Basic Information | |
---|---|
Family ID | F088966 |
Family Type | Metagenome |
Number of Sequences | 109 |
Average Sequence Length | 49 residues |
Representative Sequence | DDVEAYNNYDEMPLFTDFPKKISVVEKNLPKDILPWERKGVKGKVVTAG |
Number of Associated Samples | 62 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 48.62 % |
% of genes near scaffold ends (potentially truncated) | 50.46 % |
% of genes from short scaffolds (< 2000 bps) | 100.00 % |
Associated GOLD sequencing projects | 61 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (61.468 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (86.239 % of family members) |
Environment Ontology (ENVO) | Unclassified (90.826 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (87.156 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.16% β-sheet: 0.00% Coil/Unstructured: 55.84% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF13952 | DUF4216 | 1.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 61.47 % |
All Organisms | root | All Organisms | 38.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005093|Ga0062594_102249633 | All Organisms → cellular organisms → Eukaryota | 591 | Open in IMG/M |
3300005334|Ga0068869_101728844 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 559 | Open in IMG/M |
3300005338|Ga0068868_101736995 | Not Available | 588 | Open in IMG/M |
3300005354|Ga0070675_101421954 | Not Available | 639 | Open in IMG/M |
3300006358|Ga0068871_100744533 | Not Available | 900 | Open in IMG/M |
3300012021|Ga0120192_10009284 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1418 | Open in IMG/M |
3300013297|Ga0157378_11123143 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 823 | Open in IMG/M |
3300013297|Ga0157378_11230370 | Not Available | 789 | Open in IMG/M |
3300013297|Ga0157378_12607813 | All Organisms → cellular organisms → Eukaryota | 558 | Open in IMG/M |
3300014486|Ga0182004_10219327 | Not Available | 636 | Open in IMG/M |
3300014486|Ga0182004_10254097 | Not Available | 568 | Open in IMG/M |
3300014745|Ga0157377_10908935 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 659 | Open in IMG/M |
3300014745|Ga0157377_11630648 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 518 | Open in IMG/M |
3300015267|Ga0182122_1020159 | Not Available | 714 | Open in IMG/M |
3300015268|Ga0182154_1015642 | All Organisms → cellular organisms → Eukaryota | 766 | Open in IMG/M |
3300015268|Ga0182154_1038944 | Not Available | 603 | Open in IMG/M |
3300015269|Ga0182113_1045635 | Not Available | 633 | Open in IMG/M |
3300015274|Ga0182188_1043432 | Not Available | 555 | Open in IMG/M |
3300015276|Ga0182170_1070318 | Not Available | 518 | Open in IMG/M |
3300015279|Ga0182174_1024892 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 718 | Open in IMG/M |
3300015279|Ga0182174_1038482 | Not Available | 637 | Open in IMG/M |
3300015279|Ga0182174_1066167 | All Organisms → cellular organisms → Eukaryota | 545 | Open in IMG/M |
3300015283|Ga0182156_1055297 | Not Available | 579 | Open in IMG/M |
3300015283|Ga0182156_1082601 | All Organisms → cellular organisms → Eukaryota | 512 | Open in IMG/M |
3300015285|Ga0182186_1024636 | Not Available | 714 | Open in IMG/M |
3300015286|Ga0182176_1063360 | Not Available | 554 | Open in IMG/M |
3300015286|Ga0182176_1074784 | Not Available | 525 | Open in IMG/M |
3300015292|Ga0182141_1041162 | Not Available | 642 | Open in IMG/M |
3300015292|Ga0182141_1080108 | Not Available | 528 | Open in IMG/M |
3300015294|Ga0182126_1082746 | Not Available | 526 | Open in IMG/M |
3300015295|Ga0182175_1040551 | Not Available | 655 | Open in IMG/M |
3300015296|Ga0182157_1095945 | Not Available | 514 | Open in IMG/M |
3300015298|Ga0182106_1091289 | Not Available | 522 | Open in IMG/M |
3300015299|Ga0182107_1073206 | All Organisms → cellular organisms → Eukaryota | 562 | Open in IMG/M |
3300015300|Ga0182108_1082648 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 545 | Open in IMG/M |
3300015302|Ga0182143_1016929 | All Organisms → cellular organisms → Eukaryota | 852 | Open in IMG/M |
3300015302|Ga0182143_1053726 | All Organisms → cellular organisms → Eukaryota | 616 | Open in IMG/M |
3300015304|Ga0182112_1015014 | Not Available | 884 | Open in IMG/M |
3300015304|Ga0182112_1046907 | Not Available | 642 | Open in IMG/M |
3300015304|Ga0182112_1105011 | Not Available | 503 | Open in IMG/M |
3300015308|Ga0182142_1020066 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 844 | Open in IMG/M |
3300015308|Ga0182142_1116104 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 501 | Open in IMG/M |
3300015313|Ga0182164_1135303 | Not Available | 505 | Open in IMG/M |
3300015322|Ga0182110_1074933 | Not Available | 591 | Open in IMG/M |
3300015322|Ga0182110_1116619 | Not Available | 513 | Open in IMG/M |
3300015323|Ga0182129_1091710 | Not Available | 541 | Open in IMG/M |
3300015342|Ga0182109_1178945 | Not Available | 547 | Open in IMG/M |
3300015343|Ga0182155_1134914 | All Organisms → cellular organisms → Eukaryota | 608 | Open in IMG/M |
3300015343|Ga0182155_1178104 | Not Available | 549 | Open in IMG/M |
3300015343|Ga0182155_1212534 | Not Available | 513 | Open in IMG/M |
3300015344|Ga0182189_1011378 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1393 | Open in IMG/M |
3300015344|Ga0182189_1033135 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1002 | Open in IMG/M |
3300015344|Ga0182189_1174347 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 558 | Open in IMG/M |
3300015345|Ga0182111_1177020 | Not Available | 571 | Open in IMG/M |
3300015345|Ga0182111_1181396 | Not Available | 565 | Open in IMG/M |
3300015345|Ga0182111_1243895 | Not Available | 502 | Open in IMG/M |
3300015346|Ga0182139_1080934 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 767 | Open in IMG/M |
3300015346|Ga0182139_1233981 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 512 | Open in IMG/M |
3300015347|Ga0182177_1139453 | All Organisms → cellular organisms → Eukaryota | 628 | Open in IMG/M |
3300015351|Ga0182161_1220352 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 544 | Open in IMG/M |
3300015351|Ga0182161_1261399 | Not Available | 507 | Open in IMG/M |
3300015355|Ga0182159_1154514 | Not Available | 717 | Open in IMG/M |
3300015355|Ga0182159_1174913 | All Organisms → cellular organisms → Eukaryota | 681 | Open in IMG/M |
3300015355|Ga0182159_1193701 | Not Available | 652 | Open in IMG/M |
3300015355|Ga0182159_1204312 | Not Available | 637 | Open in IMG/M |
3300015355|Ga0182159_1282226 | Not Available | 553 | Open in IMG/M |
3300015355|Ga0182159_1347485 | Not Available | 504 | Open in IMG/M |
3300017404|Ga0182203_1122021 | Not Available | 555 | Open in IMG/M |
3300017404|Ga0182203_1132210 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 540 | Open in IMG/M |
3300017407|Ga0182220_1028795 | Not Available | 724 | Open in IMG/M |
3300017407|Ga0182220_1033054 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 698 | Open in IMG/M |
3300017407|Ga0182220_1069287 | Not Available | 572 | Open in IMG/M |
3300017409|Ga0182204_1066131 | Not Available | 603 | Open in IMG/M |
3300017409|Ga0182204_1075375 | Not Available | 580 | Open in IMG/M |
3300017409|Ga0182204_1099169 | All Organisms → cellular organisms → Eukaryota | 533 | Open in IMG/M |
3300017410|Ga0182207_1131927 | Not Available | 556 | Open in IMG/M |
3300017410|Ga0182207_1160292 | Not Available | 519 | Open in IMG/M |
3300017411|Ga0182208_1094573 | Not Available | 556 | Open in IMG/M |
3300017411|Ga0182208_1115395 | All Organisms → cellular organisms → Eukaryota | 521 | Open in IMG/M |
3300017415|Ga0182202_1054854 | Not Available | 677 | Open in IMG/M |
3300017417|Ga0182230_1083726 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 579 | Open in IMG/M |
3300017420|Ga0182228_1057880 | All Organisms → cellular organisms → Eukaryota | 675 | Open in IMG/M |
3300017420|Ga0182228_1071231 | All Organisms → cellular organisms → Eukaryota | 624 | Open in IMG/M |
3300017420|Ga0182228_1104557 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 543 | Open in IMG/M |
3300017424|Ga0182219_1128963 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 516 | Open in IMG/M |
3300017425|Ga0182224_1020059 | All Organisms → cellular organisms → Eukaryota | 961 | Open in IMG/M |
3300017425|Ga0182224_1040426 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 782 | Open in IMG/M |
3300017425|Ga0182224_1069081 | Not Available | 665 | Open in IMG/M |
3300017425|Ga0182224_1154159 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 514 | Open in IMG/M |
3300017427|Ga0182190_1025414 | Not Available | 940 | Open in IMG/M |
3300017427|Ga0182190_1103956 | Not Available | 590 | Open in IMG/M |
3300017427|Ga0182190_1145072 | Not Available | 526 | Open in IMG/M |
3300017433|Ga0182206_1114376 | Not Available | 560 | Open in IMG/M |
3300017436|Ga0182209_1054682 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 727 | Open in IMG/M |
3300017442|Ga0182221_1086706 | Not Available | 621 | Open in IMG/M |
3300017442|Ga0182221_1091549 | Not Available | 611 | Open in IMG/M |
3300017442|Ga0182221_1145631 | Not Available | 528 | Open in IMG/M |
3300017443|Ga0182193_1078579 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 689 | Open in IMG/M |
3300017443|Ga0182193_1146784 | Not Available | 558 | Open in IMG/M |
3300017681|Ga0182226_1114542 | Not Available | 514 | Open in IMG/M |
3300017682|Ga0182229_1106551 | Not Available | 501 | Open in IMG/M |
3300017683|Ga0182218_1059308 | Not Available | 674 | Open in IMG/M |
3300017683|Ga0182218_1133647 | Not Available | 525 | Open in IMG/M |
3300017684|Ga0182225_1131771 | Not Available | 517 | Open in IMG/M |
3300017685|Ga0182227_1105576 | Not Available | 553 | Open in IMG/M |
3300017685|Ga0182227_1132124 | All Organisms → cellular organisms → Eukaryota | 508 | Open in IMG/M |
3300017686|Ga0182205_1070508 | All Organisms → cellular organisms → Eukaryota | 677 | Open in IMG/M |
3300017690|Ga0182223_1093563 | Not Available | 545 | Open in IMG/M |
3300025926|Ga0207659_10810227 | Not Available | 804 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 86.24% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.83% |
Root | Host-Associated → Plants → Roots → Unclassified → Unclassified → Root | 1.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.83% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.92% |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014486 | Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017681 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062594_1022496331 | 3300005093 | Soil | VDDVEAYNNYDEMPLFIDFPKKISVVEKNLPKDILLWERKGVKGKVVTAG* |
Ga0068869_1017288441 | 3300005334 | Miscanthus Rhizosphere | DVEAYNNYDEMPLFTDFPKKISVVEKNLPKDILPWERKGVKGKVVTTG* |
Ga0068868_1017369951 | 3300005338 | Miscanthus Rhizosphere | AYNNYDEMPLFINFPKKISVVEKNLPKDILPWERKGVKEKVVTAG* |
Ga0070675_1014219541 | 3300005354 | Miscanthus Rhizosphere | IRVDGVDDVEAYNKCDEMPLFTDFCKKIEAVEKNLPKDVLPWERKGVKGKVITVG* |
Ga0068871_1007445332 | 3300006358 | Miscanthus Rhizosphere | HIIGVDGVDDVEAYNKCDEMPLFIDFCKKIEAVEKNLPKDILPWERKGVKRKVVMVG* |
Ga0120192_100092842 | 3300012021 | Terrestrial | VDDVEAYNNYKEMALFTDFCKKINVVEKNLPKDIMPWERKGVKGKVVTAG* |
Ga0157378_111231432 | 3300013297 | Miscanthus Rhizosphere | VDDVEAYNNYDEMPLFTDFPKKISVVEKNLSKDIMPREQKGVKGKVVTAD* |
Ga0157378_112303701 | 3300013297 | Miscanthus Rhizosphere | DDVEAYNNYDEMPLFADFLKKISVVEKNLPKDILLCERKCVKGKVVIAG* |
Ga0157378_126078131 | 3300013297 | Miscanthus Rhizosphere | VDDVEAYNNYDEMPLFTDFTKKISVVEKNLSKDILPWERKGVKGKVVTMG* |
Ga0182004_102193271 | 3300014486 | Root | HLFSDFSRKISVVERNLPKNIMPWERKGGKAKFVTAGPS* |
Ga0182004_102540971 | 3300014486 | Root | KCDQMPLFTDFINKIGDVEKNLPKDVLPWERKGVKWKTVTAADTNK* |
Ga0157377_109089351 | 3300014745 | Miscanthus Rhizosphere | VNDVEAYNNYDKMPLFTDFPKKISVVEKNIPKDIMPWERKGVNGKVVTAG* |
Ga0157377_116306482 | 3300014745 | Miscanthus Rhizosphere | VDDVEAYNNYDEMPLFTDFPKKISVVEKNLPKDILPYKRKGVKKKVVTAG* |
Ga0182122_10201591 | 3300015267 | Miscanthus Phyllosphere | NKCDEMPLFTDFYKKIDAVEKNLPKDVLPWERKGVKGKVVTVG* |
Ga0182154_10156421 | 3300015268 | Miscanthus Phyllosphere | MDDVEAYNNYDEMLLFTDFPKRISVVEKNLSKDILPWEQKGVKGKVVTG* |
Ga0182154_10389441 | 3300015268 | Miscanthus Phyllosphere | DEMPLFTDFCKKIEAVEKNLPKDVLPWERKCVKGKVVTVG* |
Ga0182113_10456352 | 3300015269 | Miscanthus Phyllosphere | VDDVEAYNKCNEMPLFTDFYKKIEAVKKNLPKDVLPWKRKGVKGKVITVG* |
Ga0182188_10434321 | 3300015274 | Miscanthus Phyllosphere | NYDEMPLFTDFPKKISVVEKNLPKDILPWEQKGVKGKVVTTG* |
Ga0182170_10703181 | 3300015276 | Miscanthus Phyllosphere | VDDVEEYNNYAEMQLFIDVPKKISAVEKNLPRDILPWEQKGVKGKVVTG* |
Ga0182174_10248921 | 3300015279 | Miscanthus Phyllosphere | VDDVEAYNNYDEMPLFTDFPKKISVVEKNLPKDIMPWERKGVKGKVVTAG* |
Ga0182174_10384822 | 3300015279 | Miscanthus Phyllosphere | VDDVEAYNKCNEMPLFTDFYKKIEAVKKNLPKDVLPWKRKGVKGKIITVG* |
Ga0182174_10661671 | 3300015279 | Miscanthus Phyllosphere | MDDVDEYNSYVEMQLFIDFPKKISVVEKNLPKDILPWERKSVKGKVVTAG* |
Ga0182156_10552971 | 3300015283 | Miscanthus Phyllosphere | VDDVEAYNNYDEISLFIDFPKKISIVKKNLPKDILLCERKCVKEKVVTVD* |
Ga0182156_10826011 | 3300015283 | Miscanthus Phyllosphere | VDDVEAYNNYDEISLFIDFSKKISVVEKNLPEDILPWERKGVKEKVVIAC* |
Ga0182186_10246362 | 3300015285 | Miscanthus Phyllosphere | VDDVEAYNKCDEMPLFIDFCKKIEGVEKNLPKDVLPWERKGVKGKVVTVG* |
Ga0182176_10633602 | 3300015286 | Miscanthus Phyllosphere | VDDVEAYNKCNEMPLFTDFYKKIEAVKKNLPKDVLPWERKGVKGKVVMVG* |
Ga0182176_10747841 | 3300015286 | Miscanthus Phyllosphere | VDNVEAYNNYDEMPLFIDFSKKISVVKKNLPKDIMPWERKGVKGKVVTAG* |
Ga0182141_10411621 | 3300015292 | Miscanthus Phyllosphere | EAYNNYDEMPLFIDFPKKISVVEKNLPKDIMPWERKGVKGKVVTAG* |
Ga0182141_10801081 | 3300015292 | Miscanthus Phyllosphere | IRVDGVDDVEAYNNYDEMPLFIDFSKKIIVVEKNLSKDILPWERKGVNGKVVTVG* |
Ga0182126_10827461 | 3300015294 | Miscanthus Phyllosphere | NKCDEMSLFIDFCKKIEAVEKNLPKDVLLWERKGVKGKVVTVG* |
Ga0182175_10405511 | 3300015295 | Miscanthus Phyllosphere | IIGVDGVDDVEAYNKCNEMPLFTDFYKIEAVKKNLPKDVLPWERKCVKGKVITVG* |
Ga0182157_10959451 | 3300015296 | Miscanthus Phyllosphere | NYNEMSLFIDFPKKISVVEKNLPKDIMPWERKGVKGKVVIAG* |
Ga0182106_10912891 | 3300015298 | Miscanthus Phyllosphere | MDDIEEYNNYTKMQLFTDFPKKIEAVEKNLPKDILPWERKGAKGKVVTG* |
Ga0182107_10732061 | 3300015299 | Miscanthus Phyllosphere | MDDVDEYNNYAKMQLFTNFLKISIVKKNLPKDILPWERKCVKGKVVTAG* |
Ga0182108_10826481 | 3300015300 | Miscanthus Phyllosphere | IGVDGVYDVEAYNNYDEIPLFTDFPKKIGVVEKNLPKDILPWERKGVKGKVVTAG* |
Ga0182143_10169292 | 3300015302 | Miscanthus Phyllosphere | VDDVEAYNNYDEMPLFTDFPKKFSVVKKNLPKDILPWEQKGVKEKVVTVG* |
Ga0182143_10537262 | 3300015302 | Miscanthus Phyllosphere | VDDIDEYNNYAKMHLFIDFPKKISVVEKNLSKNILPWEQKCVKG |
Ga0182112_10150141 | 3300015304 | Miscanthus Phyllosphere | VDGYNNNNYQEMELSVDFPKKISAIEKKLPKDKLPWERKDAKGKTVSG* |
Ga0182112_10469071 | 3300015304 | Miscanthus Phyllosphere | DGVDDVEAYNKCDEMPLFTDFCKKIEAMEKNLSKDVLLWERKCVNGKVVTVG* |
Ga0182112_11050112 | 3300015304 | Miscanthus Phyllosphere | VDGVDDVDEYNNYAEMHLFTNFPKKISVVEKNLPKDILPWERKCVKGKVVTAG* |
Ga0182142_10200661 | 3300015308 | Miscanthus Phyllosphere | VDDVEAYNNYDEMPLFTDFPKKISVVEKNLPKDILPWERKGVKREGKF* |
Ga0182142_11161041 | 3300015308 | Miscanthus Phyllosphere | VDDVDEYNNYAEMQLFTDFPKKISVVEKNLSKDILPWKRKGVKRKVVTSKLVVQH |
Ga0182164_11353031 | 3300015313 | Switchgrass Phyllosphere | YNNYDEMPLFTDFSKKISVMEKNLPKDILPWERKGVKRKVVTAG* |
Ga0182110_10749332 | 3300015322 | Miscanthus Phyllosphere | DDVEAYNKCNEMPLFTDFYKIEAVKKNLPKDVLPWERKCVKGKVVMVG* |
Ga0182110_11166191 | 3300015322 | Miscanthus Phyllosphere | EAYNNYDEMPLFTDFPKKISVVEKNLSKYILPWERNGVKRKVVTMGSLVVEHGLIL* |
Ga0182129_10917101 | 3300015323 | Miscanthus Phyllosphere | MDDVEAYNNYDEMLLFTDFPKKISVVEKNLSKDILSWERKGVKGKVVTAGKSVVERGVFV |
Ga0182109_11789451 | 3300015342 | Miscanthus Phyllosphere | VDDVEAYNNYDEILLFTDFPKKTSVVEKNLPKDILPWEQKGVKEKIITVG* |
Ga0182155_11349141 | 3300015343 | Miscanthus Phyllosphere | VDDVDEYNNYAKMQLFTDFPKKICVVKKNLPKDILPWERKGVKGKFVTAG* |
Ga0182155_11781041 | 3300015343 | Miscanthus Phyllosphere | NYDEMPLFTDFPKKISVVEKNLPKDIMPWERKCVKGKVVIAG* |
Ga0182155_12125341 | 3300015343 | Miscanthus Phyllosphere | VEAYNKCDEMPLFTNFCKKIEAVEKNLPKDVLPWKRKGVKRKIVTVG* |
Ga0182189_10113782 | 3300015344 | Miscanthus Phyllosphere | VDAVGAYNDYAEMPLFTDFSNKISAVERNLPKDILPWERKGGKGKVVSAGPS* |
Ga0182189_10331351 | 3300015344 | Miscanthus Phyllosphere | RVDGVDDVEAYNNYDEMPLFTDFPKKISVVEKNLPKDILPWERKGVKREGKF* |
Ga0182189_11743471 | 3300015344 | Miscanthus Phyllosphere | MDDVEAYNNYDEMPLFIDFPKKISVVEKNLPKDILPGERKGVKGKVVTAGKLVVERGVFV |
Ga0182111_11770201 | 3300015345 | Miscanthus Phyllosphere | LPPENRVDGMDDVDEYNNYAKMQLFIDFPTKINVVEKSLPKDILPWERKCVKGKVVTG* |
Ga0182111_11813961 | 3300015345 | Miscanthus Phyllosphere | DDVEAYNNYDEMPLFIDFPKKISVVEKNLPKDILPWKRNGVKGKVVIAG* |
Ga0182111_12438951 | 3300015345 | Miscanthus Phyllosphere | VDDVEAYNNYDVMPLFIDFPNKIRVVEKNLPKDILPWERKGVKGKVVTAG* |
Ga0182139_10809341 | 3300015346 | Miscanthus Phyllosphere | VDDVEAYNNYYEMPLFSDFPKKISAVEKNLSKDILPWERKCVKGKVVTG* |
Ga0182139_12339811 | 3300015346 | Miscanthus Phyllosphere | VGDVEAYNNYDEMPLFIEFSKKISVMEKNLPKDILPCERKGVKGKVVTVG* |
Ga0182177_11394531 | 3300015347 | Miscanthus Phyllosphere | VDDIDEYDNYAETHLFTDFPKKISVVEKKLPKDILPWERKGVKRKVVTG* |
Ga0182161_12203522 | 3300015351 | Miscanthus Phyllosphere | DEMPLFTDFPKKISVVEKNLLKDILPWKRKGAKGKVVTTG* |
Ga0182161_12613991 | 3300015351 | Miscanthus Phyllosphere | AYNNYDEMPLFTYFSKKISVVEKNLPKDILPWEQKCVKEKVVTAG* |
Ga0182159_11545142 | 3300015355 | Miscanthus Phyllosphere | MDDVDEYDNYAEMHLFTDFPKKISVVEKNLPKDILPWERKCVKGKVVTG* |
Ga0182159_11749131 | 3300015355 | Miscanthus Phyllosphere | MDDVEAYNNYDEMPLFIDFPKKIGVVEKNLSKDILPWERKGVKGKVVTAG* |
Ga0182159_11937011 | 3300015355 | Miscanthus Phyllosphere | VDDVEEYNNYTEMHLFIDFPKKIEVVEEKNLPKDILQWVRKGVKGKVVTG* |
Ga0182159_12043121 | 3300015355 | Miscanthus Phyllosphere | QHIIGVDGVDDAEAYNNNDEMLLFIDFTKKISLVEKNLPKDIMPWERKGVKGKVVTAGPT |
Ga0182159_12822261 | 3300015355 | Miscanthus Phyllosphere | VDGVDDVEAYNNYDEMPLFIDFPKKISVVEKNLPKDIMPWERKGVKGKVVTAG* |
Ga0182159_13474852 | 3300015355 | Miscanthus Phyllosphere | AYNNYDEMPLFIDFPKKISVVEKNLSKDILPWERKGVKGKVERAS* |
Ga0182203_11220211 | 3300017404 | Miscanthus Phyllosphere | DVDEYNNFAEMQLFTDFPKKISAVENNLSKDILPWEQKCFKGKVVTD |
Ga0182203_11322101 | 3300017404 | Miscanthus Phyllosphere | DDVEAYNNYDEMPLFTDFPKKISVVEKNLPKDILPWERKGVKGKVVTAG |
Ga0182220_10287951 | 3300017407 | Miscanthus Phyllosphere | YNNYDEILLFTDFPKKISVVEKNLLKDILPWERKCVKGKVVTAG |
Ga0182220_10330541 | 3300017407 | Miscanthus Phyllosphere | VDDVEAYNNYDEMPLYTDFPKKISVVKKNLPKDILPRERKCVKGKVVIAG |
Ga0182220_10692871 | 3300017407 | Miscanthus Phyllosphere | LFTDFPKKISVVEKNLPKDIMPWERKGVTGKVVTAG |
Ga0182204_10661311 | 3300017409 | Miscanthus Phyllosphere | VDNVEAYNNYNEMPLFIDFPKKISVVEKNLPKDILPWERKGVKGKVVIAG |
Ga0182204_10753751 | 3300017409 | Miscanthus Phyllosphere | VDDVEAYNKCDEMPLFTDFCKKIEAVEKNLPKDVLPWEQKGVKGKVVMVG |
Ga0182204_10991692 | 3300017409 | Miscanthus Phyllosphere | VDDVEAGNNYDEMPLFMDFSKKISVVEKNLPKDIMPWEGKGVKGKVVTAG |
Ga0182207_11319272 | 3300017410 | Miscanthus Phyllosphere | VDDVEAYNKCNEMPLFTDFYKKIEAVKKNLPKDVLPWKRKGVKWKVITVG |
Ga0182207_11602921 | 3300017410 | Miscanthus Phyllosphere | DGMDDVEAYNNYDEMPLFIDFPKKISVVEKNLPKDIMPWERKGVKGKVITAG |
Ga0182208_10945732 | 3300017411 | Miscanthus Phyllosphere | VDDVEAYNKCNEMPLFTDFYKKIEAVKKNLPKDVLPWKRKGVKGKVITVG |
Ga0182208_11153951 | 3300017411 | Miscanthus Phyllosphere | MDDVEAYNNYDEMPLFIDFPKKISVVEKNLPKDILPWEQKHVKGKVVTAGLL |
Ga0182202_10548541 | 3300017415 | Miscanthus Phyllosphere | VDDVDEYNNYAEMHLFTNFPKKISVVKKNISKDILPWERKGVKEKVVTAG |
Ga0182230_10837261 | 3300017417 | Miscanthus Phyllosphere | VDNIEAYNNYNKMPLFIDFPKKISVVEKNLPKDILPWKRKGVKGKVVTAG |
Ga0182228_10578801 | 3300017420 | Miscanthus Phyllosphere | VDDVEAYNNYDEMPLFIDFPKKISVVEKNLPKDILPWERKGVKGKVVTAG |
Ga0182228_10712312 | 3300017420 | Miscanthus Phyllosphere | VDDVEAYNNYDEMPLFIDFLKKISVVEKNLPKDILPWEQKGVQ |
Ga0182228_11045571 | 3300017420 | Miscanthus Phyllosphere | VDDVEAYNNYDEMPLFTDFHKKISVVEKNLPKDILPWERKCVKGKVVTAG |
Ga0182219_11289632 | 3300017424 | Miscanthus Phyllosphere | VDDVEAYNKCNEMPLFTDFCKKIEAVEKNLPKDVLPWERKGVKG |
Ga0182224_10200592 | 3300017425 | Miscanthus Phyllosphere | VDDVEAYNNYDEMPLFIDFSKKISVVEKNLPKDVLPWEQKGVNGKVIIAG |
Ga0182224_10404261 | 3300017425 | Miscanthus Phyllosphere | VDDVEAYNNYDEMPLFTDFPKKISVVEKNLSKDILSWERKGVKGKVVTAGKSVVERGVFV |
Ga0182224_10690812 | 3300017425 | Miscanthus Phyllosphere | VDDVEAYNNCDEMPLFTNFSKKINVVEKNLSKDILPWERKGVKGKVVTAG |
Ga0182224_11541591 | 3300017425 | Miscanthus Phyllosphere | VDDVEAYNNYDEMPLFIDFHKKISVVEKNLPKDILPWEQKGVKGKVVTVG |
Ga0182190_10254141 | 3300017427 | Miscanthus Phyllosphere | VDDVEAYNKCNKMPLFIDFYKKIDAVEKNLPKDVLPWERKGVKGKVVTVG |
Ga0182190_11039561 | 3300017427 | Miscanthus Phyllosphere | DDVDEYDNYAEMHLFTDFLKKISVLEKNLSKDILPWERKGVKGKVVTVG |
Ga0182190_11450721 | 3300017427 | Miscanthus Phyllosphere | MDNVDEYSNYVEMQLFTDFPKKISVVENNLPKDILPSERKDVKGKVVAG |
Ga0182206_11143761 | 3300017433 | Miscanthus Phyllosphere | PLFTDFPKKISVVEKNLPKDIMPWERKGVKGKVVTAG |
Ga0182209_10546821 | 3300017436 | Miscanthus Phyllosphere | VDDAEAYNNYDEMLLFTDFPKKISVVEKNLSKDILPWERKGVKGKVVTVS |
Ga0182221_10867061 | 3300017442 | Miscanthus Phyllosphere | VDGMDDVEAYNNYDEMSLFTDFPKKIRVVEKKLPKDILPWEQKGVKGKVIIVG |
Ga0182221_10915492 | 3300017442 | Miscanthus Phyllosphere | VEAYNKCNEMPLFIDFYKIEAVKKNLPKDVLPWKRKGIKGKVITVG |
Ga0182221_11456311 | 3300017442 | Miscanthus Phyllosphere | RVDGVDDVEAYNNYDEMPLFTDFSKKISVVKKNLPKDILPWERKGVKGKVVTAG |
Ga0182193_10785792 | 3300017443 | Miscanthus Phyllosphere | VDDVEAYNNYDEMPLFTDFPKKISVVEKNLSKDILSWERKGVKGKVVTAGKPVVERGVFV |
Ga0182193_11467841 | 3300017443 | Miscanthus Phyllosphere | MDDVEAYNNYDEMPLFTNFSKKISIVEKNLPKDILPWEXKGVKEKIVTAG |
Ga0182226_11145421 | 3300017681 | Miscanthus Phyllosphere | DVEAYNNYDEMPLFIDFPKKINVVEKNLPKDILPWEQKGVKGKVIIAG |
Ga0182229_11065511 | 3300017682 | Miscanthus Phyllosphere | YNNYDEMPLFTDFCKKIDVVEKNLPKDILPWERKCVNEKVVTG |
Ga0182218_10593081 | 3300017683 | Miscanthus Phyllosphere | DGVDDVEAYNKCNEMPLFTDFCKKIEAVEKNLPKDVLPWEQKGVKGKVVTG |
Ga0182218_11336471 | 3300017683 | Miscanthus Phyllosphere | VDDVEAYNNYDEIPLFTDFPKKVSVVEKNLLKDIFPWERKCVKGKVVTAG |
Ga0182225_11317711 | 3300017684 | Miscanthus Phyllosphere | RVDGVDDIDKYKNYVEVQLFTYFSKKISVVEKNLSKDILPWEQKGVKGKVITAG |
Ga0182227_11055761 | 3300017685 | Miscanthus Phyllosphere | VDDDEAYNNYDEILLFTDFPKKISVVKKNLPKDILLWERKGVKGKFVTAG |
Ga0182227_11321241 | 3300017685 | Miscanthus Phyllosphere | MDDVEEYNNYAKMQLFTDIPKKISAVEKNLPRDILPWEQKSVKGKVVMG |
Ga0182205_10705081 | 3300017686 | Miscanthus Phyllosphere | MDDVDEYNNYAEIQLFTNFPKKISVIEKNLPKDILPWKRKGVKGKVVTG |
Ga0182223_10935631 | 3300017690 | Miscanthus Phyllosphere | NYDEMPLFIDFPKKINAMKKNLPKNILPWEQKSVKGKVITAG |
Ga0207659_108102271 | 3300025926 | Miscanthus Rhizosphere | EELDDVEAYNKCDEMPLFTDFCKKIEAVEKNLPKDVLPWERKGVKGKVVTVG |
⦗Top⦘ |