Basic Information | |
---|---|
Family ID | F088138 |
Family Type | Metagenome |
Number of Sequences | 109 |
Average Sequence Length | 48 residues |
Representative Sequence | LSDEGDEDEDDTGRLSELIALAEAGLQAEEAEDDTGRLSELIALAEVGL |
Number of Associated Samples | 58 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 11.76 % |
% of genes near scaffold ends (potentially truncated) | 9.17 % |
% of genes from short scaffolds (< 2000 bps) | 15.60 % |
Associated GOLD sequencing projects | 58 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (100.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (93.578 % of family members) |
Environment Ontology (ENVO) | Unclassified (94.495 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (93.578 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 100.00 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 93.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.83% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.92% |
Food Waste | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Food Waste | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300021971 | Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed2 spades | Engineered | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0105243_130427451 | 3300009148 | Miscanthus Rhizosphere | EDEDDTARLSDLIALAEVGLQAEEAEDDTSRLSELIALAEAGL* |
Ga0157378_130704401 | 3300013297 | Miscanthus Rhizosphere | VLSDEGDEDEDDTTRLSELIALAEAGTQAQEAEDDTGRLNELIALAEAGM* |
Ga0157378_131964452 | 3300013297 | Miscanthus Rhizosphere | VLDNEGDEDEDDNGRLSDLITLAEVGLQVEKDEDDTGRLSEPIALAEAGL* |
Ga0182122_10285723 | 3300015267 | Miscanthus Phyllosphere | VGLQVEEAKDNTGRLSELIALAEAGLQEEEAEDDTSRLSELI |
Ga0182154_10535762 | 3300015268 | Miscanthus Phyllosphere | DDTARLSELIALAEAGLQTEEAEDDTGRLSELIALAEVGL* |
Ga0182113_10380822 | 3300015269 | Miscanthus Phyllosphere | VLADDWGEDEDDTAQLSDLIALAEAGLQAEEAEDDTGRLCELFALAETGL* |
Ga0182113_10541992 | 3300015269 | Miscanthus Phyllosphere | VETSEGGEDEDNTSRLSELIALAEVGLQVEEDEDDIGRLSELIVLTEKGL* |
Ga0182188_10461862 | 3300015274 | Miscanthus Phyllosphere | VLSDEGDEGEDDIARLSDLIALAETGLQAEEVEDDTGRLSELIALAETGL* |
Ga0182188_10469162 | 3300015274 | Miscanthus Phyllosphere | VLFDGGDEDEDDTARLSELIALAEAWLQAEEAEDDTGRLRELIALAEAG |
Ga0182172_10261222 | 3300015275 | Miscanthus Phyllosphere | VGLQAEEAEDDTSRLSELIALAEAGLQAEEAEDDTGRLSELIALAEVGL* |
Ga0182170_10584751 | 3300015276 | Miscanthus Phyllosphere | VLADDGDEDEDDTAQLSDLIALAEAGLQAEEAEDDIGRLSELIALAETGL* |
Ga0182170_10669682 | 3300015276 | Miscanthus Phyllosphere | VGLQAEEAEDNTSRLSELIALAETGMQAKEAEDDTGRLSELIALAEAGLHA* |
Ga0182170_10684231 | 3300015276 | Miscanthus Phyllosphere | VLSNEGDEDEDDTARLSDLITLAEMGLQAEEAKEDNSRLSELIALAEVGLRPA* |
Ga0182128_10488732 | 3300015277 | Miscanthus Phyllosphere | VLSDEGDEDEDDTGRLSELIALAEADMQAKDDDDNTGRLSELIALAEVGL* |
Ga0182124_10132841 | 3300015282 | Miscanthus Phyllosphere | VLAGDGDEDEDDTARLSDIIALAEAGLQAEEAEDDTGRLSELIAQAEM |
Ga0182124_10561803 | 3300015282 | Miscanthus Phyllosphere | VLPDEGDEDEDDAGRLSKLIALAEAGLQAKEDDDDTGRLSEL |
Ga0182124_10678611 | 3300015282 | Miscanthus Phyllosphere | VEEAEDDTGRLSELIALAEVGLQVEEAEDDTGRLSELIALADAGLQAEEA |
Ga0182156_10646282 | 3300015283 | Miscanthus Phyllosphere | VLSDEGDEDEDDTARLSELIALAEAGLQAEEAEDDTGRLSDLIALAETGLQAEEAED |
Ga0182186_10571732 | 3300015285 | Miscanthus Phyllosphere | PIVLADDGDEDEDDTVRLSDLIALAETGLQVEEAEEDTGRLSELIAQADAGL* |
Ga0182171_10288281 | 3300015287 | Miscanthus Phyllosphere | VLSDEGDEDEDDTARLSELIALAETGLQAEEAEDDTSRLSELIAL |
Ga0182173_10627021 | 3300015288 | Miscanthus Phyllosphere | RKRAGHNVESPIVLSDEEDEDEDDTARLSELIALAEVGLQAEEAEDDTGRLSELIALAEAGL* |
Ga0182138_10162042 | 3300015289 | Miscanthus Phyllosphere | VLSDEGDKDEDDTARLSELIALAEAGLQAEEAEDDTGRLSELIALAEVGL* |
Ga0182138_10228681 | 3300015289 | Miscanthus Phyllosphere | RTVQSSIVLSDEGDEDEDDTTRLSELIALAEAGTQAQEAEDDTGRLNELIALAEAGMQA* |
Ga0182125_10208253 | 3300015291 | Miscanthus Phyllosphere | LSDLITLAEVGLQAEEAEDDTGRLSEFTALAEAGL* |
Ga0182141_10205651 | 3300015292 | Miscanthus Phyllosphere | GDEDEDDTTRLSELIALAEAGLQTEEAEDDTGRQSELIALVEVGL* |
Ga0182175_10800821 | 3300015295 | Miscanthus Phyllosphere | VLSDEGDEDENDTTRLSDLIALAEVGLQVEKAEDDTGRLSELISLAEAG |
Ga0182175_10840652 | 3300015295 | Miscanthus Phyllosphere | VGLQAEEAEDDTGRLSELITLAEVGLQAEEAKEDTGRLSELVGLAEA |
Ga0182175_10995381 | 3300015295 | Miscanthus Phyllosphere | VLSGERDEDEDDTGRLSELIALAEAGLQGKEDEDDTGRLSELIALVEVGLQAE |
Ga0182157_10315902 | 3300015296 | Miscanthus Phyllosphere | VEEAEDDTGRLSELIALAEAGLQAEETKDDTSRLSELITLA* |
Ga0182157_10588593 | 3300015296 | Miscanthus Phyllosphere | VLSDEGDEDEDDTGRLSELIALAEVGLQAEEADDDTSRLSELIAL |
Ga0182106_10363622 | 3300015298 | Miscanthus Phyllosphere | VLSAEEDEDEDDTVRLSDLIALVEAGLQAEEAEDDTGRLSDLIALAEVGL* |
Ga0182107_10400182 | 3300015299 | Miscanthus Phyllosphere | VLSDEGDEDEDDTVRLSDLIALAKVEEVEDDTVRLSELIALARAAL* |
Ga0182107_10406211 | 3300015299 | Miscanthus Phyllosphere | VLSDEGDEDEDDTVRLSELIALAEVGIQAQEAKDDTGRLSELIALVEAGL* |
Ga0182107_10436012 | 3300015299 | Miscanthus Phyllosphere | VLSDEGDEDEDDTNRLSELIGLAEVGIQMQEVEDNTGRLSELIALVEAGLQAEEDDDGFFT* |
Ga0182123_10360521 | 3300015303 | Miscanthus Phyllosphere | LSDEEDDDKDDTARLSDPIALAEAGLQTEEAKDDIGRLRELIALAEAGLQGG* |
Ga0182112_10485671 | 3300015304 | Miscanthus Phyllosphere | VEEAEDDTDRSSELITLAEVGLQAEEAEEDTGRLSELIGLAEAGL* |
Ga0182112_11024302 | 3300015304 | Miscanthus Phyllosphere | VVADEGGKDEDDTARLSDLIALEEADLQAEEDEDGTGRLSELITLA |
Ga0182144_11098872 | 3300015307 | Miscanthus Phyllosphere | VLSDEGDKDEDNTARLSDLIALAEAGLQAEEAKDDTGRLSELIALAEAGLQVE |
Ga0182144_11102751 | 3300015307 | Miscanthus Phyllosphere | MLSDERDEDEDDTGRLSELIALAEAGIQAQEAEDDIGRLSELISLAKAGIQA* |
Ga0182142_11134311 | 3300015308 | Miscanthus Phyllosphere | VLDNEGDEDEDDTARLSILIALAEAGLQAEKDEDDTGRLSELIAVAEAGL* |
Ga0182140_10476472 | 3300015314 | Miscanthus Phyllosphere | LSDLIALAEVGLQVEEDEDDIGRLSELIVLTEKGL* |
Ga0182140_10570012 | 3300015314 | Miscanthus Phyllosphere | VLTDEGGEDEDNTGRLSEIIALVEAGLQAQEAEDDTGRLSELTALA |
Ga0182140_10988611 | 3300015314 | Miscanthus Phyllosphere | VLSDEGDEDEDDTTRLSELIALAEAGTQAQEAEDDTGRLSELIALAEASI* |
Ga0182127_10415443 | 3300015321 | Miscanthus Phyllosphere | VLDNEGDEDEDDTARLSILIALAEAGLQAEKDEDDTGRLSEL |
Ga0182127_10715453 | 3300015321 | Miscanthus Phyllosphere | DTGRLSELIALAEADLQTEEAEDDTDRLSELITLADVGLQAEEDGR* |
Ga0182127_10888301 | 3300015321 | Miscanthus Phyllosphere | VQSPIVWSDEGDEDKDDTARLSKLIALAEAGLQVEEAEDDIGRLRELIALAEAGL* |
Ga0182127_11240592 | 3300015321 | Miscanthus Phyllosphere | VLSDEGDEDEDDTTRLSELIALAEAGTQAQEAEDDTGRLSELIALAEAGMQA* |
Ga0182110_10680471 | 3300015322 | Miscanthus Phyllosphere | VLSDEGDEDEDDIARLSELIALAETGLQVEEAEDDTGRLSELI |
Ga0182129_10445951 | 3300015323 | Miscanthus Phyllosphere | MQAQEAEDDTDRLSELIALALAGMQAKEAEDDTGRLSKLIALVEAGL* |
Ga0182129_10648632 | 3300015323 | Miscanthus Phyllosphere | VLCDEGDEDEDDTGRLSELIALAEAGMQTQEAEDDTGSLSELIALAKMGM* |
Ga0182187_10655252 | 3300015341 | Miscanthus Phyllosphere | VLDNEGDEDEDDIARLSDLIALAEVGLHVKKNEDDTGSLSKFIALA |
Ga0182187_11206951 | 3300015341 | Miscanthus Phyllosphere | VLSDEGDEDEDDTARLSDLIALAEAGLQAEEAKDDTGRLSELIALA* |
Ga0182155_11014871 | 3300015343 | Miscanthus Phyllosphere | VEEAEDDTSRLSELIALAEAGLQAEEAEDDTGRLSKLITLAEAGL* |
Ga0182155_11541092 | 3300015343 | Miscanthus Phyllosphere | VLADDRDENEDSTAQLSDLIALTEVGLQAKEDEDDTGRLRELIALAEAGL* |
Ga0182189_10221162 | 3300015344 | Miscanthus Phyllosphere | AEAGLQAEKAEDDIGRLSELIGLAEAGLQAQEAEDDTERLSELIALAEAGL* |
Ga0182189_10442732 | 3300015344 | Miscanthus Phyllosphere | VLCDDGDEDEDDTGRLSELIALAEAGIQTQEAEDDTGRLSKLISLAEAGIQA* |
Ga0182111_12250211 | 3300015345 | Miscanthus Phyllosphere | VLSDEGDEDEGDTARLSDLIALAEVSLQAKEDEDDTGGLSELIALAEVGL* |
Ga0182139_10526782 | 3300015346 | Miscanthus Phyllosphere | DTGRLSELIALAEVGLQAEEAKDDTGRLSELIALAEAGL* |
Ga0182139_11279852 | 3300015346 | Miscanthus Phyllosphere | LSDFIALAEAGLQAEEAKDDTGRLSKLIALAEAGL* |
Ga0182177_10382491 | 3300015347 | Miscanthus Phyllosphere | EDEDETARLSDLIALAEARLQVEKDEDDTGRLSELIALA* |
Ga0182177_10850951 | 3300015347 | Miscanthus Phyllosphere | VLSDEGDEDEDDTARWSDLIALAETGLQAEDAEDDIARLSELIALAE |
Ga0182177_11896622 | 3300015347 | Miscanthus Phyllosphere | MRGGEDEDNIGRLSELIALAEAGLQAEEAEDDTGRLRGLITLAEVGLHVEKAKDDT |
Ga0182177_12288872 | 3300015347 | Miscanthus Phyllosphere | MLSNEGDEDEDDTGRLSELIVLAEAGLQAKEAEDDTGRLSELIALAEASL* |
Ga0182161_11627772 | 3300015351 | Miscanthus Phyllosphere | VVADDGDEDQDNTARLSDLIALAEVGLQAEEDEDDTGRLSELIALEEASL* |
Ga0182161_12039552 | 3300015351 | Miscanthus Phyllosphere | MLSDEGNEDEDDTATLSELIALAEVGLQADETEDDTGRLSELIALAEAGL* |
Ga0182161_12368221 | 3300015351 | Miscanthus Phyllosphere | DDTTRLSELIAIEEAGLQVEEAKDDTDRLSKLIALADAGL* |
Ga0182161_12618982 | 3300015351 | Miscanthus Phyllosphere | VLSDGGDEDEDGTAKLSDLIALAEAGLQVEETEDDTGRLSELIALAEAGLQA* |
Ga0182161_12630181 | 3300015351 | Miscanthus Phyllosphere | MLAYDGDEDEDDTARLSDLIALVEASLQVEEVEEDTSRLNEL |
Ga0182159_12219042 | 3300015355 | Miscanthus Phyllosphere | VLSDEGDEDEDDTTRLSELIALAEAGTQAQEAEDDTGRLNELIALAEAGMQA* |
Ga0182159_13460371 | 3300015355 | Miscanthus Phyllosphere | LFDEGDEDEDDTTRLSELIALAEAGLQTEEAEDDTGRLSELIALAEVGL* |
Ga0182159_13464702 | 3300015355 | Miscanthus Phyllosphere | DTGRLSQLIALAEAGLQTQEAEDDTGRLSELIALEEVGL* |
Ga0182145_10770201 | 3300015361 | Miscanthus Phyllosphere | MSDDGDEDEDDTAWLSDLIALAEAGLQAEEDEDDTGRLSKLITLAEV |
Ga0182220_10990462 | 3300017407 | Miscanthus Phyllosphere | VEDDTGRLSELIALVEVGLQAEEAEDDIGRLSELIALAEAGL |
Ga0182220_11080411 | 3300017407 | Miscanthus Phyllosphere | SRAGRTVQSPILLSDEGDEDEDDTGRLSELVALAEVGLQVLEAEDDTGRLSELIALAEVG |
Ga0182220_11100041 | 3300017407 | Miscanthus Phyllosphere | LQAEEVDDDTGRLSELIALAEVGLQAEEAEDDTGKLSELITLAEAGLQAEEDDNAF |
Ga0182208_10529222 | 3300017411 | Miscanthus Phyllosphere | LSDKEDEDEDDTVRLSVLIALAEAGLQVEEAEDDTGRLSELIALAEAGL |
Ga0182208_10923911 | 3300017411 | Miscanthus Phyllosphere | VEEAEDDTGRLSGLIALAEASLQAEEVEDDTGRLTKLIALAEVG |
Ga0182208_11156711 | 3300017411 | Miscanthus Phyllosphere | VLSDEGDEDKNDTARLSDLIALAEAGLHAEEADDDTGRLSELIALAEVGLQVKEA |
Ga0182208_11184702 | 3300017411 | Miscanthus Phyllosphere | LIVLSDEGDEDEDNTGRLSELIALAEAGLQAYEVEDDTGRLSELIALAEAGL |
Ga0182222_10692802 | 3300017413 | Miscanthus Phyllosphere | DDTARLSDLIALAEAGLQADEAEDDNSRLSELIALAKAGMQA |
Ga0182230_10283281 | 3300017417 | Miscanthus Phyllosphere | LQVKEDEDDTGRLSELIALAEVGLQAEEAEDDTGRLNELIALAEAGL |
Ga0182230_10762362 | 3300017417 | Miscanthus Phyllosphere | VLADDGDEDEDNTARLSDLIALAEAGLQAEEDEDDTSRLSELIA |
Ga0182230_10768511 | 3300017417 | Miscanthus Phyllosphere | VLSDEGDEDEDDTARLSNLIALAEAGLQAEEAEDDTGRLSELIALAEAGLQAEEDDDAFF |
Ga0182219_10561191 | 3300017424 | Miscanthus Phyllosphere | LTGGATARGNEDEDDTSRLSEFIALAEAGIQAQEAEDDTGRLSELIALAEVGL |
Ga0182219_10653632 | 3300017424 | Miscanthus Phyllosphere | VLSDEGDEDEDDTTRLSDLIALAEAGLQTKEAEDDTSRLSELITLAEVCL |
Ga0182219_10847172 | 3300017424 | Miscanthus Phyllosphere | MLAYDGDEDEDDTARLSDLIALVEVGLQVEEAEDDTGRLGELIAQADAGL |
Ga0182219_11272102 | 3300017424 | Miscanthus Phyllosphere | KKRAGRTVQSPIVLSDEGDEDEDDTARLSELIALAEAGLQAEEAEDDTGRLSELIALAEAGL |
Ga0182219_11287401 | 3300017424 | Miscanthus Phyllosphere | DEGDEDEDDTGRLSELIALAKAGLQAEEAEDDTGRLSELIALAEAGL |
Ga0182219_11363821 | 3300017424 | Miscanthus Phyllosphere | DEDEDDTGRLSELIALAEAGLQAKEDEDDTGRLSELIALVEVGL |
Ga0182224_10958191 | 3300017425 | Miscanthus Phyllosphere | VLSDEGDEDEDDTARLSELIALAEMGLQAEEAEDDTDRLSKLIALAEAGL |
Ga0182224_11131132 | 3300017425 | Miscanthus Phyllosphere | VLSDEGDEDENDTGRLSELIALAETGLQTQEADYDTDRLSELVALAEAGL |
Ga0182190_10950862 | 3300017427 | Miscanthus Phyllosphere | VEEAEDDIGRLSELIALAEVGLQAKEAKDDAGRLSELIAL |
Ga0182190_11446521 | 3300017427 | Miscanthus Phyllosphere | VEKDEDDTGRLSELIVLAEAGLQAQKAKDDTGRLSEPIALAEMG |
Ga0182192_10981421 | 3300017430 | Miscanthus Phyllosphere | EEAEDDTGRLSKLIALAEVSLRAEEAEDNSGRLSELIALAEADL |
Ga0182192_11084271 | 3300017430 | Miscanthus Phyllosphere | VLADDGDEDEDDTARLSDLIALVEAGLQAEEVDDDTGRLSELIALAEAGL |
Ga0182206_10781981 | 3300017433 | Miscanthus Phyllosphere | DEGDDDEDDTARLNDLIALAEVGLQAEDAEDDTGRLNELIALAKAGL |
Ga0182206_11058161 | 3300017433 | Miscanthus Phyllosphere | VLSDEGDEDEDGTARLSNLIALAEVDLQAKEAKDDPGRLSELIALAEVGL |
Ga0182209_11218252 | 3300017436 | Miscanthus Phyllosphere | VLSDEGDEDENDTTRLSDLIALAEAGLQAEEAEDDTGRLSELIALAEAGL |
Ga0182233_10776391 | 3300017680 | Miscanthus Phyllosphere | VLADDGGDEDEDDTTRLSDLIALVEVGLQAEEAEEDISRLSELI |
Ga0182233_10787001 | 3300017680 | Miscanthus Phyllosphere | GLQAEEAEDDTGRLNELIALAETGLQAEEAEDDTGRLSELIALTEVGL |
Ga0182229_10209871 | 3300017682 | Miscanthus Phyllosphere | IVLCDDGDEDEDDTGRLSELIALAEAGIQAQEAEDDTGRLSELIALAEVGIQA |
Ga0182218_10380791 | 3300017683 | Miscanthus Phyllosphere | VEEAKDDTGRLSELIALAEAGLQAEEAEDDTDRLSELIALAEMGL |
Ga0182225_10695882 | 3300017684 | Miscanthus Phyllosphere | VLSDEGDEDEDDTARLSDLIALAEVGLQVEEDEDNIGRLSELIALAEEVL |
Ga0182205_10147491 | 3300017686 | Miscanthus Phyllosphere | VLCDDGDEDEDDTGRLSELIALAEVGIQAQEADDDTGRLSELISLAEAGIQA |
Ga0182223_10420731 | 3300017690 | Miscanthus Phyllosphere | VLADDGDEDEDDTARLSDLIALVEAGLQVEEAEDDTGRLGEL |
Ga0227318_104317302 | 3300021971 | Food Waste | MATVELMEEEDDDTSRLSELIALAEAGLHEEEEDDMSRLSELIALAEAGLRAQE |
Ga0207642_111467271 | 3300025899 | Miscanthus Rhizosphere | VLCDDGDEDEDDTSRLSELIALAEAGIQAQEAEDDTVRLSELIALAEVG |
Ga0207669_113349732 | 3300025937 | Miscanthus Rhizosphere | LSDEGDEDEDDTGRLSELIALAEAGLQAEEAEDDTGRLSELIALAEVGL |
Ga0209486_103798173 | 3300027886 | Agricultural Soil | MATVELMEEEDDDTSRLSELIALAEAGLHEEEEDDMSRLSELIALAE |
⦗Top⦘ |