Metagenome Family F089059

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F089059
Family Type	Metagenome
Number of Sequences	109
Average Sequence Length	47 residues
Representative Sequence	MSPEELEIPAKKPSILAPPKEADVKQIDLGTGDPSKTATISAHLSAK
Number of Associated Samples	57
Number of Associated Scaffolds	109

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	0.93 %
% of genes near scaffold ends (potentially truncated)	62.39 %
% of genes from short scaffolds (< 2000 bps)	99.08 %
Associated GOLD sequencing projects	57
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Eukaryota (57.798 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (91.743 % of family members)
Environment Ontology (ENVO)	Unclassified (92.661 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (92.661 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 5.33% β-sheet: 18.67% Coil/Unstructured: 76.00%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.34
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 109 Family Scaffolds
PF00078	RVT_1	4.59

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	57.80 %
Unclassified	root	N/A	42.20 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	57.80 %
Unclassified	root	N/A	42.20 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	57.80 %
Unclassified	root	N/A	42.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	21.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Anthephorinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae	19.27 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Digitaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria	19.27 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.20 %
Digitaria exilis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	19.27 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005614\|Ga0068856_101880824	All Organisms → cellular organisms → Eukaryota	610	Open in IMG/M
3300006237\|Ga0097621_102373106	All Organisms → cellular organisms → Eukaryota	508	Open in IMG/M
3300009148\|Ga0105243_12084329	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	603	Open in IMG/M
3300009176\|Ga0105242_12484984	Not Available	566	Open in IMG/M
3300013296\|Ga0157374_11987178	All Organisms → cellular organisms → Eukaryota	608	Open in IMG/M
3300013297\|Ga0157378_10970253	All Organisms → cellular organisms → Eukaryota	883	Open in IMG/M
3300013297\|Ga0157378_12045501	All Organisms → cellular organisms → Eukaryota	623	Open in IMG/M
3300015267\|Ga0182122_1067366	Not Available	513	Open in IMG/M
3300015268\|Ga0182154_1013542	All Organisms → cellular organisms → Eukaryota	795	Open in IMG/M
3300015268\|Ga0182154_1028148	Not Available	657	Open in IMG/M
3300015268\|Ga0182154_1050491	Not Available	561	Open in IMG/M
3300015268\|Ga0182154_1064058	All Organisms → cellular organisms → Eukaryota	524	Open in IMG/M
3300015269\|Ga0182113_1021027	Not Available	788	Open in IMG/M
3300015275\|Ga0182172_1064873	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	529	Open in IMG/M
3300015276\|Ga0182170_1003790	All Organisms → cellular organisms → Eukaryota	1153	Open in IMG/M
3300015277\|Ga0182128_1023777	Not Available	708	Open in IMG/M
3300015277\|Ga0182128_1036204	Not Available	631	Open in IMG/M
3300015277\|Ga0182128_1041381	Not Available	608	Open in IMG/M
3300015277\|Ga0182128_1066596	Not Available	530	Open in IMG/M
3300015279\|Ga0182174_1081353	All Organisms → cellular organisms → Eukaryota	511	Open in IMG/M
3300015281\|Ga0182160_1010179	All Organisms → cellular organisms → Eukaryota	903	Open in IMG/M
3300015281\|Ga0182160_1044892	Not Available	604	Open in IMG/M
3300015282\|Ga0182124_1047035	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	593	Open in IMG/M
3300015282\|Ga0182124_1056491	All Organisms → cellular organisms → Eukaryota	562	Open in IMG/M
3300015282\|Ga0182124_1075697	All Organisms → cellular organisms → Eukaryota	516	Open in IMG/M
3300015283\|Ga0182156_1058829	Not Available	568	Open in IMG/M
3300015283\|Ga0182156_1079140	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	519	Open in IMG/M
3300015283\|Ga0182156_1084146	Not Available	509	Open in IMG/M
3300015285\|Ga0182186_1018733	Not Available	771	Open in IMG/M
3300015286\|Ga0182176_1057038	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	572	Open in IMG/M
3300015286\|Ga0182176_1060833	All Organisms → cellular organisms → Eukaryota	561	Open in IMG/M
3300015286\|Ga0182176_1068882	All Organisms → cellular organisms → Eukaryota	540	Open in IMG/M
3300015286\|Ga0182176_1070637	Not Available	535	Open in IMG/M
3300015287\|Ga0182171_1040915	Not Available	631	Open in IMG/M
3300015288\|Ga0182173_1029861	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	682	Open in IMG/M
3300015288\|Ga0182173_1046947	All Organisms → cellular organisms → Eukaryota	602	Open in IMG/M
3300015291\|Ga0182125_1052467	All Organisms → cellular organisms → Eukaryota	600	Open in IMG/M
3300015292\|Ga0182141_1071584	All Organisms → cellular organisms → Eukaryota	547	Open in IMG/M
3300015292\|Ga0182141_1091426	All Organisms → cellular organisms → Eukaryota	507	Open in IMG/M
3300015294\|Ga0182126_1007645	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	1026	Open in IMG/M
3300015294\|Ga0182126_1057840	Not Available	586	Open in IMG/M
3300015294\|Ga0182126_1074429	All Organisms → cellular organisms → Eukaryota	543	Open in IMG/M
3300015294\|Ga0182126_1086605	Not Available	519	Open in IMG/M
3300015295\|Ga0182175_1039173	Not Available	662	Open in IMG/M
3300015295\|Ga0182175_1046781	Not Available	629	Open in IMG/M
3300015295\|Ga0182175_1072669	All Organisms → cellular organisms → Eukaryota	553	Open in IMG/M
3300015296\|Ga0182157_1050765	Not Available	624	Open in IMG/M
3300015299\|Ga0182107_1067203	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	577	Open in IMG/M
3300015299\|Ga0182107_1074694	All Organisms → cellular organisms → Eukaryota	559	Open in IMG/M
3300015300\|Ga0182108_1079183	Not Available	552	Open in IMG/M
3300015302\|Ga0182143_1045969	All Organisms → cellular organisms → Eukaryota	645	Open in IMG/M
3300015302\|Ga0182143_1101192	Not Available	507	Open in IMG/M
3300015303\|Ga0182123_1037556	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	664	Open in IMG/M
3300015304\|Ga0182112_1103049	All Organisms → cellular organisms → Eukaryota	506	Open in IMG/M
3300015304\|Ga0182112_1105568	All Organisms → cellular organisms → Eukaryota	503	Open in IMG/M
3300015305\|Ga0182158_1085741	Not Available	534	Open in IMG/M
3300015305\|Ga0182158_1103506	Not Available	504	Open in IMG/M
3300015308\|Ga0182142_1027191	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	774	Open in IMG/M
3300015308\|Ga0182142_1096853	All Organisms → cellular organisms → Eukaryota	531	Open in IMG/M
3300015314\|Ga0182140_1096116	Not Available	533	Open in IMG/M
3300015314\|Ga0182140_1113965	Not Available	505	Open in IMG/M
3300015321\|Ga0182127_1065793	All Organisms → cellular organisms → Eukaryota	616	Open in IMG/M
3300015321\|Ga0182127_1092025	Not Available	555	Open in IMG/M
3300015322\|Ga0182110_1032477	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	757	Open in IMG/M
3300015322\|Ga0182110_1047747	Not Available	676	Open in IMG/M
3300015322\|Ga0182110_1078963	Not Available	581	Open in IMG/M
3300015322\|Ga0182110_1093777	All Organisms → cellular organisms → Eukaryota	550	Open in IMG/M
3300015323\|Ga0182129_1042355	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	681	Open in IMG/M
3300015323\|Ga0182129_1091560	All Organisms → cellular organisms → Eukaryota	541	Open in IMG/M
3300015342\|Ga0182109_1085728	Not Available	719	Open in IMG/M
3300015342\|Ga0182109_1218158	All Organisms → cellular organisms → Eukaryota	507	Open in IMG/M
3300015344\|Ga0182189_1200284	Not Available	529	Open in IMG/M
3300015345\|Ga0182111_1134357	Not Available	634	Open in IMG/M
3300015345\|Ga0182111_1135469	Not Available	632	Open in IMG/M
3300015345\|Ga0182111_1172332	Not Available	577	Open in IMG/M
3300015345\|Ga0182111_1246164	All Organisms → cellular organisms → Eukaryota	501	Open in IMG/M
3300015346\|Ga0182139_1101718	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	704	Open in IMG/M
3300015346\|Ga0182139_1143764	Not Available	619	Open in IMG/M
3300015346\|Ga0182139_1197184	All Organisms → cellular organisms → Eukaryota	548	Open in IMG/M
3300015346\|Ga0182139_1230582	All Organisms → cellular organisms → Eukaryota	515	Open in IMG/M
3300015347\|Ga0182177_1078119	Not Available	779	Open in IMG/M
3300015347\|Ga0182177_1096847	All Organisms → cellular organisms → Eukaryota	720	Open in IMG/M
3300015351\|Ga0182161_1177321	Not Available	593	Open in IMG/M
3300015351\|Ga0182161_1187473	Not Available	580	Open in IMG/M
3300015351\|Ga0182161_1214749	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	549	Open in IMG/M
3300015351\|Ga0182161_1258350	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	509	Open in IMG/M
3300015355\|Ga0182159_1184371	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	666	Open in IMG/M
3300015355\|Ga0182159_1240055	All Organisms → cellular organisms → Eukaryota	594	Open in IMG/M
3300015355\|Ga0182159_1260460	All Organisms → cellular organisms → Eukaryota	573	Open in IMG/M
3300015355\|Ga0182159_1288367	Not Available	548	Open in IMG/M
3300015355\|Ga0182159_1310999	Not Available	530	Open in IMG/M
3300015361\|Ga0182145_1087836	Not Available	656	Open in IMG/M
3300015361\|Ga0182145_1113639	All Organisms → cellular organisms → Eukaryota	603	Open in IMG/M
3300015361\|Ga0182145_1132599	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	572	Open in IMG/M
3300017409\|Ga0182204_1056437	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	632	Open in IMG/M
3300017425\|Ga0182224_1029012	Not Available	863	Open in IMG/M
3300017427\|Ga0182190_1138633	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	534	Open in IMG/M
3300017430\|Ga0182192_1081057	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	654	Open in IMG/M
3300017433\|Ga0182206_1144174	All Organisms → cellular organisms → Eukaryota	519	Open in IMG/M
3300017438\|Ga0182191_1074589	Not Available	679	Open in IMG/M
3300017443\|Ga0182193_1157304	All Organisms → cellular organisms → Eukaryota	545	Open in IMG/M
3300017682\|Ga0182229_1071842	Not Available	595	Open in IMG/M
3300017683\|Ga0182218_1075687	All Organisms → cellular organisms → Eukaryota	626	Open in IMG/M
3300017686\|Ga0182205_1172798	Not Available	500	Open in IMG/M
3300017690\|Ga0182223_1074932	All Organisms → cellular organisms → Eukaryota	579	Open in IMG/M
3300017690\|Ga0182223_1096707	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	540	Open in IMG/M
3300021060\|Ga0182232_1024466	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1044	Open in IMG/M
3300025908\|Ga0207643_10315749	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	975	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	92.66%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.59%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.83%
Roots	Host-Associated → Plants → Roots	0.92%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	92.66%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.59%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.83%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.92%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	92.66%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.59%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.83%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.92%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	91.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.75%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.83%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.92%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.92%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068856_1018808241	3300005614	Corn Rhizosphere	SQEELEIPAKKPSIIAPPKEADIKQIDLGTGDTSKTATISAHLSEK*
Ga0097621_1023731061	3300006237	Miscanthus Rhizosphere	SILAPPKEADVKQIDLGTGDPSKMATISAHLSAK*
Ga0105243_120843291	3300009148	Miscanthus Rhizosphere	MSPEELEIPAKKPSILAPPKEANVKQIDLGTGDPTKTATISAHLSAK*
Ga0105242_124849841	3300009176	Miscanthus Rhizosphere	KKPNIIAPSKEADVKQIDLGTGDTSKTATISAHLSAK*
Ga0157374_119871781	3300013296	Miscanthus Rhizosphere	KKPSLIAPPKEADVKQIDLGTGDTSKTATISAHLSTK*
Ga0157378_109702532	3300013297	Miscanthus Rhizosphere	MSPEELEIPAKKPSILAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0157378_120455012	3300013297	Miscanthus Rhizosphere	TIAAEMSPEELEIPAKKPSILAPPKEADIKQIDLGTGDPSRTATISAHLSAK*
Ga0182122_10673662	3300015267	Miscanthus Phyllosphere	VELSPEELEIPAKKPSILAPPKEADVKQIDLGTGDPVKTAIISAHLSAK*
Ga0182154_10135422	3300015268	Miscanthus Phyllosphere	MNPEELEIPAKRPSILAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182154_10281481	3300015268	Miscanthus Phyllosphere	LAKKPSILATPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182154_10504913	3300015268	Miscanthus Phyllosphere	IAAETSQEELEIPAKKPSIIAPPKEADIKQIDLGTGDPSKTATISAHLSAK*
Ga0182154_10640582	3300015268	Miscanthus Phyllosphere	EELEIPAKKPSILAPPKEADVKQIDLGTDDPSKTATISAHLSAK*
Ga0182113_10210273	3300015269	Miscanthus Phyllosphere	MNPKELEILAKRPGILAPPKEANIKQIDLGTGDPSKTATINAHLSAK*
Ga0182172_10249682	3300015275	Miscanthus Phyllosphere	MNPEELEIPAKRPSILAPPKEADVKQIDLGTGDPSK
Ga0182172_10648732	3300015275	Miscanthus Phyllosphere	MSPEELVIPAKKPNILAPPKEADVEQIDLGTGDPSKMATISAHLLAK*
Ga0182170_10037901	3300015276	Miscanthus Phyllosphere	EIATIAAEISQEELEMPAKKPSILAPPKEADVKQIDLGTSDPSKTATISAHLSAK*
Ga0182128_10237772	3300015277	Miscanthus Phyllosphere	MSPEELVIPAKKPTILAPPKEADVKQIDLGTGDPSKMTTISAHLSAK*
Ga0182128_10362041	3300015277	Miscanthus Phyllosphere	RKEIAIIAAETNPEELEIPAKKPSILAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182128_10413812	3300015277	Miscanthus Phyllosphere	ELEIPAKKPNILAPPKEADVEQIDLGTGDPEKTAIISANLDPK*
Ga0182128_10665961	3300015277	Miscanthus Phyllosphere	MIEKEISTIAVEMSPEELEILATKPSILAPPKEANVKQIDLGTGDPSKTATISAHLSAK*
Ga0182174_10813531	3300015279	Miscanthus Phyllosphere	GRKEIAAIAAETSQEELEIPAKKPSIIAPPKEADVKQIDLGTGDPSKTVTISAHLSAK*
Ga0182160_10101792	3300015281	Miscanthus Phyllosphere	MNPEELEIPAKRPSILAPPKEANVKQIDLGTGDPSKTATISAHLSAK*
Ga0182160_10448922	3300015281	Miscanthus Phyllosphere	MSPEELEIPAKKSSILAPPKEDDVKQIDLGTGDPSKTTTISAHLSAN*
Ga0182124_10470351	3300015282	Miscanthus Phyllosphere	MNLEELEILAKRPSILAPPKEVDVKQIDLGTGDPSKTATISAHLSAK*
Ga0182124_10564911	3300015282	Miscanthus Phyllosphere	KELEIPAKKPSILAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182124_10756971	3300015282	Miscanthus Phyllosphere	QEELEIPAKKPSIIAPPKEADVKQIDLGTGDISKTATISAHLSAK*
Ga0182156_10588291	3300015283	Miscanthus Phyllosphere	MNPEELEIPAKKPSILAPPKEAGVKQIDLGTSDPSKTATISAHLSAK*
Ga0182156_10791402	3300015283	Miscanthus Phyllosphere	MSPEELEIPAKKHSIIAPPKEADVKQIDLGTGDTSKTATI
Ga0182156_10841461	3300015283	Miscanthus Phyllosphere	MSPEELVIPAKKPNILAPLKEADVKQIDLAIGDPSKTATISAHLSAK*
Ga0182186_10187331	3300015285	Miscanthus Phyllosphere	SSILAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182176_10570381	3300015286	Miscanthus Phyllosphere	MSLEELVIPAKKPSILAPPKEADVKQIDLGTGDPSKTAT
Ga0182176_10608331	3300015286	Miscanthus Phyllosphere	EMSLEELEIPAKKPSILAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182176_10688821	3300015286	Miscanthus Phyllosphere	IAAIAAETSQEELEIPAKKPSIIAPPKEADVKQIDLGTGDTSKTATISAHLSAK*
Ga0182176_10706372	3300015286	Miscanthus Phyllosphere	MSPEELEISAKKPNILAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182171_10409151	3300015287	Miscanthus Phyllosphere	MSTEELVIPAKNPSILAPPKEADVKQIDLGTDDPSKMATISAHLSAK*
Ga0182173_10298611	3300015288	Miscanthus Phyllosphere	LEIPAKKPSILAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182173_10469471	3300015288	Miscanthus Phyllosphere	MNPEELEIPAKRPRILAPPKEDDVKQIDLGTGDPSKTATISAHLSAK*
Ga0182125_10524672	3300015291	Miscanthus Phyllosphere	PEELEIPAKKPSILAPPKEADVKQIDLGTGDPSKMATISAHLSAK*
Ga0182141_10715842	3300015292	Miscanthus Phyllosphere	TETNPEELEIPAKKPSILAPPKEADVKQIDLGTGDPSKTATISVHLSAK*
Ga0182141_10914261	3300015292	Miscanthus Phyllosphere	EELEIPAKRPSILAPPKEANVKQIDLGTGDPTKIVTISAHLSAK*
Ga0182126_10076451	3300015294	Miscanthus Phyllosphere	ETSQEELEIPAKKPSIIAPPKEADVKQIDLGTGDTSKTATISAHLSEK*
Ga0182126_10578402	3300015294	Miscanthus Phyllosphere	RPSILAPPKEANMKQIDLGTGDPTKTATISTHLSAK*
Ga0182126_10744291	3300015294	Miscanthus Phyllosphere	LAAEISQEDLEIPAKKPSILAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182126_10866051	3300015294	Miscanthus Phyllosphere	TIATEMNSEELEIPAKKPSILTPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182175_10391732	3300015295	Miscanthus Phyllosphere	MSPEELEILAKKPSILAPPKEADVKQIDLGTGDPSKTATI
Ga0182175_10467811	3300015295	Miscanthus Phyllosphere	ELNAAKLEIPEKNPSILAPPKEADVKQNELGTGDPSKTATISAHLTAK*
Ga0182175_10726692	3300015295	Miscanthus Phyllosphere	EMIPEELEIPAKKPSILAPPKEADIKQIDLGTGDPSKTATITAHLSAK*
Ga0182157_10507651	3300015296	Miscanthus Phyllosphere	MSLEELEIPAKKPSILAPPKEADVKQIDLGTGDPSKTITISAHLSAK*
Ga0182107_10672031	3300015299	Miscanthus Phyllosphere	IATIATEMSQEELEIPAKKPSIIAPPKEADVKQIDLGTGDASKTATISAHLLAK*
Ga0182107_10746941	3300015299	Miscanthus Phyllosphere	MSPEELEILAKKPSILAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182108_10791832	3300015300	Miscanthus Phyllosphere	MSPEELEIPAKKPSILAPPKEADVKQIDLGTGDPSKIATINAHLSAK*
Ga0182143_10459691	3300015302	Miscanthus Phyllosphere	NDGRKEIATIAVETSQEELEIPAKRPSILAPPKEANVKQIDLGTGDPTKTATISAHLLVK
Ga0182143_11011921	3300015302	Miscanthus Phyllosphere	ATITAEISPEELEILAKKPSIVAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182123_10375561	3300015303	Miscanthus Phyllosphere	MNLEELEILAKRPSILAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182112_11030491	3300015304	Miscanthus Phyllosphere	RKEIAAIAAETSQEELEIPAKKPSIIAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182112_11055681	3300015304	Miscanthus Phyllosphere	EMSQEELEIPAKKPSIIAPPKEADIKQIDLGTGDTSKIATISAHLSAK*
Ga0182158_10857411	3300015305	Miscanthus Phyllosphere	IAVEISQEELEIPAKKPSILAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182158_11035061	3300015305	Miscanthus Phyllosphere	MSPEELEIPAKKPSILAPPKEADVKQIDLGTGDPSKMATISAHLWAK*
Ga0182142_10271911	3300015308	Miscanthus Phyllosphere	MNLEELEIPAKRPSILAPPKEADIKQIDLGTGNPSKTATISAHLSTK*
Ga0182142_10968532	3300015308	Miscanthus Phyllosphere	ELSPEELEIPAKKPSILAPPKVANVKQIDLGTGDPTKMATISAHLSAK*
Ga0182140_10961161	3300015314	Miscanthus Phyllosphere	AKRPSILAPPKEADVKQIDLGTGDPSKTATISDHLSAK*
Ga0182140_11139652	3300015314	Miscanthus Phyllosphere	MSLEELEIPAKKPSILAPPKEADVKQIDLGTSDPSKTATISAHLSTK*
Ga0182127_10657931	3300015321	Miscanthus Phyllosphere	AAEASQEELEIPAKKPSIIAPPKEADVKQIDLGTGDTSKTATISAHLSAK*
Ga0182127_10920252	3300015321	Miscanthus Phyllosphere	ELSPEELEIPAKKPSILAPPKEADVKQINLGTGDPAKTTTISAHLSAK*
Ga0182110_10324771	3300015322	Miscanthus Phyllosphere	MATITAETSQEELEILAKRPSILAPPKEANVKQIDLGTGDPTKTATISAHLSAK*
Ga0182110_10477471	3300015322	Miscanthus Phyllosphere	MNPEELEILAKRPSILAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182110_10789631	3300015322	Miscanthus Phyllosphere	EEITTVTAQMNPEELEIPAKKPCILAPQKEADVKKIDLGTGDPEKTATISAHLLDK*
Ga0182110_10937771	3300015322	Miscanthus Phyllosphere	EIATIAIETSQEELEIPAKRPSILAPPKEANVKQIDLGTGDPTKTATISAHLSAK*
Ga0182129_10423552	3300015323	Miscanthus Phyllosphere	MNLEELEIPAKRPSILAPPKEANVKQIDLGTGDPSKTATISAHLSAK*
Ga0182129_10915601	3300015323	Miscanthus Phyllosphere	ATVAAEINPEELVIPAKKPGILAPPKEVDIKQIDLGTGDASKTAIISAHLSAK*
Ga0182109_10857281	3300015342	Miscanthus Phyllosphere	MSPEELEIPAKKPSILAPPKEADVKQIDLGTGDPSKTTTISADLSAK*
Ga0182109_12181581	3300015342	Miscanthus Phyllosphere	EMNPEELEIPAKKPSILAPPKEADVKQIDLGTGDPSKTATISAHLSTK*
Ga0182189_12002841	3300015344	Miscanthus Phyllosphere	KLEIPAKKPSILAPPKEADVKQIDLGTGDPSKIATISAHLSAK*
Ga0182111_11343572	3300015345	Miscanthus Phyllosphere	VELSPEELEILAKKPSILAPPKEADVKQIDLGTGDPSKTATISAHLWAK*
Ga0182111_11354692	3300015345	Miscanthus Phyllosphere	MNPDELEILAKRPIILAPQKEANVKQIDLSTGDPSKTVTISAHHFAK*
Ga0182111_11723322	3300015345	Miscanthus Phyllosphere	GRKEIATVATEMSPEELVIPAKKPSILAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182111_12461642	3300015345	Miscanthus Phyllosphere	QEELEIPAKKPSIIAPPKEADVKQIDLGTGDTSKTATISAHLSAK*
Ga0182139_11017182	3300015346	Miscanthus Phyllosphere	MNPEELEISAKKPSILAPPKKADVKQIDLCTGDPSKTATISAHLSAK*
Ga0182139_11437641	3300015346	Miscanthus Phyllosphere	MNLEELEILAKKPSILAPPKEADVKQIDLGTNDPSKTTAISAHLSTK*
Ga0182139_11971842	3300015346	Miscanthus Phyllosphere	ATIAAEMNPEELEIPAKKPSILAPPKETDVKQIDLGTGDPSKTATISAHLLTK*
Ga0182139_12305822	3300015346	Miscanthus Phyllosphere	TIAAETSQEELEITAKRPSILAPPKEANVKQIDLGTGDPTKTATISAHLSTK*
Ga0182177_10781191	3300015347	Miscanthus Phyllosphere	VELSSEELEIPAKKPSILAPPKEADVKQIDLGTGDPAKTATIS
Ga0182177_10968472	3300015347	Miscanthus Phyllosphere	NAAVAINPEELQIPSKKPSLLAPPKEVDVKHIDLGTSDPTKIAIISAHLSAK*
Ga0182161_11773211	3300015351	Miscanthus Phyllosphere	MNPEELEILAKKPSILAPPKEADVKQIDLGTGDPSKTATISAHLSAK*
Ga0182161_11874731	3300015351	Miscanthus Phyllosphere	AAEISQEELEIPAKKPSIPAPPKEADVKQIDLGTGDPSKTTTISAHLSAK*
Ga0182161_12147491	3300015351	Miscanthus Phyllosphere	MNSEELEIPAKRPSILAPPKEADIKQIDLGTADPSKTATISVHL*
Ga0182161_12583502	3300015351	Miscanthus Phyllosphere	MELSPKELEIPAKKPSILAPPKVADVKQIDLGTADPAKTATISAHLSAK*
Ga0182159_11843711	3300015355	Miscanthus Phyllosphere	EIPAKKPSILAPPKEADVKQIDLGTGDPSKMATISAHLLAK*
Ga0182159_12400552	3300015355	Miscanthus Phyllosphere	PAKKPSILAPPKEADVKQINLGTGDPSKMATINAYLSIK*
Ga0182159_12604602	3300015355	Miscanthus Phyllosphere	GRKEIATIAAEMNPEELEIPAKKPSILAPPKEADVKQIDLGTGDPSKMATISAHLSAK*
Ga0182159_12883672	3300015355	Miscanthus Phyllosphere	MSPEELEIPAKKPSILAPPKEADIKQIDQGIGDPSKTATISAHLSAK*
Ga0182159_13109992	3300015355	Miscanthus Phyllosphere	MSPEDLEIPAKKPSILAPPKEADVKQIDLGIGDPSKMATISTHLSAK*
Ga0182145_10878361	3300015361	Miscanthus Phyllosphere	KRPTILAPPKEANVKQIDLGTGDPSKMVTISAHLSAK*
Ga0182145_11136391	3300015361	Miscanthus Phyllosphere	SILAPPKEVDVKQIDLGTGDPSKTATISAHLSAK*
Ga0182145_11325991	3300015361	Miscanthus Phyllosphere	MNLEELEIPAKRPSILAPPKEADVKQIDLGTGDPSKMATISAHLSAK*
Ga0182204_10564372	3300017409	Miscanthus Phyllosphere	MNLEELEIPAKKPNILAPPKEANVKQVDLGIGDPSKTATISAHLSTK
Ga0182224_10290121	3300017425	Miscanthus Phyllosphere	MNPEELEIPAKRPSILAPPKEADVKQIDLGTGDPSKTATISTHLSAK
Ga0182190_11386331	3300017427	Miscanthus Phyllosphere	MSPEELEISAKKPSILTPPKEADVKQIDLGTGDLSKTATISAH
Ga0182192_10810571	3300017430	Miscanthus Phyllosphere	MSQEELEISAKKPSIITPPKEADVKQIDLGTGDTSKTATISAHLSAK
Ga0182206_11441742	3300017433	Miscanthus Phyllosphere	QEELEIPAKKPSIITPPKEADVKQIDLGTGDTSKTSTISAHLSAK
Ga0182191_10745891	3300017438	Miscanthus Phyllosphere	MNPEELQILAKKPSIHAPPKEANVKQIDLGTSDPSKTATISAHLSAK
Ga0182193_11573042	3300017443	Miscanthus Phyllosphere	EASQEELEIPAKKPSIIAPPKEADVKQIDLGTGDTSKTATISAHLSAK
Ga0182229_10718422	3300017682	Miscanthus Phyllosphere	EELEIPAKKPSIIAPPKEADVKQIDLGTGDTSKTATISAHLSEK
Ga0182218_10756871	3300017683	Miscanthus Phyllosphere	LEIPAKKPSIIAPPKEADVKQIDLGTGDTSKTATISAHLSAK
Ga0182205_11727982	3300017686	Miscanthus Phyllosphere	EIATIVAEISPEELEILAKKPSILAPPKEADVKKIDLGTGDPSKTATISAHLSAK
Ga0182223_10749321	3300017690	Miscanthus Phyllosphere	MSQEELEIPAKKPSIITPPKEADVKQIDLGTGDTSKTATISAHLSAK
Ga0182223_10967071	3300017690	Miscanthus Phyllosphere	MNPEELEIPAKKPSIIAPPKEADVKQIDLGTGDPSKTATISAHL
Ga0182232_10244662	3300021060	Phyllosphere	MSLEELEIPVKKPSILVPPKEADVKQIDLGTGDSSKTATISAHLLAK
Ga0207643_103157492	3300025908	Miscanthus Rhizosphere	PAKKPSIIAPPKEADVKQIDLGTGDTSKTATISAHLSAK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F089059

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences