Metagenome / Metatranscriptome Family F088146

Basic Information
Family ID	F088146
Family Type	Metagenome / Metatranscriptome
Number of Sequences	109
Average Sequence Length	43 residues
Representative Sequence	MSLGSNGVDRERSLRKILARHRGMNICINCTSLARFAPSFVQ
Number of Associated Samples	83
Number of Associated Scaffolds	109

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	14.68 %
% of genes near scaffold ends (potentially truncated)	96.33 %
% of genes from short scaffolds (< 2000 bps)	98.17 %
Associated GOLD sequencing projects	80
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.42

Most Common Taxonomy
Group	Unclassified (100.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (36.697 % of family members)
Environment Ontology (ENVO)	Unclassified (76.147 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (75.229 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43%
Feature Viewer

Powered by Feature Viewer

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	100.00 %

Scaffold	Taxonomy	Length	IMG/M Link
3300005335\|Ga0070666_10223488	Not Available	1328	Open in IMG/M
3300005335\|Ga0070666_10883062	Not Available	660	Open in IMG/M
3300005347\|Ga0070668_102006566	Not Available	533	Open in IMG/M
3300005467\|Ga0070706_101156633	Not Available	712	Open in IMG/M
3300005549\|Ga0070704_101049547	Not Available	739	Open in IMG/M
3300005617\|Ga0068859_101460343	Not Available	755	Open in IMG/M
3300005618\|Ga0068864_101162318	Not Available	769	Open in IMG/M
3300005842\|Ga0068858_100676527	Not Available	1003	Open in IMG/M
3300005842\|Ga0068858_101336781	Not Available	705	Open in IMG/M
3300009092\|Ga0105250_10622992	Not Available	502	Open in IMG/M
3300009101\|Ga0105247_11015735	Not Available	649	Open in IMG/M
3300009177\|Ga0105248_13177102	Not Available	523	Open in IMG/M
3300009553\|Ga0105249_10478390	Not Available	1288	Open in IMG/M
3300009553\|Ga0105249_13260800	Not Available	522	Open in IMG/M
3300009972\|Ga0105137_101509	Not Available	877	Open in IMG/M
3300009979\|Ga0105032_115369	Not Available	607	Open in IMG/M
3300009980\|Ga0105135_127356	Not Available	527	Open in IMG/M
3300009981\|Ga0105133_102390	Not Available	1027	Open in IMG/M
3300009989\|Ga0105131_132928	Not Available	559	Open in IMG/M
3300009992\|Ga0105120_1044550	Not Available	553	Open in IMG/M
3300009992\|Ga0105120_1051711	Not Available	521	Open in IMG/M
3300009995\|Ga0105139_1056596	Not Available	702	Open in IMG/M
3300010371\|Ga0134125_10904797	Not Available	969	Open in IMG/M
3300010371\|Ga0134125_11956903	Not Available	637	Open in IMG/M
3300010399\|Ga0134127_11207574	Not Available	823	Open in IMG/M
3300010399\|Ga0134127_12285189	Not Available	620	Open in IMG/M
3300010399\|Ga0134127_13672409	Not Available	504	Open in IMG/M
3300013306\|Ga0163162_13364294	Not Available	511	Open in IMG/M
3300015278\|Ga0182099_1065199	Not Available	522	Open in IMG/M
3300015280\|Ga0182100_1062538	Not Available	593	Open in IMG/M
3300015284\|Ga0182101_1035669	Not Available	709	Open in IMG/M
3300015301\|Ga0182184_1091151	Not Available	521	Open in IMG/M
3300015309\|Ga0182098_1042079	Not Available	736	Open in IMG/M
3300015309\|Ga0182098_1092315	Not Available	567	Open in IMG/M
3300015311\|Ga0182182_1083038	Not Available	580	Open in IMG/M
3300015312\|Ga0182168_1124335	Not Available	523	Open in IMG/M
3300015315\|Ga0182120_1092040	Not Available	592	Open in IMG/M
3300015315\|Ga0182120_1107393	Not Available	558	Open in IMG/M
3300015318\|Ga0182181_1064141	Not Available	617	Open in IMG/M
3300015324\|Ga0182134_1097889	Not Available	592	Open in IMG/M
3300015325\|Ga0182148_1020380	Not Available	986	Open in IMG/M
3300015325\|Ga0182148_1121919	Not Available	540	Open in IMG/M
3300015326\|Ga0182166_1065912	Not Available	676	Open in IMG/M
3300015327\|Ga0182114_1069817	Not Available	706	Open in IMG/M
3300015327\|Ga0182114_1124039	Not Available	563	Open in IMG/M
3300015328\|Ga0182153_1049598	Not Available	764	Open in IMG/M
3300015328\|Ga0182153_1110392	Not Available	573	Open in IMG/M
3300015330\|Ga0182152_1106853	Not Available	584	Open in IMG/M
3300015330\|Ga0182152_1145283	Not Available	516	Open in IMG/M
3300015333\|Ga0182147_1131321	Not Available	560	Open in IMG/M
3300015333\|Ga0182147_1164134	Not Available	509	Open in IMG/M
3300015335\|Ga0182116_1060479	Not Available	788	Open in IMG/M
3300015337\|Ga0182151_1052510	Not Available	782	Open in IMG/M
3300015337\|Ga0182151_1099142	Not Available	620	Open in IMG/M
3300015338\|Ga0182137_1053766	Not Available	822	Open in IMG/M
3300015348\|Ga0182115_1285497	Not Available	522	Open in IMG/M
3300015349\|Ga0182185_1106671	Not Available	809	Open in IMG/M
3300015352\|Ga0182169_1104427	Not Available	909	Open in IMG/M
3300015352\|Ga0182169_1156864	Not Available	743	Open in IMG/M
3300015352\|Ga0182169_1163939	Not Available	726	Open in IMG/M
3300015353\|Ga0182179_1131189	Not Available	771	Open in IMG/M
3300017408\|Ga0182197_1075592	Not Available	655	Open in IMG/M
3300017408\|Ga0182197_1118795	Not Available	552	Open in IMG/M
3300017439\|Ga0182200_1108823	Not Available	582	Open in IMG/M
3300017445\|Ga0182198_1177673	Not Available	530	Open in IMG/M
3300017694\|Ga0182211_1107333	Not Available	655	Open in IMG/M
3300020223\|Ga0182118_106992	Not Available	636	Open in IMG/M
3300025931\|Ga0207644_11266844	Not Available	620	Open in IMG/M
3300025941\|Ga0207711_11813832	Not Available	553	Open in IMG/M
3300025961\|Ga0207712_10939700	Not Available	766	Open in IMG/M
3300025986\|Ga0207658_10876830	Not Available	816	Open in IMG/M
3300026088\|Ga0207641_11276860	Not Available	734	Open in IMG/M
3300026095\|Ga0207676_12523565	Not Available	510	Open in IMG/M
3300028049\|Ga0268322_1022992	Not Available	680	Open in IMG/M
3300028051\|Ga0268344_1001023	Not Available	1334	Open in IMG/M
3300028051\|Ga0268344_1011640	Not Available	645	Open in IMG/M
3300028052\|Ga0268300_1002100	Not Available	1340	Open in IMG/M
3300028054\|Ga0268306_1012375	Not Available	702	Open in IMG/M
3300028058\|Ga0268332_1000626	Not Available	2060	Open in IMG/M
3300028058\|Ga0268332_1005335	Not Available	1176	Open in IMG/M
3300028062\|Ga0268342_1001756	Not Available	1423	Open in IMG/M
3300028062\|Ga0268342_1006160	Not Available	955	Open in IMG/M
3300028063\|Ga0268350_1045059	Not Available	640	Open in IMG/M
3300028064\|Ga0268340_1002300	Not Available	1524	Open in IMG/M
3300028064\|Ga0268340_1003855	Not Available	1331	Open in IMG/M
3300028139\|Ga0268355_1006257	Not Available	705	Open in IMG/M
3300028142\|Ga0268347_1026030	Not Available	552	Open in IMG/M
3300028142\|Ga0268347_1034015	Not Available	506	Open in IMG/M
3300028143\|Ga0268348_1015827	Not Available	588	Open in IMG/M
3300028144\|Ga0268345_1006322	Not Available	785	Open in IMG/M
3300028144\|Ga0268345_1015587	Not Available	611	Open in IMG/M
3300028147\|Ga0268303_100166	Not Available	2547	Open in IMG/M
3300028152\|Ga0268336_1005398	Not Available	840	Open in IMG/M
3300028153\|Ga0268320_1012234	Not Available	658	Open in IMG/M
3300028155\|Ga0268349_1042291	Not Available	584	Open in IMG/M
3300028248\|Ga0268312_1006141	Not Available	871	Open in IMG/M
3300028251\|Ga0268324_1000578	Not Available	1506	Open in IMG/M
3300028251\|Ga0268324_1000847	Not Available	1358	Open in IMG/M
3300028253\|Ga0268316_1017117	Not Available	565	Open in IMG/M
3300028262\|Ga0268310_1004503	Not Available	1082	Open in IMG/M
3300028463\|Ga0268325_101121	Not Available	865	Open in IMG/M
3300028468\|Ga0268317_1000366	Not Available	1426	Open in IMG/M
3300028472\|Ga0268315_1001030	Not Available	1300	Open in IMG/M
3300028472\|Ga0268315_1008636	Not Available	718	Open in IMG/M
3300028473\|Ga0268319_1014390	Not Available	593	Open in IMG/M
3300028475\|Ga0268327_1009799	Not Available	683	Open in IMG/M
3300028477\|Ga0268309_1016609	Not Available	546	Open in IMG/M
3300028523\|Ga0268313_1007715	Not Available	664	Open in IMG/M
3300032465\|Ga0214493_1105490	Not Available	668	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	93.58%
Environmental	Environmental	6.42%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	93.58%
Terrestrial	Environmental → Terrestrial	6.42%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	68.81%
Rhizosphere	Host-Associated → Plants → Rhizosphere	11.01%
Unclassified	Host-Associated → Plants → Unclassified	7.34%
Soil	Environmental → Terrestrial → Soil	6.42%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.42%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	68.81%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	7.34%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.42%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.42%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	4.59%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.59%
Loam	Environmental → Terrestrial → Soil → Loam	1.83%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	68.81%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	7.34%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.42%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.42%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	4.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.59%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.83%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	36.70%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	32.11%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	7.34%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	6.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.50%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.59%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	4.59%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.92%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009972	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG	Host-Associated	Open in IMG/M
3300009979	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG	Host-Associated	Open in IMG/M
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated	Open in IMG/M
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated	Open in IMG/M
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300020223	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028051	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028052	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028054	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028062	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028063	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028139	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028142	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028143	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028144	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028147	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028152	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028155	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028251	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028253	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028463	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028468	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028473	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028475	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028477	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028523	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070666_102234881	3300005335	Switchgrass Rhizosphere	KETHQNMSLGSNGVDRERSLRKNQARNRGMKFCINCTSLARFAPSFVQ*
Ga0070666_108830621	3300005335	Switchgrass Rhizosphere	MVPNAPKREETHQNMSLGSSGVDQERSLCKILTRHRGMNFCINCTSLARFVASIV*
Ga0070668_1020065661	3300005347	Switchgrass Rhizosphere	MSLGSNGVDRDRSLQKILTRHRGTNFCINCTSLARFAAIF
Ga0070706_1011566331	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MVPNAPKREETHQNMSLGSSGVDQERSLCKILTRHRGMNFCINCTSLARFVASFV*
Ga0070704_1010495471	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MSLGSNGVDRERSLRKILKRRRGTNFCINCTSLARFAASFV
Ga0068859_1014603431	3300005617	Switchgrass Rhizosphere	KETHQNMSLGSNGVDRERSLRKIMTQLRGTNSYINCTSLARYAPSFVQ*
Ga0068864_1011623181	3300005618	Switchgrass Rhizosphere	MSLGSNGVDRERSLRKIQARNRGMKFCINCTSLARFAPSFVQ*
Ga0068858_1006765271	3300005842	Switchgrass Rhizosphere	MSLGSNGVDRERSLRKIMTQLRGTNSYINCTSLAR
Ga0068858_1013367811	3300005842	Switchgrass Rhizosphere	MSLGSNGVDRERSLRKILARHRGMNICINCTSLARFAPSFVQ
Ga0105250_106229921	3300009092	Switchgrass Rhizosphere	QREETHQNMSLGSSGMDQERSLRKILTRHRGMNFCINCTSLARFVASFV*
Ga0105247_110157351	3300009101	Switchgrass Rhizosphere	KRKETHQNMSLGSYGVDRERSLRKIQARNRGMKFCINCTSLARFAPSFMQ*
Ga0105248_131771021	3300009177	Switchgrass Rhizosphere	KETQQNMSLGSNGVDREDLLRKIVRRHRGMNFCINCTRFAHFAPSFVQ*
Ga0105249_104783901	3300009553	Switchgrass Rhizosphere	QNMSLGSNGVDRERSLRKNQARNRGMKFCINCTSLARFAPSFVQ*
Ga0105249_132608001	3300009553	Switchgrass Rhizosphere	SLVSNGVDRERWLQKIMTRLRGKIFYINCSSLARIAPSFVQ*
Ga0105137_1015091	3300009972	Switchgrass Associated	VDRESLLRKILTGLRGTNFCINCTSLARFAASFVQ*
Ga0105032_1153692	3300009979	Switchgrass Associated	MSLGSNGMDRERSL*KIMTRLRGMNSYINCTSLAR
Ga0105135_1273561	3300009980	Switchgrass Associated	EMHQNMSLGSNGVDRERSLRKIMTRLRGMSFYINCTCLARYAPCFMQ*
Ga0105133_1023901	3300009981	Switchgrass Associated	MSLGSSGVDRERLLQKILTTHRGTNFCINCTSLARFVASFV
Ga0105131_1329281	3300009989	Switchgrass Associated	MHKNMSLGSNGVDCERSLQKIITRLRSTNYYINCTSLARYA
Ga0105120_10445501	3300009992	Switchgrass Associated	LVSSGVDQERSLQKILTRHRGMNFCINCTSLARFAATLVQ*
Ga0105120_10517111	3300009992	Switchgrass Associated	QNMSLGCNGVDRERLLRKILTKHHGTKFCINSTSLARFAASFVQ*
Ga0105139_10565961	3300009995	Switchgrass Associated	MILVSNGVDRERSLQKIITRLRGTNFYINCTSLARFAPSFGQ*
Ga0134125_109047971	3300010371	Terrestrial Soil	KETHQSMSLGSNGVDRERSLRKIQARNRGMKFCINCTSLARFAPSFVQ*
Ga0134125_119569031	3300010371	Terrestrial Soil	GSNSVDRERSLRKIMTRLRGTKFYINYTSLARFTPSFVQ*
Ga0134127_112075741	3300010399	Terrestrial Soil	NMSLGSNSVDRERSLQKILTRHHGLNFCINCTSLARFAAGFVQ*
Ga0134127_122851891	3300010399	Terrestrial Soil	MSLGSNAVDREHTLRKIPTRLHGMKFCINCTSLARFAQSFVQYRNGPRCTQ
Ga0134127_136724091	3300010399	Terrestrial Soil	MSLGSNGVDRERSLRKILARHHGMNICINCTSLAR
Ga0163162_133642941	3300013306	Switchgrass Rhizosphere	KWKEKHQNKSLGSNGVDWEHSLRKILARHRGMNFCINCTSFARFAPSFVQ*
Ga0182099_10651991	3300015278	Switchgrass Phyllosphere	MSLGSHGVDRERSLRKILTRHRGMNFCINCTSLVRFAASFV
Ga0182100_10625381	3300015280	Switchgrass Phyllosphere	MGLGSNGVDREHSLQKILTRHRGTNFCINCTGLVRFAAS
Ga0182101_10356691	3300015284	Switchgrass Phyllosphere	MSLGSNGVDRERSLQKILTRHHGLNFCINCTSLARFAAGFV
Ga0182184_10911511	3300015301	Switchgrass Phyllosphere	KETKQNMSLGSNGVDREHSLRKVLARHRGMNFCNNCTSLARFAPSFVQ*
Ga0182098_10420791	3300015309	Switchgrass Phyllosphere	RETHPNMSLGSNGVDRERSLQKLLTRHRGKNFCINCTSLARFAASLVQ*
Ga0182098_10923151	3300015309	Switchgrass Phyllosphere	KQKETHENLSLGSNGVDQGRSLQKILMRLRGTNFFTNFTSLARFALSFV*
Ga0182182_10830381	3300015311	Switchgrass Phyllosphere	MLQNMSLGSNGVDQMRTLQKNSTRLRGTNFCINCTSSAKIA
Ga0182168_11243351	3300015312	Switchgrass Phyllosphere	HPNMSLGSNGVDRERSLQKILTRHRGTNFCINYTSLARFAASFMQ*
Ga0182120_10920401	3300015315	Switchgrass Phyllosphere	KEMHQNMSLGSNGVDRERSLRKIMTRLRGTNFCINCTSLARFAANFVQ*
Ga0182120_11073931	3300015315	Switchgrass Phyllosphere	MSLGSNGLDRERSLRKILARHRGMNICINCTSLARFAASFV
Ga0182181_10641411	3300015318	Switchgrass Phyllosphere	MHQNMSLGSNGVDRERSL*KVVSRLRATNFHINCTSLARFAPSF
Ga0182134_10978891	3300015324	Switchgrass Phyllosphere	KETHQNMILGSNSVDRERSLQKNLTRHRGLNICINCTSLARFAASFVQ*
Ga0182148_10203801	3300015325	Switchgrass Phyllosphere	QKKTHQNMSLGSNGANRERSLQKILARHRGMNICINCTSLARFAPSFVQ*
Ga0182148_11219191	3300015325	Switchgrass Phyllosphere	MHQNMSLGSNGVDRERSLQKFLTRHRGTNFCINCNSSARFAQSF
Ga0182166_10659121	3300015326	Switchgrass Phyllosphere	NGVDRERSLQKIQTRHRGTNFCINCTSLARFAASFVQ*
Ga0182114_10698171	3300015327	Switchgrass Phyllosphere	RETHPNMSLGSNGVDRERSLQKILTRHRGTNFSINCTSLARFAASFMQ*
Ga0182114_11240391	3300015327	Switchgrass Phyllosphere	MSLGSNGVDRERSLQKILTRHRGTNFCINYTSLARFAASFMQ*
Ga0182153_10495981	3300015328	Switchgrass Phyllosphere	NMSLGSNGVDRERSLRKNQARNRGMKFCINCTSLARFAPSFVQ*
Ga0182153_11103921	3300015328	Switchgrass Phyllosphere	MSLGSNGVDRDRSLQKIQTRHRGTNFCINCTSLARFAA
Ga0182152_11068531	3300015330	Switchgrass Phyllosphere	SLGSNGVDRERSLQKIQTRHRGTNFCINCTSLARFAASFVQ*
Ga0182152_11452831	3300015330	Switchgrass Phyllosphere	MSLGSNGVDRERSLQKTLARHRGMNICINCTSLARFAL
Ga0182147_11313211	3300015333	Switchgrass Phyllosphere	SNGVDRERSLRKIQARNRGMKFCINCTSLARFAPSFVQ*
Ga0182147_11641341	3300015333	Switchgrass Phyllosphere	MSLGSIGVDRQLSLQKIMTRLRGTNFYINCTSLAR
Ga0182116_10604791	3300015335	Switchgrass Phyllosphere	MSLGSNGVDQERSLRKIQAQNRGMKFCINCTSLAHFAPSFVQ*
Ga0182151_10525101	3300015337	Switchgrass Phyllosphere	MHQNMSLGSNGVDRERSLGKVVSRLCATNFHINCTSLARF
Ga0182151_10991421	3300015337	Switchgrass Phyllosphere	SLGSNGADRERSLQKILTRHRGTNFCINCTSLVRFAPSFVQ*
Ga0182137_10537661	3300015338	Switchgrass Phyllosphere	QQNMSLGSNGVDREDLLRKIVRRHRGMNFCINCTGFAHFAPSFVQ*
Ga0182115_12854971	3300015348	Switchgrass Phyllosphere	MSLGSNGADRERSLQKILTRHRGMNFCINCTSLVRFAASFVQ
Ga0182185_11066711	3300015349	Switchgrass Phyllosphere	QNMSLGSNGVDREHLLRKIVRRHRGMNFCINCTGFAHFAPSFVQ*
Ga0182169_11044272	3300015352	Switchgrass Phyllosphere	MSLGKNGEDLERSLQKILTRHRCTNFCINCTSLARFAPSFVQYQNC
Ga0182169_11568641	3300015352	Switchgrass Phyllosphere	REQKEMHKNMSLGFNGVDRERSLRKILTRHRGMNFCINCTSLARFAASFVQ*
Ga0182169_11639391	3300015352	Switchgrass Phyllosphere	MSLGSNGVDRERSLWKIMTRLRGTNSYINCTSLARYAPSF
Ga0182179_11311891	3300015353	Switchgrass Phyllosphere	QNMSLGSNGVDRERSLRKIMTRLRGTNFFINCTSLARFAASFGQ*
Ga0182197_10755921	3300017408	Switchgrass Phyllosphere	NMSLGSNGVDREHLLRKIVRRHRGMNFCINCTGFAHFAPSFVQ
Ga0182197_11187951	3300017408	Switchgrass Phyllosphere	MSLGSYGVDRECLLRKIQARNRGMKFCINCTSLARFAPSFVQ
Ga0182200_11088231	3300017439	Switchgrass Phyllosphere	MSLGSNGVDRERSLQKILTRHRGTNFCINCTSLARFAQSFM
Ga0182198_11776731	3300017445	Switchgrass Phyllosphere	THQNMILGSNSVDQERSLQKNLTRHRGLNFCINYTSLARFAASFVQ
Ga0182211_11073331	3300017694	Switchgrass Phyllosphere	NSVDREWSLQKNLTRHRGLNFCINGTSLARFAASFVQ
Ga0182118_1069921	3300020223	Switchgrass Phyllosphere	MHLNMSLGSSGVDRERSLRKILARYRGMNFCINCTSLARFAPSFV
Ga0207644_112668441	3300025931	Switchgrass Rhizosphere	MSLGSNGVDRERSLQKILTRHRGTNFSINCTSLAHFAAS
Ga0207711_118138321	3300025941	Switchgrass Rhizosphere	ETQQNMSLGSNGVDREDLLRKIVRRHRGMNFCINCTRFAHFAPSFVQ
Ga0207712_109397001	3300025961	Switchgrass Rhizosphere	HQNMSLGSNGMDRERSLRKNQARNRGMKFCINCTSLARFAPSFVQ
Ga0207658_108768301	3300025986	Switchgrass Rhizosphere	ETHPNMSLGSNGVDRERSLQNILTRHRGTNFCINCTSLARFATSFMQ
Ga0207641_112768601	3300026088	Switchgrass Rhizosphere	MSLGSNGANRERSLQKILARHRGMNICINCTSLARF
Ga0207676_125235651	3300026095	Switchgrass Rhizosphere	MHQNMSLGSNGVDRERSLRKILTRLRGTNFCINFTSLARFAAS
Ga0268322_10229921	3300028049	Phyllosphere	HQSMSLGFNGVDRERSLRKIQARNRGMKFCINCTSLARFAPSFVQ
Ga0268344_10010233	3300028051	Phyllosphere	NMSLGSNGVDRERSLRKIQARNRGMKFCINCTSLARFAPSFVQ
Ga0268344_10116401	3300028051	Phyllosphere	SLGSNGVDRERSLRKIQARNRGMKFCINCTSLARFAPSFVQ
Ga0268300_10021001	3300028052	Phyllosphere	HENMSLGSNGVDRERSLRKIQARNRGMKFCINCTSLARFAPSFVQ
Ga0268306_10123751	3300028054	Phyllosphere	MSFGSNGVDRERSLRKIQARNRGMKFCINCTSLARFAPSFVQ
Ga0268332_10006261	3300028058	Phyllosphere	MSLGSNGVDRERSLRKILARHRGMNICINCTSLARFA
Ga0268332_10053351	3300028058	Phyllosphere	EETHQNMSLGSSGMDQERSLRKILTRHRGMNFCINCTSLARFVASFV
Ga0268342_10017562	3300028062	Phyllosphere	MSLGKNGEDLERSLQKILTRHRCTNFCINCTSLARFAPSFVQYQNCSKM
Ga0268342_10061601	3300028062	Phyllosphere	EMHQNMSLGSNGVDRERSLRKIMTRLRGTNSYINCTSLARYAPSFVQ
Ga0268350_10450591	3300028063	Phyllosphere	SNSVDRERSLQKILTRRRGLNFCINCTSLACFAASFVQ
Ga0268340_10023003	3300028064	Phyllosphere	MSLGKNGEDLERSLQKILTRHRCTNFCINCTSLARFAP
Ga0268340_10038551	3300028064	Phyllosphere	TEQNMSLGSNGVDREHSLRKVLARHRGMNFCNNCTSLARFAPSFVQ
Ga0268355_10062571	3300028139	Phyllosphere	QNMSLGSNGADRERSLQKILTRHRGTNFCINCTSLVRFAASFVQ
Ga0268347_10260301	3300028142	Phyllosphere	MSLGSNGVDRERSLQKILTRHHGLNFCINCTSLACFAAGFMQ
Ga0268347_10340151	3300028142	Phyllosphere	MSLGSNGVDRERSLQKFLTRHRGTNFCINCTSLARFAQSF
Ga0268348_10158271	3300028143	Phyllosphere	LGSNSVDRERSLQKILTRRRGLNFCINCTSLACFAASFVQ
Ga0268345_10063221	3300028144	Phyllosphere	YGVYRERSLRKIQARNRGMKFCINCTSLARFAPSFMQ
Ga0268345_10155871	3300028144	Phyllosphere	NSVDRERSLQKILARRRGLNFCINCTSLACFAASFVQ
Ga0268303_1001662	3300028147	Phyllosphere	MSLGSNGVDRERSLRKILARHRGMNICINCTSLARFAASFVQ
Ga0268336_10053981	3300028152	Phyllosphere	MSLDSNGVDRERLLRKFLTTHRGTNFCINCTRLAHL
Ga0268320_10122341	3300028153	Phyllosphere	MHQNMSLGSNGVDRERSLQKFLTRHRGTNFCINCTSLARFA
Ga0268349_10422911	3300028155	Phyllosphere	MSLGSYGVDRECLLRKIQARNRGMKFCINCTNLARFAPSFV
Ga0268312_10061411	3300028248	Phyllosphere	MNLGSNGVDRERSLRKILARHRGMNICINCTSLERFA
Ga0268324_10005781	3300028251	Phyllosphere	QNMSLGFNGVDREHSLRKVLARHRGMNFCNNCTSLARFAPSFVQ
Ga0268324_10008472	3300028251	Phyllosphere	MSLGSNGANRERSLQKILARHRGMNICINCTSLARFATSFVQ
Ga0268316_10171171	3300028253	Phyllosphere	MRLGSNGVDRERSLRKIIARHRGMNICINCTSLARFVPSF
Ga0268310_10045031	3300028262	Phyllosphere	KETHQNMSLGYNSVDRERSLQKILTRHRGLNFCINCTSLACFAASFVH
Ga0268325_1011211	3300028463	Phyllosphere	MHQNMSLGSNSVDRERSLQKILTRHHGLNFCINCTSLARFAAGFVQ
Ga0268317_10003662	3300028468	Phyllosphere	MSLGSNGVDRERSLQKILTRHRGTNFYINCTSLASFAASFMQ
Ga0268315_10010302	3300028472	Phyllosphere	MVPNAPKREETHQNMSLGSSGVDQERSLCKILTRHRGMNFCINCTSLARFVASIV
Ga0268315_10086361	3300028472	Phyllosphere	LEQKETHQSMSLGSNGVDRERSLRKIQARNRGMKFCINCTSLARFAPSFVQ
Ga0268319_10143901	3300028473	Phyllosphere	MHQNMSLGSNGVDRERSLQKFLTRHRGTNFCINCTSLARFAQSFMQ
Ga0268327_10097991	3300028475	Phyllosphere	NGVDQERSLRKIQTRHRGMNFCINCTSLARFAASFVQ
Ga0268309_10166091	3300028477	Phyllosphere	NGVDRERSLRKIMTQLRGTNSYINCTSLARYAPSFVQ
Ga0268313_10077151	3300028523	Phyllosphere	VDQERSLQKILTRRRGLNFCINCTSLACFAASFVQ
Ga0214493_11054901	3300032465	Switchgrass Phyllosphere	MSLDSNGVDRERLLRKFLKTHRGTNFCINCTSLAYFAASFV

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.42
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.42
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F088146

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign