Metagenome / Metatranscriptome Family F088912

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F088912
Family Type	Metagenome / Metatranscriptome
Number of Sequences	109
Average Sequence Length	39 residues
Representative Sequence	MTEGERAGRWAMLYLYTVLFALWFNIVAIAVWHIKEWFL
Number of Associated Samples	63
Number of Associated Scaffolds	109

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	95.41 %
% of genes near scaffold ends (potentially truncated)	8.26 %
% of genes from short scaffolds (< 2000 bps)	62.39 %
Associated GOLD sequencing projects	58
AlphaFold2 3D model prediction	No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (58.716 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (27.523 % of family members)
Environment Ontology (ENVO)	Unclassified (64.220 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (80.734 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 87.18% β-sheet: 0.00% Coil/Unstructured: 12.82%
Feature Viewer

Powered by Feature Viewer

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 109 Family Scaffolds
PF04434	SWIM	12.84
PF14743	DNA_ligase_OB_2	9.17
PF06941	NT5C	3.67
PF01145	Band_7	2.75
PF00149	Metallophos	1.83
PF13792	Obsolete Pfam Family	1.83
PF01738	DLH	1.83
PF13640	2OG-FeII_Oxy_3	1.83
PF00916	Sulfate_transp	1.83
PF00768	Peptidase_S11	1.83
PF03401	TctC	0.92
PF01661	Macro	0.92
PF00155	Aminotran_1_2	0.92
PF13589	HATPase_c_3	0.92
PF07486	Hydrolase_2	0.92
PF14099	Polysacc_lyase	0.92
PF09414	RNA_ligase	0.92
PF11750	DUF3307	0.92
PF00574	CLP_protease	0.92
PF03783	CsgG	0.92
PF01370	Epimerase	0.92

COG ID	Name	Functional Category	% Frequency in 109 Family Scaffolds
COG4279	Uncharacterized protein, contains SWIM-type Zn finger domain	Function unknown [S]	12.84
COG4715	Uncharacterized protein, contains SWIM-type Zn finger domain	Function unknown [S]	12.84
COG5431	Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain	General function prediction only [R]	12.84
COG4502	5'(3')-deoxyribonucleotidase	Nucleotide transport and metabolism [F]	3.67
COG0616	Periplasmic serine protease, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	1.83
COG0659	Sulfate permease or related transporter, MFS superfamily	Inorganic ion transport and metabolism [P]	1.83
COG0740	ATP-dependent protease ClpP, protease subunit	Posttranslational modification, protein turnover, chaperones [O]	1.83
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	1.83
COG2233	Xanthine/uracil permease	Nucleotide transport and metabolism [F]	1.83
COG2252	Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family	Nucleotide transport and metabolism [F]	1.83
COG1030	Membrane-bound serine protease NfeD, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	0.92
COG1462	Curli biogenesis system outer membrane secretion channel CsgG	Cell wall/membrane/envelope biogenesis [M]	0.92
COG2110	O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain	Translation, ribosomal structure and biogenesis [J]	0.92
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.92
COG3773	Cell wall hydrolase CwlJ, involved in spore germination	Cell cycle control, cell division, chromosome partitioning [D]	0.92

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	77.98 %
Unclassified	root	N/A	22.02 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	73.39 %
Unclassified	root	N/A	22.02 %
cellular organisms	root	All Organisms → cellular organisms	4.59 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	58.72 %
Unclassified	root	N/A	22.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.68 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	4.59 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	58.72 %
Unclassified	root	N/A	22.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.68 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.75 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.83 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	58.72 %
Unclassified	root	N/A	22.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.68 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.83 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.83 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.92 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	58.72 %
Unclassified	root	N/A	22.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.68 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.83 %
Chlorobi	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi	1.83 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.92 %

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	56.88 %
Unclassified	root	N/A	22.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.68 %
unclassified Chlorobiota	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota	1.83 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.92 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.92 %
Boseaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae	0.92 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	56.88 %
Unclassified	root	N/A	22.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.68 %
Chlorobiota bacteirum	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum	1.83 %
Pusillimonas (ex Stolz et al. 2005)	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005)	0.92 %
Bosea	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea	0.92 %
Polynucleobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	0.92 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	56.88 %
Unclassified	root	N/A	22.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.68 %
Chlorobiota bacteirum	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum	1.83 %
unclassified Pusillimonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas	0.92 %
unclassified Bosea	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea	0.92 %
Polynucleobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	0.92 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	56.88 %
Unclassified	root	N/A	22.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.68 %
Chlorobiota bacteirum	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum	1.83 %
Bosea sp. BK604	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. BK604	0.92 %
Pusillimonas sp. (ex Stolz et al. 2005)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)	0.92 %
Polynucleobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	0.92 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000756\|JGI12421J11937_10125366	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	664	Open in IMG/M
3300002132\|M2t6BS2_1236747	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4208	Open in IMG/M
3300002447\|JGI24768J34885_10070074	All Organisms → Viruses → Predicted Viral	1169	Open in IMG/M
3300002447\|JGI24768J34885_10071539	All Organisms → Viruses → Predicted Viral	1157	Open in IMG/M
3300003277\|JGI25908J49247_10005116	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4192	Open in IMG/M
3300003277\|JGI25908J49247_10009749	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2998	Open in IMG/M
3300003277\|JGI25908J49247_10010373	Not Available	2904	Open in IMG/M
3300003277\|JGI25908J49247_10019860	All Organisms → Viruses → Predicted Viral	2007	Open in IMG/M
3300003277\|JGI25908J49247_10046938	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1144	Open in IMG/M
3300003277\|JGI25908J49247_10068279	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	893	Open in IMG/M
3300003277\|JGI25908J49247_10141505	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	563	Open in IMG/M
3300003277\|JGI25908J49247_10141556	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	563	Open in IMG/M
3300003388\|JGI25910J50241_10082369	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	917	Open in IMG/M
3300003393\|JGI25909J50240_1034423	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1099	Open in IMG/M
3300003393\|JGI25909J50240_1083962	Not Available	637	Open in IMG/M
3300003411\|JGI25911J50253_10002181	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7264	Open in IMG/M
3300003497\|JGI25925J51416_10045868	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1178	Open in IMG/M
3300004481\|Ga0069718_15714884	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1426	Open in IMG/M
3300004763\|Ga0007746_1331888	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	572	Open in IMG/M
3300004788\|Ga0007742_10013188	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	817	Open in IMG/M
3300005517\|Ga0070374_10635448	Not Available	529	Open in IMG/M
3300005527\|Ga0068876_10040433	All Organisms → Viruses → Predicted Viral	2876	Open in IMG/M
3300005582\|Ga0049080_10015500	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2651	Open in IMG/M
3300005662\|Ga0078894_10134608	All Organisms → Viruses → Predicted Viral	2209	Open in IMG/M
3300005662\|Ga0078894_10140921	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2159	Open in IMG/M
3300005662\|Ga0078894_11342535	Not Available	600	Open in IMG/M
3300006484\|Ga0070744_10003970	All Organisms → Viruses → Predicted Viral	4445	Open in IMG/M
3300006805\|Ga0075464_10536193	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	718	Open in IMG/M
3300008107\|Ga0114340_1000386	Not Available	36874	Open in IMG/M
3300008107\|Ga0114340_1003488	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8774	Open in IMG/M
3300008107\|Ga0114340_1102879	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1139	Open in IMG/M
3300008107\|Ga0114340_1188035	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	711	Open in IMG/M
3300008108\|Ga0114341_10065251	All Organisms → Viruses → Predicted Viral	2310	Open in IMG/M
3300008108\|Ga0114341_10156786	All Organisms → Viruses → Predicted Viral	1317	Open in IMG/M
3300008111\|Ga0114344_1006985	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4798	Open in IMG/M
3300008111\|Ga0114344_1139427	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	841	Open in IMG/M
3300008113\|Ga0114346_1005846	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9554	Open in IMG/M
3300010354\|Ga0129333_10016255	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7072	Open in IMG/M
3300011184\|Ga0136709_1003515	All Organisms → Viruses → Predicted Viral	2380	Open in IMG/M
3300011268\|Ga0151620_1183480	Not Available	636	Open in IMG/M
3300012012\|Ga0153799_1007672	Not Available	2515	Open in IMG/M
3300012663\|Ga0157203_1000175	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	22281	Open in IMG/M
3300012663\|Ga0157203_1000202	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	20019	Open in IMG/M
3300012663\|Ga0157203_1000453	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	12694	Open in IMG/M
3300012663\|Ga0157203_1000465	Not Available	12514	Open in IMG/M
3300012663\|Ga0157203_1001911	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4850	Open in IMG/M
3300012665\|Ga0157210_1014571	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1323	Open in IMG/M
3300013004\|Ga0164293_10189376	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1495	Open in IMG/M
3300013372\|Ga0177922_10799661	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4663	Open in IMG/M
3300013372\|Ga0177922_11096880	Not Available	611	Open in IMG/M
3300013372\|Ga0177922_11182898	Not Available	903	Open in IMG/M
3300017780\|Ga0181346_1041771	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1876	Open in IMG/M
3300020141\|Ga0211732_1191331	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1176	Open in IMG/M
3300020141\|Ga0211732_1229272	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8980	Open in IMG/M
3300020141\|Ga0211732_1280084	All Organisms → Viruses → Predicted Viral	2661	Open in IMG/M
3300020141\|Ga0211732_1309240	Not Available	2255	Open in IMG/M
3300020141\|Ga0211732_1345824	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	733	Open in IMG/M
3300020141\|Ga0211732_1562865	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)	827	Open in IMG/M
3300020141\|Ga0211732_1565956	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2257	Open in IMG/M
3300020151\|Ga0211736_10159362	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	742	Open in IMG/M
3300020151\|Ga0211736_10621438	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2531	Open in IMG/M
3300020151\|Ga0211736_10630343	Not Available	694	Open in IMG/M
3300020151\|Ga0211736_10918346	Not Available	531	Open in IMG/M
3300020159\|Ga0211734_10900212	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1298	Open in IMG/M
3300020159\|Ga0211734_11013106	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8456	Open in IMG/M
3300020159\|Ga0211734_11293607	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9867	Open in IMG/M
3300020160\|Ga0211733_10042725	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	863	Open in IMG/M
3300020160\|Ga0211733_10241529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	800	Open in IMG/M
3300020160\|Ga0211733_10540881	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	834	Open in IMG/M
3300020160\|Ga0211733_10559312	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	797	Open in IMG/M
3300020160\|Ga0211733_10918385	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum	2134	Open in IMG/M
3300020162\|Ga0211735_11437422	Not Available	527	Open in IMG/M
3300020172\|Ga0211729_10059473	All Organisms → Viruses → Predicted Viral	1228	Open in IMG/M
3300020172\|Ga0211729_11318139	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum	953	Open in IMG/M
3300020205\|Ga0211731_10080281	All Organisms → Viruses → Predicted Viral	1594	Open in IMG/M
3300020205\|Ga0211731_10491622	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5589	Open in IMG/M
3300020205\|Ga0211731_11358565	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	742	Open in IMG/M
3300020205\|Ga0211731_11583852	Not Available	515	Open in IMG/M
3300020527\|Ga0208232_1022470	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	894	Open in IMG/M
3300021961\|Ga0222714_10071618	All Organisms → Viruses → Predicted Viral	2295	Open in IMG/M
3300021962\|Ga0222713_10740781	Not Available	555	Open in IMG/M
3300021963\|Ga0222712_10116545	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1845	Open in IMG/M
3300022407\|Ga0181351_1061334	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1545	Open in IMG/M
3300024346\|Ga0244775_10014925	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7224	Open in IMG/M
3300027586\|Ga0208966_1004987	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4009	Open in IMG/M
3300027608\|Ga0208974_1007906	All Organisms → Viruses → Predicted Viral	3540	Open in IMG/M
3300027608\|Ga0208974_1040049	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1380	Open in IMG/M
3300027608\|Ga0208974_1046025	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1267	Open in IMG/M
3300027608\|Ga0208974_1100846	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	770	Open in IMG/M
3300027710\|Ga0209599_10046857	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1147	Open in IMG/M
3300027732\|Ga0209442_1330787	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	516	Open in IMG/M
3300027764\|Ga0209134_10009346	Not Available	2951	Open in IMG/M
3300027772\|Ga0209768_10141284	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1137	Open in IMG/M
3300027785\|Ga0209246_10155994	Not Available	897	Open in IMG/M
3300027798\|Ga0209353_10250561	Not Available	762	Open in IMG/M
3300027808\|Ga0209354_10171351	Not Available	884	Open in IMG/M
3300027808\|Ga0209354_10275684	Not Available	672	Open in IMG/M
3300027836\|Ga0209230_10125530	All Organisms → Viruses → Predicted Viral	1447	Open in IMG/M
3300028025\|Ga0247723_1117786	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	652	Open in IMG/M
3300028108\|Ga0256305_1150513	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	554	Open in IMG/M
3300031758\|Ga0315907_10368289	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1165	Open in IMG/M
3300031784\|Ga0315899_10041370	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4848	Open in IMG/M
3300031784\|Ga0315899_10063803	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3829	Open in IMG/M
3300031786\|Ga0315908_10840489	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	748	Open in IMG/M
3300031787\|Ga0315900_10359401	Not Available	1171	Open in IMG/M
3300031857\|Ga0315909_10735720	Not Available	634	Open in IMG/M
3300031963\|Ga0315901_10335700	All Organisms → Viruses → Predicted Viral	1237	Open in IMG/M
3300034071\|Ga0335028_0704150	Not Available	528	Open in IMG/M
3300034082\|Ga0335020_0218498	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. BK604	949	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.17%
Terrestrial	Environmental → Terrestrial	1.83%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	90.83%
Marine	Environmental → Aquatic → Marine	6.42%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.83%
Unclassified	Environmental → Aquatic → Unclassified	0.92%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	38.53%
Lentic	Environmental → Aquatic → Freshwater → Lentic	36.70%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	7.34%
Lotic	Environmental → Aquatic → Freshwater → Lotic	6.42%
Unclassified	Environmental → Aquatic → Marine → Unclassified	4.59%
Coastal	Environmental → Aquatic → Marine → Coastal	1.83%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.83%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.92%
River	Environmental → Aquatic → Freshwater → River	0.92%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified	0.92%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	38.53%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	34.86%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	7.34%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	6.42%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	4.59%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	1.83%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.83%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.92%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	0.92%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.92%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	0.92%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified → Unclassified	0.92%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	27.52%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	26.61%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	8.26%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	6.42%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	5.50%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	5.50%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	2.75%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	2.75%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	2.75%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	1.83%
Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment	0.92%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	0.92%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	0.92%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.92%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.92%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	0.92%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	0.92%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.92%
Marine	Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine	0.92%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.92%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.92%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000756	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011	Environmental	Open in IMG/M
3300002132	Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t6BS2 (105f)	Environmental	Open in IMG/M
3300002447	Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome	Environmental	Open in IMG/M
3300003277	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD	Environmental	Open in IMG/M
3300003388	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN	Environmental	Open in IMG/M
3300003393	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD	Environmental	Open in IMG/M
3300003411	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD	Environmental	Open in IMG/M
3300003497	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN	Environmental	Open in IMG/M
3300004481	Combined Assembly of Gp0112041, Gp0112042, Gp0112043	Environmental	Open in IMG/M
3300004763	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004788	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008108	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA	Environmental	Open in IMG/M
3300008111	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300011184	Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG	Environmental	Open in IMG/M
3300011268	Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555	Environmental	Open in IMG/M
3300012012	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m	Environmental	Open in IMG/M
3300012663	Freshwater microbial communities from Indian River, Ontario, Canada - S50	Environmental	Open in IMG/M
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental	Open in IMG/M
3300020162	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020527	Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300027586	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027732	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)	Environmental	Open in IMG/M
3300027764	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027772	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027785	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027798	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027808	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)	Environmental	Open in IMG/M
3300027836	Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028108	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031786	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031963	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116	Environmental	Open in IMG/M
3300034071	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110	Environmental	Open in IMG/M
3300034082	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12421J11937_101253663	3300000756	Freshwater And Sediment	MNEGERAGRWAMLYLYTVLFALWFNIVAIAVWHIK
M2t6BS2_123674711	3300002132	Marine	MNEGERAGRWAMLYIYTVLFALWFNVVAIAAWFIREWFL*
JGI24768J34885_100700744	3300002447	Freshwater And Sediment	MTEGERAGRWAMLYLYTALFALWFNIIAIVGWHIKEWFL*
JGI24768J34885_100715394	3300002447	Freshwater And Sediment	STLRREAMTEGERAGRWAMLYLYTALFALWFNIVAIAAWHIKEWFL*
JGI25908J49247_100051163	3300003277	Freshwater Lake	MNEGERAGRWAMVYLYTVLFALWFNIVAIVGWHIKEWFL*
JGI25908J49247_100097498	3300003277	Freshwater Lake	MTEGERAGRWAMLYLYTALFALWFNIXAIAAWFIKEWFL*
JGI25908J49247_100103736	3300003277	Freshwater Lake	MTEGERAGRWAMLYLYTVLFALWFNIVCIAGWHIKEWFL*
JGI25908J49247_100198606	3300003277	Freshwater Lake	MTEGERAGRWAMLYIYTALFALWFNIICIAGWHIKEWFL*
JGI25908J49247_100469384	3300003277	Freshwater Lake	MNEGERAGRWAMIYLYTVLFALWFNVVAIAVWHIKEWFL*
JGI25908J49247_100682791	3300003277	Freshwater Lake	MTEGERAGRWAMLYLYTALFALWFNIVAIAVWHIKEWFL*
JGI25908J49247_101415052	3300003277	Freshwater Lake	MNEGERAGRWAMIYLYTVLFALWFNVVAIAIWHIREWFL*
JGI25908J49247_101415562	3300003277	Freshwater Lake	MNEGERAGRWAMLYIYTVLFALWFNIVAIAVWHIREWFL*
JGI25910J50241_100823691	3300003388	Freshwater Lake	VTEGEQAGRWAMLYIYTALFTLGFTIVSISVSFIRGWFL*
JGI25909J50240_10344234	3300003393	Freshwater Lake	MNEGERAGRWAMLYIYTVLFALWFNXVAIAXWHIREWFL*
JGI25909J50240_10839623	3300003393	Freshwater Lake	MTEGERAGRWAMIYXYTXLFALWFNIVAIAVWHIKEWFL*
JGI25911J50253_100021812	3300003411	Freshwater Lake	MNEGERAGRWAMIYLYTVLFALWFNVVAIAVWHIQEWFL*
JGI25925J51416_100458681	3300003497	Freshwater Lake	TVGASMNEGERAGRWAMLYIYTVLFALWFNIVAIAVWHIREWFL*
Ga0069718_157148842	3300004481	Sediment	MTEGERAGRWAMLYLYTVLFALWFNIIAIVGWHIREWFL*
Ga0007746_13318882	3300004763	Freshwater Lake	MNEGERAGRWAMLYIYTVLFALWFNIVAIAIWHIREWFL*
Ga0007742_100131882	3300004788	Freshwater Lake	MTEGERAGRWAMLYIYTVLFALWFNIVAIAVWHIREWFL*
Ga0070374_106354481	3300005517	Freshwater Lake	MTEGERAGRWAMLYLYTALFALWFNIIAIAAWFIKEWFL*
Ga0068876_100404331	3300005527	Freshwater Lake	MTEGERAGRWAMLYLYTVLFALWFNIVAIAVWHIKEWFL*
Ga0049080_100155003	3300005582	Freshwater Lentic	MNEGERAGRWAMLYLYTVLFALWFNIVAIAAWHIKEWFL*
Ga0078894_101346085	3300005662	Freshwater Lake	MTEGERAGRWAMLYLYTVLFALWFNVFAIVGWHIMVWFL*
Ga0078894_101409212	3300005662	Freshwater Lake	MTEGERAGRWAMVYIYTALFALWFNIIAIAAWHIREWFL*
Ga0078894_113425352	3300005662	Freshwater Lake	MTEGERAGRWAMLYIYTVLFALWFNIVAIAVWHIKEWFL*
Ga0070744_100039703	3300006484	Estuarine	MTEGEQAGRWAMMYLYMALFAVWFNIACIIGWHIKEWFL*
Ga0075464_105361931	3300006805	Aqueous	MTEGERAGRWAMLYIYTALFALWFNIVCIAAWHIREWFL*
Ga0114340_100038664	3300008107	Freshwater, Plankton	MTEGERAGRWAMLYLYTVLFALWFNIVAIAAWHIKEWFL*
Ga0114340_10034889	3300008107	Freshwater, Plankton	MTEGERAGRWAMVYLYTALFALWFNIICIVGWHIKEWFL*
Ga0114340_11028791	3300008107	Freshwater, Plankton	MTEGERAGRWAMIYLYTVLFALWFNIIAIAVWHIKEWFL*
Ga0114340_11880352	3300008107	Freshwater, Plankton	MTEGERAGRWAMLYLYTVLFALWFNVVAIAVWHIREWFL*
Ga0114341_100652514	3300008108	Freshwater, Plankton	MTEGERAGRWAMLYLYTVLFALWFNIVCIAGWFIREWFL*
Ga0114341_101567862	3300008108	Freshwater, Plankton	MTEGERAGRWAMLYLYTALFALWFNIIAIMVWHIREWFL*
Ga0114344_10069856	3300008111	Freshwater, Plankton	MNEGERAGRWAMLYIYTVLFALWFNIVAIAVWHIKEWFL*
Ga0114344_11394272	3300008111	Freshwater, Plankton	MTEGERAGRWAMLYLYTVLFALWFNIIAIVAWHIKEWFL*
Ga0114346_10058463	3300008113	Freshwater, Plankton	MNEGERAGRWAMLYLYTVLFALWFNIVCIAGWHIKEWFL*
Ga0129333_1001625512	3300010354	Freshwater To Marine Saline Gradient	MNEGERAGCWAMVYLYMVLFAVWFNIIFIVGWHIKEWFL*
Ga0136709_10035158	3300011184	Freshwater	MTEGERAGRWAMPYLYTALFALWFNIVAITVWHIKEWFL*
Ga0151620_11834802	3300011268	Freshwater	MKEGERAGRWAMIYLYTVLFALWFNIVAIAVWHIKEWFL*
Ga0153799_10076726	3300012012	Freshwater	MTEGERAGRWAMIYIYTVLFALWFNIVCIVGWHIKEWFL*
Ga0157203_100017532	3300012663	Freshwater	MTEGERAGRWAMLYLYTALFALWFNIIAIAVWHIKEWFL*
Ga0157203_10002021	3300012663	Freshwater	MTEGERAGRWAMLYLYTVLFALWFNIIAIAVWHIREWFL*
Ga0157203_10004537	3300012663	Freshwater	MTEGERAGRWAMIYLYTALFALWFNIVAIAVWHIREWFL*
Ga0157203_10004656	3300012663	Freshwater	MTEGEQAGRWAMLYLYTVLFALWFNIIAIAGWHIKEWFL*
Ga0157203_100191112	3300012663	Freshwater	MTEGERAGRWAMLYLYTVLFALWFNIVAIAVWHIREWFL*
Ga0157210_10145712	3300012665	Freshwater	MTEGERAGRWAMLYIYTALFALWFNVVAIAVWHIREWFL*
Ga0164293_101893763	3300013004	Freshwater	MTEGERAGRWAMLYLYTVLFALWFNIVCIVGWHIKEWFL*
Ga0177922_107996615	3300013372	Freshwater	MTEGERAGRWAMIYLYTVLFALWFNVVAIAGWHIKEWFL*
Ga0177922_110968803	3300013372	Freshwater	MNEGERAGRWAMLYIYTALFALWFNIICIAGWHIKEWFL*
Ga0177922_111828981	3300013372	Freshwater	MTEGERAGRWAMIYLYTALFALWFNIVAIVGWHIKEWFL*
Ga0181346_10417712	3300017780	Freshwater Lake	MNEGERAGRWAMIYLYTVLFALWFNVVAIAIWHIREWFL
Ga0211732_11913313	3300020141	Freshwater	MTEGERAGRWAMLYLYTVLFALWFNIVCIVGWHIKEWFL
Ga0211732_122927210	3300020141	Freshwater	MTEGERAGRWAMLYLYTVLFALWFNIVCIAAWFIREWFL
Ga0211732_12800845	3300020141	Freshwater	MTEGERAGRWAMLYIYTVLFALWFNIVAIAAWFIREWFL
Ga0211732_13092402	3300020141	Freshwater	MTEGERAGRWAMLYIYTVLFALWFNIIAIVGWHIKEWFL
Ga0211732_13458241	3300020141	Freshwater	MTEGERAGRWAMLYLYTVLFALWFNIVCIAGWHIKEWFL
Ga0211732_15628651	3300020141	Freshwater	MTEGERAGRWAMVYIYTVLFALWFNIVAIAAWFIREWFL
Ga0211732_15659566	3300020141	Freshwater	MTEGERAGRWAMLYLYTVLFALWFNIVAIAVWHIKEWFL
Ga0211736_101593622	3300020151	Freshwater	MTEGERAGRWAMLYLYTALFALWFNIVCIVGWHIKEWFL
Ga0211736_106214382	3300020151	Freshwater	MTEGERAGRWAMLYLYTALFALWFNIVAIAAWFIREWFL
Ga0211736_106303431	3300020151	Freshwater	MNEGERAGRWAMIYLYTVLFALWFNVVAIAVWHIKEWFL
Ga0211736_109183461	3300020151	Freshwater	MTEGELAGRWAMLYLYTVLFALWFNIVAIAVWHIKEWFL
Ga0211734_109002121	3300020159	Freshwater	MTEGERAGRWAMLYLYTALFALWFNIIAIAVWHIKEWFL
Ga0211734_1101310621	3300020159	Freshwater	MTEGERAGRWAMLYLYTVLFALWFNIVAIAAWHIKEWFL
Ga0211734_1129360711	3300020159	Freshwater	MTEGERAGRWAMLYLYMVLFALWFNIVCIAVWHIKEWFL
Ga0211733_100427253	3300020160	Freshwater	MTEGERAGRWAMLYLYTVLFALWFNIVFIVGWHIKEWFL
Ga0211733_102415292	3300020160	Freshwater	MTEGERAGRWAMMYLYMALFALWFNIACIVGWHIKEWFL
Ga0211733_105408814	3300020160	Freshwater	MTEGERAGRWAMIYLYTVLFALWFNIVAIAVWHIKEWFL
Ga0211733_105593123	3300020160	Freshwater	MTEGERAGRWAMLYLYTVLFALWFNIVAIAVWFIKEWFL
Ga0211733_109183856	3300020160	Freshwater	MTEGERAGRWAMIYIYTVLFALWFNIVAIAVWHIKEWFL
Ga0211735_114374222	3300020162	Freshwater	MTEGERAGRWAMIYLYTVLFALWFNIIAIAVWHIKEWFL
Ga0211729_100594732	3300020172	Freshwater	MTEGERAGRWAMVYIYTALFALWFNIVAIAVWHIREWFL
Ga0211729_113181392	3300020172	Freshwater	MTEGERAGRWAMLYLYMVLFALWFYIVAIAAWFIREWFL
Ga0211731_100802812	3300020205	Freshwater	MTEGERAGRWAMLYIYTALFALWFNIIAIAGWHIREWFL
Ga0211731_1049162211	3300020205	Freshwater	MTEGERAGRWAMLYIYTVLFALWFNIVCIAGWHIREWFL
Ga0211731_113585652	3300020205	Freshwater	MTEGERAGRWAMIYLYTVLFALWFNVVCIAGWHIREWFL
Ga0211731_115838522	3300020205	Freshwater	MNEGERAGRWAMLYLYTVLFALWFNIVAIVGWHIKEWFL
Ga0208232_10224701	3300020527	Freshwater	MTEGERAGRWAMLYIYTVLFALWFNIVAIAVWHIKEWFL
Ga0222714_100716188	3300021961	Estuarine Water	MKEGERAGRWAMIYLYTVLFALWFNIVAIAVWHIKEWFL
Ga0222713_107407813	3300021962	Estuarine Water	MTEGERAGRWAMIYLYTVLFALWFNIVAIAVWHIKEWF
Ga0222712_101165453	3300021963	Estuarine Water	MNEGERAGRWAMLYLYMVLFALWFNIVCIAAWHIKEWFL
Ga0181351_10613345	3300022407	Freshwater Lake	MNEGERAGRWAMVYLYTVLFALWFNIVAIVGWHIKEWFL
Ga0244775_1001492518	3300024346	Estuarine	MTEGEQAGRWAMMYLYMALFAVWFNIACIIGWHIKEWFL
Ga0208966_100498711	3300027586	Freshwater Lentic	MNEGERAGRWAMVYLYTVLFALWFNIVAIVGWHIKEWF
Ga0208974_100790612	3300027608	Freshwater Lentic	MTEGERAGRWAMLYIYTALFALWFNIICIAGWHIKEWFL
Ga0208974_10400492	3300027608	Freshwater Lentic	MTEGERAGRWAMIYIYTVLFALWFNIVCIVGWHIKEWFL
Ga0208974_10460254	3300027608	Freshwater Lentic	MTEGERAGRWAMLYLYTALFALWFNIIAIAAWFIKEWFL
Ga0208974_11008463	3300027608	Freshwater Lentic	MNEGERAGRWAMLYLYTVLFALWFNIVAIAAWHIKEWFL
Ga0209599_100468572	3300027710	Deep Subsurface	MTEGERAGRWAMLYLYTVLFALWFNIIAIVGWHIREWFL
Ga0209442_13307872	3300027732	Freshwater Lake	MNEGERAGRWAMLYIYTVLFALWFNIVAIAVWHIREWFL
Ga0209134_100093462	3300027764	Freshwater Lake	MNEGERAGRWAMLYLYTVLFALWFNIVCIAGWHIKEWFL
Ga0209768_101412841	3300027772	Freshwater Lake	MTEGERAGRWAMLYLYTALFALWFNIIAIAAWHIKEWFL
Ga0209246_101559944	3300027785	Freshwater Lake	MTEGERAGRWAMIYIYTALFALWFNIVCIAGWHIREWFL
Ga0209353_102505613	3300027798	Freshwater Lake	MTEGERAGRWAMLYIYTALFALWFNIVAIAAWHIKEWFL
Ga0209354_101713513	3300027808	Freshwater Lake	MNEKMTEGERAGRWAMLYIYTALFALWFNIVCIAGWHIKEWFL
Ga0209354_102756843	3300027808	Freshwater Lake	MTEGERAGRWAMLYLYTALFALWFNIICIVGWHIKEWFL
Ga0209230_101255304	3300027836	Freshwater And Sediment	MTEGERAGRWAMLYLYTALFALWFNIVAIAAWHIKEWFL
Ga0247723_11177862	3300028025	Deep Subsurface Sediment	MTEGERAGRWAMLYLYTVLFALWFNIVAIAVWHIREWFL
Ga0256305_11505131	3300028108	Freshwater	MTEGERAGRWAMLYLYTVLFALWFNIVAISVWHIREWFL
Ga0315907_103682893	3300031758	Freshwater	MTEGERAGRWAMLYLYTVLFALWFNVVAIAVWHIREWFL
Ga0315899_100413704	3300031784	Freshwater	MNEGERAGRWAMLYIYTVLFALWFNIVAIAVWHIKEWFL
Ga0315899_100638036	3300031784	Freshwater	MTEGERAGRWAMAYLYTALFALWFNIICIVGWHIKEWFL
Ga0315908_108404892	3300031786	Freshwater	MTEGERAGRWAMVYIYTALFALWFNIIAIAAWHIREWFL
Ga0315900_103594012	3300031787	Freshwater	MTEGERAGRWAMLYLYTVLFALWFNIVCIAGWFIREWFL
Ga0315909_107357201	3300031857	Freshwater	MTEGERAGRWAMLYLYTVLFALWFNIVAIAAWHIKEWF
Ga0315901_103357004	3300031963	Freshwater	MTEGERAGRWAMLYLYTVLFALWFNIIAIVAWHIKEWFL
Ga0335028_0704150_275_418	3300034071	Freshwater	MPDDSGGTMTEGERAGRWAMIYLYTVLFALWFNIVCIVGWHIKEWFL
Ga0335020_0218498_665_784	3300034082	Freshwater	MTEGERAGRWAMIYLYTVLFALWFNIVCIVGWHIREWFL

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F088912

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences