKKRSESTGLTRQTWDPCHESLIIKQKKFKITKLN
Ga0307513_100348393	3300031456	Ectomycorrhiza	MKKNKKKSESTGLNHQTLDPCHESLIIKQKKFNIKKL
Ga0307513_100412703	3300031456	Ectomycorrhiza	MKKNKKKLESTRLIRQTXDSCHESLIIKQKKFNIKKLN
Ga0307513_100508801	3300031456	Ectomycorrhiza	MKKKSESTGLTRQTWDSCHESLIIKQKKFNIKKLN
Ga0307513_100562155	3300031456	Ectomycorrhiza	MKNKKSESTGLNHQTWDPCHESLIIKQKKFNIKKL
Ga0307513_100895342	3300031456	Ectomycorrhiza	MKKKKKKSGSTGLTRQTWGLCHESLIIKQKKFNIKKLN
Ga0307513_101514401	3300031456	Ectomycorrhiza	MKEKTNEEKEKKSESTGLNHQTWDPCHESLIIKQKKFNIKKL
Ga0307513_101737801	3300031456	Ectomycorrhiza	MKKKKKKSESTGLTRQTWDSCYESLIIKQKKFNIKKLN
Ga0307513_106027671	3300031456	Ectomycorrhiza	MKKKTNEEKEKKSELTRLSHQTWDSCHESLIIKQKKFNIKKLN
Ga0307513_107705442	3300031456	Ectomycorrhiza	EEKEKKSESTGLTRQTWDPCHESLIIKQKKFNIKKL
Ga0307509_100394102	3300031507	Ectomycorrhiza	MKKKKKKSELTGLNHQTLDPCHESLIIKQKKFNIKKL
Ga0307509_100430172	3300031507	Ectomycorrhiza	MKKKKSESTGLNHQTWNPCHESLIIKPKKFNIKKL
Ga0307509_100480362	3300031507	Ectomycorrhiza	MKKKTNEEKEKKSEYTGLTRQTWDPCNESLIIKQIKFNIKKLN
Ga0307509_100671462	3300031507	Ectomycorrhiza	MKKKKKKIESTGLNYQTWNPFHESLIIKQKKFNIKKL
Ga0307509_101540321	3300031507	Ectomycorrhiza	MKKKTKEEKEKKSESIGLTSQTRLIHQTWDPCYESLIIKQKKFNIKKLN
Ga0307509_101560841	3300031507	Ectomycorrhiza	MKKKKKKSKSTGLTRQTRDPCHESLIIKLKTFNIKKL
Ga0307509_101818321	3300031507	Ectomycorrhiza	MKKKTNEEKEKKYESTRLNYQTWDLYHESLIIKQKKVNMKKL
Ga0307509_103506882	3300031507	Ectomycorrhiza	IQEEKTIEEKEKKSESTGLNHQTWDPCYESLIIKHQKFNIKKL
Ga0307509_104613201	3300031507	Ectomycorrhiza	TGRKKLMKKKKSESTGLTCQTCDPCHESLIIKQKKFNIKKQN
Ga0307509_105308481	3300031507	Ectomycorrhiza	MKKKTNEEKEKKYESTGLNYQTWDLYHESLIIKQKKFNMKKL
Ga0307508_101643691	3300031616	Ectomycorrhiza	MKKKTNEEKEKKSESTGLTLQIYDSCHESLIIKQKKFNIKKLN
Ga0307508_104198352	3300031616	Ectomycorrhiza	LMKKKKKKSESTRLTRQTWDSCHESLIIKQKKFNIKKLN
Ga0307508_105132422	3300031616	Ectomycorrhiza	MKEKTNEEKEKKSESTGLNYQTWDPCHESLIIKQKKFNIKKL
Ga0307508_107358881	3300031616	Ectomycorrhiza	MKKKTNEEKEKKYESTGLNHQTWDLYHESLIIKQKKFNIKKL
Ga0307508_107916732	3300031616	Ectomycorrhiza	KNNQEKEKKSESTRLTHQIWDPCHESLIIKQKKFNIEKL
Ga0307514_100967441	3300031649	Ectomycorrhiza	MKKKKKKSESTGLTHQTRLTRQTWDPCHESLVIKQKKFNIKKLN
Ga0307514_101653912	3300031649	Ectomycorrhiza	MKKKTNEEKEKKSESTGLTHQTRLTRQTRDLCHESLIIKKKI
Ga0307514_102128461	3300031649	Ectomycorrhiza	NEEKEKKSESTGLNHQTWDPCHENLIIKQKKFNIKKL
Ga0307514_103116631	3300031649	Ectomycorrhiza	RKNKTNEEKKKRSESTGLTRQTWDPCHESLIIKQKKFKITKLN
Ga0307514_103435392	3300031649	Ectomycorrhiza	MKLEEKKTNEEKEKKSESTGLTRQIGLTRQTWDPCHESVITK
Ga0307514_103729631	3300031649	Ectomycorrhiza	NKTNEEKEKQSESTGLTRQTWDPCHESLIIKHKKFNINKLN
Ga0307514_103896821	3300031649	Ectomycorrhiza	KKLMKKKKKKSESTGLNHQTWDPCHESMIIKQKKFNIKKL
Ga0307514_103926242	3300031649	Ectomycorrhiza	KEKEKSESTGLNHQTWDPCHESLIIKQKKFNIKKL
Ga0307514_104636651	3300031649	Ectomycorrhiza	KKSESTGLNHQTWDPCHESLIIKQKKFNIKKLWKKIN
Ga0307514_105228961	3300031649	Ectomycorrhiza	MKKKKKKSESTGLTRQTWNPCHKNLIIKQKKNNIKK
Ga0307516_100276062	3300031730	Ectomycorrhiza	MKKKKSESTGLNHQTWDPCHESLIIKQKKFNIKKL
Ga0307516_100333435	3300031730	Ectomycorrhiza	MKKKKKKSESTGLTRQTWDPCHESLIIKQKKFNIKKLN
Ga0307516_100721282	3300031730	Ectomycorrhiza	MKKNKNKSESTGLTRQTWDSCHESLIIKQKNLILKN
Ga0307516_100926374	3300031730	Ectomycorrhiza	KEKNTDWKEKTNEKKEKKSESTGLNHQTWDLCHENLIIKHKKFNIKKL
Ga0307516_101553011	3300031730	Ectomycorrhiza	MKKKTNEEKKNSESTGLTRQTWDSCHESLIIKQKTFNIKKIN
Ga0307516_101975121	3300031730	Ectomycorrhiza	MKKKKKKSKSTGLTHQTRLTRQTWDPCHESLVIKQKKFNIKKLN
Ga0307516_105126201	3300031730	Ectomycorrhiza	RKKKTNEEKKKSESTGLTCQTWDPCHESLIIKQKKFNIKKLN
Ga0307518_100207692	3300031838	Ectomycorrhiza	MKKTTIEEKEKQSESTRLNHQTWDPCHESLIIKQKKFNIKIL
Ga0307518_101279231	3300031838	Ectomycorrhiza	MKEKTNEEKEKKSESTGLNHQTWDSCHESLIIKQKKFNIKKL
Ga0307518_102270241	3300031838	Ectomycorrhiza	KKTYRKKKTIEEKEKKSESTGLNHQTWDMCHESLIIKQKI
Ga0307518_102675361	3300031838	Ectomycorrhiza	TNEEKKKSESTGLTCQTWDPCHESLIIKQKKFNIKKLN
Ga0325403_10015143	3300032354	Xylem	MKKKKKKSESTGLILQTWDSCHESLIIKQKKFNIKKLN
Ga0325403_10101413	3300032354	Xylem	MKKKNNEEKEKKSESTGLTRQTWDPCHESLIIKQKKFNIKKL
Ga0325403_10105253	3300032354	Xylem	MKKKTSEKKENKSELAGLTRQTWDPCHESLIIKQKKFNIKKL
Ga0325403_10155853	3300032354	Xylem	MKEKTNEEKEKKSESTRLNYQTWDPCHESLIIKQKKFNIKKL
Ga0325403_10155855	3300032354	Xylem	MKEKTNEEKEKKSESTGLNHQTWDPCHESLIIKQKKFNFKKL
Ga0325403_10194715	3300032354	Xylem	MNKKKKKSESTRLTCQTWDSCHESLIIKQKKFNIKKLN
Ga0325403_10267522	3300032354	Xylem	MMKKTNEKKSESTRITYQTRLTHQTWDLCHKSLIIKQKKFNIKKLN
Ga0325403_10276562	3300032354	Xylem	MMKKTNEKKSESTGITYQIRLTHQTWDLCHKSLIIKQKKFNIKKLN
Ga0325403_10391172	3300032354	Xylem	MKEKTNEEKKIESIGLNHQTXDSCHESLIIKQKKFNIKKL
Ga0325403_10499691	3300032354	Xylem	MKKKKKKFESTGLTRQTWDPCHESLIIKQKKFNTKKLN
Ga0325403_10886982	3300032354	Xylem	MKEKTNEEKVKKSESTGLNHQTWDPCHESLIIKQKKFNINKL
Ga0325403_10889922	3300032354	Xylem	MKEKTNEEKEKKSESTGLNHQTWDPCHESLIIKQKKFNINKL
Ga0325403_10894811	3300032354	Xylem	RKKLMKKKRKKSESTGLNHQIWDPCHENLIIKQKKFNTKKL
Ga0325403_11460781	3300032354	Xylem	MKKKRKKSESTGLNHQIWDPCHENLIIKQKKFNTKKL
Ga0325401_10232721	3300032355	Xylem	MKEKTNEEKEKKSKSTGLNHQTWDPCHESLIIKQKKFNFKKL
Ga0325401_10232724	3300032355	Xylem	MKEKTNEEKEKKSESTRLNYQTWDLCHQSLIIKQKKFNIKKL
Ga0325405_100329916	3300032389	Xylem	MKKKKKKSESTRLNHQTWDPCHKSLIIKQKKFNIKKL
Ga0325405_10324863	3300032389	Xylem	MKEKTNEEKEKKSESTRLNYQTWDPCHQSLIIKQKKFNIKKL
Ga0325405_10334981	3300032389	Xylem	MKKKKKKYESTELNYQTWDPCHESLIIKQKKFNIKKL
Ga0325405_10366876	3300032389	Xylem	MKKKKKTSESIGLNHQTRDPCHESLIIKQKKFNIKKL
Ga0325405_10581921	3300032389	Xylem	LMKKKKKTSESIGLNHQTRDPCHESLIIKQKKFNIKKL
Ga0325404_10068358	3300032390	Xylem	MKKKKKKSESTRLNHQTWDPCHESLIIKQKKFNIKKL
Ga0325414_100080017	3300032741	Leaf	MRKKKKKSESTGLTRQTRDPCHKILMTKKKITLTN
Ga0307507_100187858	3300033179	Ectomycorrhiza	MKKKTNEEKEKKSESTGLTHQTRLTSQTRDLCHESLIIKKKKFNIKKL
Ga0307507_100565092	3300033179	Ectomycorrhiza	MKKKKSESTGLTCQTCDPCHESLIIKQKKFNIKKKN
Ga0307507_100713721	3300033179	Ectomycorrhiza	MKKKKKKSKSTELTRQTRDPCHESLIIKLKTFNIKKL
Ga0307507_101007871	3300033179	Ectomycorrhiza	MKKKTNEEKKNSESTGLTRQTWDSCHESLIIKQKKFNIKKIN
Ga0307507_102659441	3300033179	Ectomycorrhiza	KKKMNEKKKKSESTELTHQTWDPCHESLIIKQKKFNIKKL
Ga0307507_102958061	3300033179	Ectomycorrhiza	MKKKEKKSESTGLNHQTWDPCHESMIIKQKKFNIKKI
Ga0307510_101380481	3300033180	Ectomycorrhiza	MKEKTNEEKEKKSESTGLNHQTWDPCHENLIIKQKKFNIKKL
Ga0307510_101598651	3300033180	Ectomycorrhiza	MKKKTNEEKEKKYESTGLNHQIWDLYHESLIIKQKKFNIKKL
Ga0307510_102438581	3300033180	Ectomycorrhiza	RKNKTNEEKEKQSESTGLTRQTWDPCHESLIIKHKKFNINKLN
Ga0307510_106326841	3300033180	Ectomycorrhiza	MKKKKKKSESTRLTRQTWDSCHESLIIKQKKFNIKK
Ga0325420_133970_559_687	3300034688	Leaf	MKGKTNEEKEKKSESTGLNHQTWDPCHESLIIKQKKFNINKL

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F087983

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated	Open in IMG/M
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated	Open in IMG/M
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated	Open in IMG/M
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated	Open in IMG/M
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated	Open in IMG/M
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated	Open in IMG/M
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated	Open in IMG/M
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated	Open in IMG/M
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated	Open in IMG/M
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated	Open in IMG/M
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated	Open in IMG/M
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated	Open in IMG/M
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated	Open in IMG/M
3300032390	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1	Host-Associated	Open in IMG/M
3300032741	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3	Host-Associated	Open in IMG/M
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated	Open in IMG/M
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated	Open in IMG/M
3300034688	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign