NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F088623

Metagenome / Metatranscriptome Family F088623

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088623
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 42 residues
Representative Sequence GDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL
Number of Associated Samples 99
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 88.07 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.083 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen
(19.266 % of family members)
Environment Ontology (ENVO) Unclassified
(32.110 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(34.862 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.75%    β-sheet: 0.00%    Coil/Unstructured: 49.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF06974WS_DGAT_C 9.17
PF00497SBP_bac_3 5.50
PF00887ACBP 1.83
PF00515TPR_1 1.83
PF13483Lactamase_B_3 0.92
PF00437T2SSE 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG4281Acyl-CoA-binding proteinLipid transport and metabolism [I] 1.83

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.08 %
UnclassifiedrootN/A0.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001213|JGIcombinedJ13530_102678425All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria690Open in IMG/M
3300005172|Ga0066683_10403846All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales844Open in IMG/M
3300005290|Ga0065712_10420102All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales713Open in IMG/M
3300005293|Ga0065715_10931967All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales565Open in IMG/M
3300005467|Ga0070706_102085100All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales513Open in IMG/M
3300005568|Ga0066703_10205848All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1195Open in IMG/M
3300005617|Ga0068859_100982347All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria927Open in IMG/M
3300005618|Ga0068864_102137238All Organisms → cellular organisms → Bacteria → Proteobacteria566Open in IMG/M
3300005719|Ga0068861_100084997All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2485Open in IMG/M
3300005994|Ga0066789_10165194All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales938Open in IMG/M
3300005995|Ga0066790_10222996All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales804Open in IMG/M
3300006794|Ga0066658_10500289All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales661Open in IMG/M
3300006806|Ga0079220_10037198All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2205Open in IMG/M
3300006904|Ga0075424_100196478All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2142Open in IMG/M
3300006918|Ga0079216_11678497All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria541Open in IMG/M
3300009075|Ga0105090_10301776All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria981Open in IMG/M
3300009091|Ga0102851_12469960All Organisms → cellular organisms → Bacteria → Proteobacteria594Open in IMG/M
3300009147|Ga0114129_11869105All Organisms → cellular organisms → Bacteria → Proteobacteria729Open in IMG/M
3300009179|Ga0115028_11194898All Organisms → cellular organisms → Bacteria → Proteobacteria626Open in IMG/M
3300009545|Ga0105237_10708139All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1013Open in IMG/M
3300010360|Ga0126372_10751777All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria959Open in IMG/M
3300010397|Ga0134124_10356775All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1379Open in IMG/M
3300012201|Ga0137365_10709769All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria735Open in IMG/M
3300012202|Ga0137363_11557415All Organisms → cellular organisms → Bacteria → Proteobacteria553Open in IMG/M
3300012209|Ga0137379_10576394All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1032Open in IMG/M
3300012209|Ga0137379_10886124All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria797Open in IMG/M
3300012354|Ga0137366_10514950All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria863Open in IMG/M
3300012359|Ga0137385_10547288All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria977Open in IMG/M
3300012361|Ga0137360_10652116All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria903Open in IMG/M
3300012532|Ga0137373_10699562All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria756Open in IMG/M
3300012582|Ga0137358_10674444All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria692Open in IMG/M
3300012987|Ga0164307_10306706Not Available1134Open in IMG/M
3300014261|Ga0075360_1155586All Organisms → cellular organisms → Bacteria → Proteobacteria501Open in IMG/M
3300014319|Ga0075348_1190567All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300014969|Ga0157376_11044872All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria841Open in IMG/M
3300017965|Ga0190266_10871588All Organisms → cellular organisms → Bacteria → Proteobacteria587Open in IMG/M
3300017974|Ga0187777_10821186All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria665Open in IMG/M
3300018429|Ga0190272_12261415All Organisms → cellular organisms → Bacteria → Proteobacteria585Open in IMG/M
3300018476|Ga0190274_10368285All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1376Open in IMG/M
3300019279|Ga0184642_1584524All Organisms → cellular organisms → Bacteria → Proteobacteria576Open in IMG/M
3300020006|Ga0193735_1140003All Organisms → cellular organisms → Bacteria → Proteobacteria640Open in IMG/M
3300021086|Ga0179596_10729994All Organisms → cellular organisms → Bacteria → Proteobacteria501Open in IMG/M
3300021432|Ga0210384_10692968All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria912Open in IMG/M
3300021560|Ga0126371_10295382All Organisms → cellular organisms → Bacteria → Proteobacteria1746Open in IMG/M
3300025461|Ga0208851_1089645All Organisms → cellular organisms → Bacteria → Proteobacteria505Open in IMG/M
3300025901|Ga0207688_10191418All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1223Open in IMG/M
3300025903|Ga0207680_10926262All Organisms → cellular organisms → Bacteria → Proteobacteria624Open in IMG/M
3300025905|Ga0207685_10024339All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2075Open in IMG/M
3300025907|Ga0207645_10066244All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2309Open in IMG/M
3300025910|Ga0207684_11631290All Organisms → cellular organisms → Bacteria → Proteobacteria521Open in IMG/M
3300025923|Ga0207681_10091502All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2173Open in IMG/M
3300025923|Ga0207681_10879730All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria750Open in IMG/M
3300025925|Ga0207650_10056818All Organisms → cellular organisms → Bacteria2909Open in IMG/M
3300025937|Ga0207669_11598140All Organisms → cellular organisms → Bacteria → Proteobacteria556Open in IMG/M
3300025939|Ga0207665_11563449All Organisms → cellular organisms → Bacteria → Proteobacteria523Open in IMG/M
3300025941|Ga0207711_10900579All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria822Open in IMG/M
3300026067|Ga0207678_10870705All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria796Open in IMG/M
3300026088|Ga0207641_11021354All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria824Open in IMG/M
3300026331|Ga0209267_1012593All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-434509Open in IMG/M
3300027727|Ga0209328_10187495All Organisms → cellular organisms → Bacteria → Proteobacteria625Open in IMG/M
3300027765|Ga0209073_10016765All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2095Open in IMG/M
3300027890|Ga0209496_10623057All Organisms → cellular organisms → Bacteria → Proteobacteria585Open in IMG/M
3300027899|Ga0209668_10187899All Organisms → cellular organisms → Bacteria → Proteobacteria1278Open in IMG/M
3300027900|Ga0209253_10187559All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1658Open in IMG/M
3300027907|Ga0207428_10755459All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria693Open in IMG/M
3300028381|Ga0268264_11976303All Organisms → cellular organisms → Bacteria → Proteobacteria592Open in IMG/M
3300028679|Ga0302169_10065626All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria853Open in IMG/M
3300028739|Ga0302205_10171620All Organisms → cellular organisms → Bacteria → Proteobacteria555Open in IMG/M
3300028743|Ga0302262_10093576All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1032Open in IMG/M
3300028868|Ga0302163_10248756All Organisms → cellular organisms → Bacteria → Proteobacteria506Open in IMG/M
3300029923|Ga0311347_10340635All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria914Open in IMG/M
3300029981|Ga0302293_10235157All Organisms → cellular organisms → Bacteria → Proteobacteria564Open in IMG/M
3300029984|Ga0311332_10000934All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria15920Open in IMG/M
3300029990|Ga0311336_10189246All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1674Open in IMG/M
3300029990|Ga0311336_11399336All Organisms → cellular organisms → Bacteria → Proteobacteria614Open in IMG/M
3300030000|Ga0311337_10178848All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1733Open in IMG/M
3300030014|Ga0302175_10148197All Organisms → cellular organisms → Bacteria → Proteobacteria554Open in IMG/M
3300030048|Ga0302273_1079800All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria970Open in IMG/M
3300030048|Ga0302273_1097042All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria872Open in IMG/M
3300030294|Ga0311349_10023969All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria5500Open in IMG/M
3300030294|Ga0311349_10505505All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1143Open in IMG/M
3300030294|Ga0311349_12171304All Organisms → cellular organisms → Bacteria → Proteobacteria509Open in IMG/M
3300030339|Ga0311360_10433675All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1056Open in IMG/M
3300031170|Ga0307498_10354079All Organisms → cellular organisms → Bacteria → Proteobacteria565Open in IMG/M
3300031232|Ga0302323_100197574All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2030Open in IMG/M
3300031232|Ga0302323_101080675All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria893Open in IMG/M
3300031521|Ga0311364_11195701All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria755Open in IMG/M
3300031720|Ga0307469_12155027All Organisms → cellular organisms → Bacteria → Proteobacteria542Open in IMG/M
3300031726|Ga0302321_100022022All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria5927Open in IMG/M
3300031726|Ga0302321_101208384All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria866Open in IMG/M
3300031902|Ga0302322_101641105All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria786Open in IMG/M
3300031903|Ga0307407_10592481All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria824Open in IMG/M
3300031918|Ga0311367_12252118All Organisms → cellular organisms → Bacteria → Proteobacteria522Open in IMG/M
3300031938|Ga0308175_101754498All Organisms → cellular organisms → Bacteria → Proteobacteria695Open in IMG/M
3300032173|Ga0315268_11667701All Organisms → cellular organisms → Bacteria → Proteobacteria650Open in IMG/M
3300032179|Ga0310889_10700221All Organisms → cellular organisms → Bacteria → Proteobacteria529Open in IMG/M
3300032397|Ga0315287_11865245All Organisms → cellular organisms → Bacteria → Proteobacteria667Open in IMG/M
3300032782|Ga0335082_10498092All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1080Open in IMG/M
3300032782|Ga0335082_10976770All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria711Open in IMG/M
3300033419|Ga0316601_102358120All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300033482|Ga0316627_101629250All Organisms → cellular organisms → Bacteria → Proteobacteria658Open in IMG/M
3300033513|Ga0316628_102676947All Organisms → cellular organisms → Bacteria → Proteobacteria657Open in IMG/M
3300034125|Ga0370484_0038003All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales1166Open in IMG/M
3300034147|Ga0364925_0421190All Organisms → cellular organisms → Bacteria → Proteobacteria507Open in IMG/M
3300034176|Ga0364931_0213228All Organisms → cellular organisms → Bacteria → Proteobacteria631Open in IMG/M
3300034177|Ga0364932_0108775All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1053Open in IMG/M
3300034354|Ga0364943_0204737All Organisms → cellular organisms → Bacteria → Proteobacteria727Open in IMG/M
3300034354|Ga0364943_0370556All Organisms → cellular organisms → Bacteria → Proteobacteria550Open in IMG/M
3300034417|Ga0364941_193507All Organisms → cellular organisms → Bacteria → Proteobacteria525Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen19.27%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.50%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment5.50%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.67%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.75%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.75%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland1.83%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.83%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.83%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.92%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.92%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.92%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.92%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.92%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.92%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300014261Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D1EnvironmentalOpen in IMG/M
3300014319Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025461Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028679Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3EnvironmentalOpen in IMG/M
3300028739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3EnvironmentalOpen in IMG/M
3300028743Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4EnvironmentalOpen in IMG/M
3300028868Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3EnvironmentalOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029981Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_2EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030014Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3EnvironmentalOpen in IMG/M
3300030048Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3EnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M
3300034417Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ13530_10267842513300001213WetlandGAPAAGMSLDHAAYHVLALFAPLLLGDGRALIERLGVDYL*
Ga0066683_1040384613300005172SoilRAAETVSLDRAAYQVLSLIAPFLRGDARALLDRLSRDYL*
Ga0065712_1042010223300005290Miscanthus RhizosphereSFQRIGAHGGGDAAAVSLDRAAYQVLALIAPYLMGDGRALIERLGQDYL*
Ga0065715_1093196713300005293Miscanthus RhizosphereGGGDAAAVSLDRAAYQVLALIAPYLLGDGRALIERLGQDYL*
Ga0070706_10208510023300005467Corn, Switchgrass And Miscanthus RhizosphereGQRAADAVSLERAAYQVLALIAPFLRGNARALLDRLSGDYL*
Ga0066703_1020584813300005568SoilETVSLDRAAYQVLSLIAPFLRGDARALLDRLSRDYL*
Ga0068859_10098234723300005617Switchgrass RhizosphereKSGGDEVNLDLAAYHVLALFAPFLLGEGRALVERLGEDYL*
Ga0068864_10213723813300005618Switchgrass RhizosphereAGGEDVSLDHAAYHVLALFAPFLLGDGRALIERLGEDYL*
Ga0068861_10008499743300005719Switchgrass RhizospherePRLDRAAYQVMALVAPFMHGDARALIDRLGDEYL*
Ga0066789_1016519423300005994SoilISYQRIAAQQPDAAAVNLDRAAYQVLSLIAPFLQGTSRTLLDRLSRDYL*
Ga0066790_1022299613300005995SoilQPDAEAVSLDRAAYQVLSLIAPFLQGPARALLDRLSQDYL*
Ga0066658_1050028923300006794SoilSTGERAAQAFSLDRAAYQVLSLIAPFLRGNARALLDRLSRDYL*
Ga0079220_1003719843300006806Agricultural SoilGPRGGEHSDRPVNLDRAAYQVLSLIAPFLRGDARALLDRLSRDYL*
Ga0075424_10019647843300006904Populus RhizosphereGAHGVGSGADMNLDLAAYRVLALFAPFLVGDGRALIERLGEEYL*
Ga0079216_1167849723300006918Agricultural SoilLGLDRAAYQVLALIAPFTFGAAHALIERLGERYL*
Ga0105090_1030177613300009075Freshwater SedimentAAMSLERAAYQVLALIAPFTVGSARALIERLGDRYL*
Ga0102851_1246996013300009091Freshwater WetlandsTARGDAGDIDLGRGAYQVLALIAPFLVGDARALLDRLGRDYL*
Ga0114129_1186910523300009147Populus RhizosphereETINLDRAAYQVLSLIAPFLRGDARALLDRLSRDYL*
Ga0115028_1119489813300009179WetlandRGDAGDIDLGRGAYQVLALIAPFLVGDARALLDRLGRDYL*
Ga0105237_1070813913300009545Corn RhizosphereDQRGQSPSLDRAAYQVLSLIAPFLRGPSRTLLARLSQGYL*
Ga0126372_1075177723300010360Tropical Forest SoilAESVSLDRAAYQVLSLIAPFLRGDARALVERLSAEYL*
Ga0134124_1035677513300010397Terrestrial SoilMQHSASGEAGDVSLDHAAYHVLALVAPFLTGDGRALIERLGEDYL*
Ga0137365_1070976913300012201Vadose Zone SoilRIGYGDNEDQREADAGRAAYQVLALIAPYLLGDARVLLDRLGADYL*
Ga0137363_1155741523300012202Vadose Zone SoilAAGERDTEAISLDRAAFQVLSLIAPYLRGSARALVERLSRDYL*
Ga0137379_1057639413300012209Vadose Zone SoilASDSAGAVVSLDRAAYQVLSLIAPFLEGTHRALLDRLSQDYL*
Ga0137379_1088612423300012209Vadose Zone SoilAQRSQASVNLDRAVYQVLSLIAPFLRGDDRALLDRLSRDYLH*
Ga0137366_1051495023300012354Vadose Zone SoilVNLDRAVYQVLSLIAPFLRGDERALLDRLSRDYLQ*
Ga0137385_1054728823300012359Vadose Zone SoilVSLDRAAYQVLSLIAPFLRGDARTLLDRLSHDYL*
Ga0137360_1065211623300012361Vadose Zone SoilEAVNLDHAAYQVLSLIAPFLQGSSRALIDRLSQDYL*
Ga0137373_1069956223300012532Vadose Zone SoilVSLDRAAYQVLSLIAPFLRGDARALLDRLSRDYL*
Ga0137358_1067444413300012582Vadose Zone SoilINLDHAAYQVLSLIAPFLRGSARTLLDRLSQNYL*
Ga0164307_1030670633300012987SoilSDHRREAPSLDRAAHQVLSLIAPFLRGPSRTLLARLSQGYL*
Ga0075360_115558613300014261Natural And Restored WetlandsGDDPAVSLDRAAYQVLALIAPYLVGDGRALIERLGEDYL*
Ga0075348_119056723300014319Natural And Restored WetlandsPVGDDAAMSLERAAYQVLALIAPFTVGSARALIERLGDRYL*
Ga0157376_1104487213300014969Miscanthus RhizosphereTARLDRAAYQVLALIAPFMVGPARALIDRLGSDYL*
Ga0190266_1087158813300017965SoilSDAAANLDHAAYHVLALFAPFLVGNDRALLERLGEDYL
Ga0187777_1082118623300017974Tropical PeatlandISYQKLSAGEHASDAVSLDRAAYQVLALIAPFLRGDARALVERLSGEYL
Ga0190272_1226141513300018429SoilKISVGERPADAVSLDRAAYQVLSLIAPFLRGNARALLDRLSGDYL
Ga0190274_1036828513300018476SoilGMSLDRAAYQVLALIAPYLVGDGRALIERLGQDYL
Ga0184642_158452423300019279Groundwater SedimentAEDARLGHAAYQVLGLIAPFLVGDARALVERLGADYVQ
Ga0193735_114000323300020006SoilRIAAQQPDAAAVNLDRAAYQVLSLIAPFMQGPSRALLDRLSQDYL
Ga0179596_1072999413300021086Vadose Zone SoilETGVSLDRAAYQVLSLIAPFLHGDARTLLDRLSHDYL
Ga0210384_1069296813300021432SoilDAETVNLDRAAYQVLSLIAPFLQGSSRALLDRLSQDYL
Ga0126371_1029538233300021560Tropical Forest SoilLSEGHRQNEGINLDRAAYQVLSLIAPFLRGSARTLLDKLSRDYL
Ga0208851_108964513300025461Arctic Peat SoilGDAAGGGLDRAAYQVLALIAPYLVGDGRALVERLGEEYL
Ga0207688_1019141813300025901Corn, Switchgrass And Miscanthus RhizosphereFQRIGAHGGGDAAAVSLDRAAYQVLALIAPYLMGDGRALIERLGQDYL
Ga0207680_1092626213300025903Switchgrass RhizosphereASADQRGQSPSLDRAAYQVLSLIAPFLRGPSRTLLARLSQGYL
Ga0207685_1002433913300025905Corn, Switchgrass And Miscanthus RhizosphereRQPPSLDRAAYQVLSLIAPFLRGPSRTLLARLSQGYL
Ga0207645_1006624413300025907Miscanthus RhizosphereDVSLDHAAYHVLALVAPFLTGDGRALIERLGEDYL
Ga0207684_1163129013300025910Corn, Switchgrass And Miscanthus RhizosphereYQRISAGQRAADAVSLERAAYQVLALIAPFLRGNARALLDRLSGDYL
Ga0207681_1009150213300025923Switchgrass RhizosphereAGDVSLDHAAYHVLALVAPFLTGDGRALIERLGEDYL
Ga0207681_1087973013300025923Switchgrass RhizosphereGEAGAPRLDRAAYQVMALVAPFMHGDARALIDRLGDEYL
Ga0207650_1005681813300025925Switchgrass RhizosphereRIGGHGGGDAAAVSLDRAAYQVLALIAPYLLGDGRALIERLGQDYL
Ga0207669_1159814013300025937Miscanthus RhizosphereETPRLDRAAYQVMALVAPFMHGDARALIDRLGDEYL
Ga0207665_1156344913300025939Corn, Switchgrass And Miscanthus RhizosphereVANLDRAAYQVLSIIAPFLRGDARALVERLGEEYL
Ga0207711_1090057923300025941Switchgrass RhizosphereGAQLGFAAYHVLALIAPYLRGADRALIERLGSDYLG
Ga0207678_1087070523300026067Corn RhizosphereGDAAAVSLDRAAYQVLALIAPYLMGDGRALIERLGQDYL
Ga0207641_1102135423300026088Switchgrass RhizosphereGRAHGAAGAEDVSLDHAAFHVLALFAPFLLGDGRALIERLGEDYL
Ga0209267_101259313300026331SoilISAGERAAETVSLDRAAYQVLSLIAPFLRGDARALLDRLSRDYL
Ga0209328_1018749513300027727Forest SoilETVNLDRAAYQVLSLIAPFLQGSPRALIDRLSQDYL
Ga0209073_1001676513300027765Agricultural SoilISSGEHSDRPVNLDRAAYQVLSLIAPFLRGDARALLDRLSRDYL
Ga0209496_1062305713300027890WetlandGDDAAMSLERAAYQVLALIAPFTVGSARALIERLGDRYL
Ga0209668_1018789913300027899Freshwater Lake SedimentVEAQSARLDHAAYQVMALVAPFMLGEARTLIDRLGGEYLQGG
Ga0209253_1018755913300027900Freshwater Lake SedimentPPGRSVGDDAAMSLERAAYQVLALIAPFTVGSARALIERLGDRYL
Ga0207428_1075545913300027907Populus RhizosphereRISSTPVDQGDGDTATARLDRAAYQVLALIAPFMVGSARALIDRLGSGYL
Ga0268264_1197630313300028381Switchgrass RhizosphereQFDVSLDHAAYHVLALVAPFLVGEGRALIERLGEDYL
Ga0302169_1006562623300028679FenTYWMSYQQISAHHGGDAADGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL
Ga0302205_1017162023300028739FenDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL
Ga0302262_1009357633300028743FenGDAADGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL
Ga0302163_1024875623300028868FenTGDGKGSAGTLNLDRAAYQVLSLIAPFLLGSTRTLLDRLSQDYL
Ga0311347_1034063523300029923FenDAADGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL
Ga0302293_1023515713300029981FenGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL
Ga0311332_1000093413300029984FenRIGAHHGGDAADGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL
Ga0311336_1018924633300029990FenAADGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL
Ga0311336_1139933613300029990FenRVRSRHGPEDAGGDAAGGGLDHAAYQVLALIAPYLVGDGRALVERLGEEYL
Ga0311337_1017884833300030000FenVLEVVDGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL
Ga0302175_1014819713300030014FenIATGDGKGSAGTLNLDRAAYQVLSLIAPFLLGRTRTLFDRLSQDYL
Ga0302273_107980023300030048BogGNAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL
Ga0302273_109704213300030048BogDGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL
Ga0311349_1002396963300030294FenRSRHGPEDAGGDAAGGGLDRAAYQVLALIAPYLVGDGRALVERLGEEYL
Ga0311349_1050550533300030294FenAHHGGDGNAAAVSLDRAAYQVLALVAPFLVGDGRALIERLGQDYL
Ga0311349_1217130423300030294FenTGEGKGSAGTINLDRAAYQVLSLIAPFLRGSTRRLLDRISQDYL
Ga0311360_1043367523300030339BogMSYQRIGAHHGGDGDAAAVSLDRAAYQVLALVAPFLVGDGRALIERLGQDYL
Ga0307498_1035407913300031170SoilIAMNGGKEPAGAINLDRAAYQVLSLIAPFLLGRTRTLLDRLSQDYL
Ga0302323_10019757413300031232FenIGTHHGGDAAAVSLDRAAYQVLALVAPFLVGDGRALIERLGQDYL
Ga0302323_10108067513300031232FenTYWMSYQRIGAHHGGDAADGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL
Ga0311364_1119570113300031521FenHGGDAADGDAAVSLDRAAYQVLALIAPYLVGDGRALIERLGQDYL
Ga0307469_1215502713300031720Hardwood Forest SoilRISAQQPDAAAVNLDRAAYQVLSLIAPFMQGPSRALLDRLSQDYL
Ga0302321_10002202273300031726FenAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL
Ga0302321_10120838423300031726FenWMSFQRIGAHRGGDAVDGGEAAISLDRAAYQVLALIAPYLIGESRVLIERLGEDYL
Ga0302322_10164110523300031902FenWMSYQRIGAHHGGDTADGDAAAVSLDRAAYQVLALIAPFLVGDGRALIERLGQDYL
Ga0307407_1059248113300031903RhizosphereHMSLDRAAYQVLALIAPFAVGESRALIESLGERYFRV
Ga0311367_1225211813300031918FenQGGDEANDEKAAVRLDRAAYQVLALIAPYLVGDGRALIERLGEDYL
Ga0308175_10175449823300031938SoilGTQASAGHAVNLDNAAYNVLALFAPFLQGEDRALLARLGEDYL
Ga0315268_1166770123300032173SedimentAHHGGDAADGDAAAVSLDRAAYQVLALIAPFLEGDGRALIERLGQDYL
Ga0310889_1070022123300032179SoilDTATARLDRAAYQVLALIAPFMVGSARALIDRLGSDYL
Ga0315287_1186524513300032397SedimentHHGGDAVDLNDAAVSLDRAAYQVLALIAPYLVGDGRALIERLGEDYL
Ga0335082_1049809233300032782SoilRTGGQASAVVSLDRAAYQVLALIAPFLRGDARALVERLGAEYL
Ga0335082_1097677013300032782SoilPGLDRAAYQVLALISPYLQGGDRALIDRLGAEYIRED
Ga0316601_10235812013300033419SoilAMSLERAAYQVLALIAPFTVGSARALIERLGDRYL
Ga0316627_10162925013300033482SoilPQESLDRAAYQVMALIAPFLVGDGRTLIERLGEDYL
Ga0316628_10267694723300033513SoilGRSAGDDAAMSLERAAYQVLALIAPFTVGSARALIERLGDRYL
Ga0370484_0038003_1056_11663300034125Untreated Peat SoilEAVNLDRAAYQVLSLIAPFLQGSSRALLDRLSQDYL
Ga0364925_0421190_1_1143300034147SedimentAAAVSLDRAAYQVLALIAPYLLGDGRALIERLGQDYL
Ga0364931_0213228_517_6303300034176SedimentAAAVSLDRAAYQVLALIAPYLVGDGRALIERLGEDYL
Ga0364932_0108775_941_10513300034177SedimentEAVSLDRAAYQVLALIAPFLRGNARALLARLSRDYL
Ga0364943_0204737_580_7263300034354SedimentSYQKIAVGERAAEAVSLDRAAYQVLSLIAPFLRGNARALLDRLSRDYL
Ga0364943_0370556_418_5493300034354SedimentDGSEGGEAAVSLDRAAYQVLALIAPYLVGDGRELIEKLGEDYL
Ga0364941_193507_386_5233300034417SedimentKLHAGERTADGVDLGRAAYQVLSLVAPFLRGEARSLIDRLSAEYL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.