NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089132

Metagenome / Metatranscriptome Family F089132

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089132
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 157 residues
Representative Sequence VKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPVGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAG
Number of Associated Samples 97
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 58.33 %
% of genes near scaffold ends (potentially truncated) 99.08 %
% of genes from short scaffolds (< 2000 bps) 90.83 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.083 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(30.275 % of family members)
Environment Ontology (ENVO) Unclassified
(30.275 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.789 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 71.35%    β-sheet: 0.00%    Coil/Unstructured: 28.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF00535Glycos_transf_2 11.01
PF13692Glyco_trans_1_4 10.09
PF13524Glyco_trans_1_2 7.34
PF13440Polysacc_synt_3 5.50
PF00534Glycos_transf_1 4.59
PF01266DAO 1.83
PF01943Polysacc_synt 1.83
PF13439Glyco_transf_4 1.83
PF16901DAO_C 0.92
PF13579Glyco_trans_4_4 0.92



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.08 %
UnclassifiedrootN/A0.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_10406595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium indicum522Open in IMG/M
3300000891|JGI10214J12806_11236476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium indicum558Open in IMG/M
3300001431|F14TB_106199989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria751Open in IMG/M
3300001686|C688J18823_10546522All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium741Open in IMG/M
3300001686|C688J18823_10575674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria719Open in IMG/M
3300004153|Ga0063455_100282571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria896Open in IMG/M
3300004157|Ga0062590_100503468All Organisms → cellular organisms → Bacteria → Proteobacteria1033Open in IMG/M
3300004479|Ga0062595_102069114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. BHC-A553Open in IMG/M
3300005093|Ga0062594_103253721All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium510Open in IMG/M
3300005333|Ga0070677_10704842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria569Open in IMG/M
3300005336|Ga0070680_100742813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria845Open in IMG/M
3300005339|Ga0070660_100920048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria738Open in IMG/M
3300005344|Ga0070661_101778937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium pentaromativorans523Open in IMG/M
3300005455|Ga0070663_102018491All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium pentaromativorans519Open in IMG/M
3300005457|Ga0070662_100968248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria728Open in IMG/M
3300005457|Ga0070662_101422901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium pentaromativorans597Open in IMG/M
3300005458|Ga0070681_11047182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria736Open in IMG/M
3300005459|Ga0068867_101726033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium pentaromativorans587Open in IMG/M
3300005459|Ga0068867_102016419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium indicum546Open in IMG/M
3300005535|Ga0070684_100842675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria858Open in IMG/M
3300006196|Ga0075422_10213033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria799Open in IMG/M
3300009093|Ga0105240_12709869All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium511Open in IMG/M
3300009094|Ga0111539_11289756All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium848Open in IMG/M
3300009147|Ga0114129_12498032All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium618Open in IMG/M
3300009551|Ga0105238_13058119All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium502Open in IMG/M
3300009789|Ga0126307_11218681All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium609Open in IMG/M
3300010037|Ga0126304_10911840All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium598Open in IMG/M
3300010039|Ga0126309_10074833All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1686Open in IMG/M
3300010039|Ga0126309_10734742All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium637Open in IMG/M
3300010040|Ga0126308_10849767All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium634Open in IMG/M
3300010041|Ga0126312_11025861All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium604Open in IMG/M
3300010044|Ga0126310_10643142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria796Open in IMG/M
3300010371|Ga0134125_12334466All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium582Open in IMG/M
3300010371|Ga0134125_13065092All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium506Open in IMG/M
3300010375|Ga0105239_13423794All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium516Open in IMG/M
3300010397|Ga0134124_11525524All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium697Open in IMG/M
3300010399|Ga0134127_13044725All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium547Open in IMG/M
3300010400|Ga0134122_11803210All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium644Open in IMG/M
3300010401|Ga0134121_10966173All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium833Open in IMG/M
3300010403|Ga0134123_11079442All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium825Open in IMG/M
3300012212|Ga0150985_114752253All Organisms → cellular organisms → Bacteria2510Open in IMG/M
3300012212|Ga0150985_121920998All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium633Open in IMG/M
3300012469|Ga0150984_121785249All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1388Open in IMG/M
3300012678|Ga0136615_10354019All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium641Open in IMG/M
3300012884|Ga0157300_1117304All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium510Open in IMG/M
3300012897|Ga0157285_10034447All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1159Open in IMG/M
3300012910|Ga0157308_10027770All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1326Open in IMG/M
3300012937|Ga0162653_100000273All Organisms → cellular organisms → Bacteria → Proteobacteria3241Open in IMG/M
3300012951|Ga0164300_11139073All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium513Open in IMG/M
3300012957|Ga0164303_10016046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Lyngbya → Lyngbya majuscula2764Open in IMG/M
3300012958|Ga0164299_11213038All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium572Open in IMG/M
3300012958|Ga0164299_11415409All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium538Open in IMG/M
3300013297|Ga0157378_12704401All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium549Open in IMG/M
3300015264|Ga0137403_10893125All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium739Open in IMG/M
3300015374|Ga0132255_103933750All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium631Open in IMG/M
3300018000|Ga0184604_10005108All Organisms → cellular organisms → Bacteria → Proteobacteria2405Open in IMG/M
3300018051|Ga0184620_10160812All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium731Open in IMG/M
3300018054|Ga0184621_10050269All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1391Open in IMG/M
3300018061|Ga0184619_10340445All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium685Open in IMG/M
3300018066|Ga0184617_1013224All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1701Open in IMG/M
3300018071|Ga0184618_10222103All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium794Open in IMG/M
3300018076|Ga0184609_10565428All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium512Open in IMG/M
3300018422|Ga0190265_12415934All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium625Open in IMG/M
3300019356|Ga0173481_10387553All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium679Open in IMG/M
3300019878|Ga0193715_1020342All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1441Open in IMG/M
3300019882|Ga0193713_1067750All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1013Open in IMG/M
3300021073|Ga0210378_10130438All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium974Open in IMG/M
3300021078|Ga0210381_10374190All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium523Open in IMG/M
3300021080|Ga0210382_10213793All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium839Open in IMG/M
3300021413|Ga0193750_1042852All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium979Open in IMG/M
3300021418|Ga0193695_1005065All Organisms → cellular organisms → Bacteria → Proteobacteria2480Open in IMG/M
3300022694|Ga0222623_10091375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Indioceanicola → Indioceanicola profundi1182Open in IMG/M
3300022694|Ga0222623_10128370All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium988Open in IMG/M
3300025917|Ga0207660_10822545All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium758Open in IMG/M
3300025933|Ga0207706_10187049All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1818Open in IMG/M
3300025935|Ga0207709_10465606All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium980Open in IMG/M
3300025944|Ga0207661_11917672All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium538Open in IMG/M
3300026041|Ga0207639_10734007All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium918Open in IMG/M
3300026067|Ga0207678_10370818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Indioceanicola → Indioceanicola profundi1236Open in IMG/M
3300027876|Ga0209974_10006890All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium3940Open in IMG/M
3300028708|Ga0307295_10149862All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium647Open in IMG/M
3300028711|Ga0307293_10178826All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium675Open in IMG/M
3300028711|Ga0307293_10181774All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium669Open in IMG/M
3300028716|Ga0307311_10170380All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium631Open in IMG/M
3300028720|Ga0307317_10047130All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1376Open in IMG/M
3300028755|Ga0307316_10057199All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1317Open in IMG/M
3300028787|Ga0307323_10047370All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1512Open in IMG/M
3300028791|Ga0307290_10028688All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1967Open in IMG/M
3300028791|Ga0307290_10048351All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1532Open in IMG/M
3300028799|Ga0307284_10101277All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1077Open in IMG/M
3300028814|Ga0307302_10241681All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium884Open in IMG/M
3300028819|Ga0307296_10228569All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1011Open in IMG/M
3300028824|Ga0307310_10716223All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium514Open in IMG/M
3300028878|Ga0307278_10366202All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium635Open in IMG/M
3300028881|Ga0307277_10031412All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium2115Open in IMG/M
3300028884|Ga0307308_10027286All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium2646Open in IMG/M
3300028885|Ga0307304_10524451All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium544Open in IMG/M
3300030606|Ga0299906_11011294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria607Open in IMG/M
3300030620|Ga0302046_10393046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1139Open in IMG/M
3300031538|Ga0310888_10335655All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium872Open in IMG/M
3300031731|Ga0307405_10027936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales3279Open in IMG/M
3300031731|Ga0307405_10976066All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium721Open in IMG/M
3300031852|Ga0307410_11973228All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium520Open in IMG/M
3300031911|Ga0307412_11826279All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium559Open in IMG/M
3300031938|Ga0308175_102378125All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium594Open in IMG/M
3300031943|Ga0310885_10065662All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1556Open in IMG/M
3300032000|Ga0310903_10238430All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium870Open in IMG/M
3300034644|Ga0370548_012790All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1178Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil30.28%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.42%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil6.42%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil6.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere6.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.59%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.59%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.67%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.67%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.75%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.83%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.92%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.92%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.92%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012678Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06)EnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300034644Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1040659513300000891SoilRSPTLRSVVIYGASGLGFAGANLILARVLPTAEYALFTLVIALVNLSYPLAPAGMDGIVNRRHLEAGPSVLKRALVAGLVTSLVFLLIAGFLYRLGLPLLLIVFAATVGGGAMAVAGAQFQSEQRFGISLAITQSPNLMLMVAALVVVVTGIREAQLALGVSALGFVLAAVIGW
JGI10214J12806_1123647613300000891SoilRSPTLRSVVIYGASGLGFAGANLILARVLPTAEYALFTLVIALVNLSYPLAPAGMDGIVNRRHLEAGPSVLKRALVAGLVTSLVFLIIAGFLYRLGLPLLLIVFAATIGGGAMAVAGAQFQSEQRFGISLAITLSPNFMLMVAALVVVATGIREALLALGVSAVGFVLAAVIGWGILFHERAAKPY
F14TB_10619998923300001431SoilVKKLWYSPTLRSVVIYGASGLGFAGANLILARVLPATEYGLFTLVVALVNLSFALAPLXXDGIVNRRQLEAGPRLLKRTLTAAVLVSTAFVIIAEVGYQLSLPLLLVVFTSTFAGGAMAVAGAQFQSEQRYGISLSLTQSPNLAMLVAALAVVVTGGRGVGLPLTICTLGFG
C688J18823_1054652223300001686SoilVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRPLEAGPALLRRTLTAAIPVGLIFVIVAEMAYQMSALMLVVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAGAVILSHGRQAWLPLVIAGLGFFLAA
C688J18823_1057567413300001686SoilVRRLWYSPTLRSVVIYGASGLGFAGANLILARALPTAQYGLFTLVVALMNLSFALAPAGVDGVVNRRRLEAGPRLLKHTLTAAVLVTSGFVIIAEIGYHMSIPLLLVVFVSAVAGGAMMVAGAQFQSEQRYGISLTLTQSPNLAMLVAALIVTLSGVREVWLPLGICMLGFVLAAWVGWSIL
Ga0063455_10028257113300004153SoilVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRPLEAGPALLRRTLTAAIPVGLIFVIVAELAYQMSALMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAAAVILSRARQAWLPLVIAGLGFFLAALLGWSVLF
Ga0062590_10050346813300004157SoilLWRSPTLRSVVIYGASGLGFAGANLILARVLPTAEYALFTLVIALVNLSYPLAPAGMDGIVNRRHLEAGPSVLKRALVAGLVTSLVFLLIAGFLYRLGLPLLLIVFAATVGGGAMAVAGAQFQSEQRFGI
Ga0062595_10206911413300004479SoilGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPVGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAGAVILSQARQAWLPLVIAGLGFLLAALSGWSVLFRERAMKPAKETWFPWTEAFSFAGL
Ga0062594_10325372113300005093SoilPTLRSVVIYGASGLGFAGANLVLARLLPTGEYALFTLVIALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPLGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAGAVILSQARQAWLPLVIAGLGFLLAALS
Ga0070677_1070484213300005333Miscanthus RhizosphereVKKLWYSPTLRSVVIYGASGLGFAGANLILARVLPATEYGLFTLVVALTNLSFALAPLGVDGIVNRRQLEAGPRLLKRTLTAAALVSTAFVIIAEVGYQLSLPLLLVVFTSTFAGGAMAVAGAQFQSEQRYGISLSLTQSPN
Ga0070680_10074281323300005336Corn RhizosphereVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPVGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGL
Ga0070660_10092004813300005339Corn RhizosphereVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPVGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAGAVILSHARQAWLPLVIAG
Ga0070661_10177893713300005344Corn RhizosphereVKKLWYSPTLRSVVIYGASGLGFAGANLILARVLPATEYGLFTLVVALTNLSFALAPLGVDGIVNRRQLEAGPRLLKRTLTAAALVSTAFVIIAEVGYQLSLPLLLVVFTSTFAGGAMAVAGAQFQSEQRYGISLSLTQSP
Ga0070663_10201849113300005455Corn RhizosphereQHDGVESQRGRRVRRLENLWYSPTLRTVLVYGVAGLGFSGSNLILARVLPTAEYAVFTLVVALSNLAYSLAPAGVDGIVNRRQLDMGPQVLRRTLYPAVLVGLAFVAIAALSYDIPAPLLGVLFVSTVAGGAMAVAGAQFQSERRFGLSLALIQSPNVVMLVAALIVLLTGGK
Ga0070662_10096824823300005457Corn RhizosphereVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPVGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAGAVILSQARQAWLPLVISGLGFLLAALSGWSVLFRERAIKP
Ga0070662_10142290113300005457Corn RhizosphereVKSFWRSPTLRSVLVYGASGLGFAGANLILARFLPTTEYALFTLVIALANLGYSLAPAGVDGIVNRRHLDAGPRLLRRTLAPSLFVGVVFAIIAATAYDISPPFLGVLFVSTVAGGSM
Ga0070681_1104718223300005458Corn RhizosphereVRRLENLWYSPTLRTVLVYGVAGLGFSGSNLILARVLPTAEYAVFTLVVALSNLAYSLAPAGVDGIVNRRQLDMGPQVLRRTLYPAILVGLAFVAIAALSYDIPAPLLGVLFVSTVAGGAMAVAGAQFQSERRFGLSLALIQSPNV
Ga0068867_10172603323300005459Miscanthus RhizosphereVKSFWRSPTLRSVLVYGASGLGFAGANLILARFLPTTEYALFTLVIALANLGYSLAPAGVDGIVNRRHLDAGPRLLRRTLAPSLFVGVVFAIIAATAYDISPPFLGVLFVSTVAGGSMAVAAAQFQSERRFGISLSLSQSP
Ga0068867_10201641913300005459Miscanthus RhizosphereQWGWRVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTGEYALFTLVVALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPVGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAGAVILSHARQAWLPLVIAGLGFLLAA
Ga0070684_10084267523300005535Corn RhizosphereVKKLWYSPTLRSVVIYGASGLGFAGANLILARVLPATEYGLFTLVVALTNLSFALAPLGVDGIVNRRQLEAGPRLLKRTLTAAVLVSTAFVIIAEVGYQLSLPLLLVVFTSTFAG
Ga0075422_1021303313300006196Populus RhizosphereVKKLWYSPTLRSVVIYGASGLGFAGANLILARVLPATEYGLFTLVVALTNLSFALAPLGVDGIVNRRQLEAGPRLLKRTLTAAALVSTAFVIIAEVGYQLSLPLLLVVFTSTFAGGAMAVAGAQFQSEQRYGISLSLTQSPNLAMLVAALAVVVTGGRGVGLPLTICTLGFVLAA
Ga0105240_1270986913300009093Corn RhizosphereVKSFWRSHTLRSVLVYGASGLGFAGANLILARFLPTTEYALFTLVIALANLGYSLAPAGVDGIVNRRHLDAGPRLLRRTLAPSLFVGVVFAIIAATAYDISPPFLGVLFVSTVAGGSMAVAAAQFQSERRFGISLSLSQSPNLFLLL
Ga0111539_1128975623300009094Populus RhizosphereVKKLWYSPTLRSALVYGASGLGFAGANLILARVLPTGEYGLFTLVIALVNLSFALAPLGVDGMVNRRHMDAGPRLLRRTLLAGLIVGAAFVVIAEVAYDMSIPLVLVVFVSTIAGGSMAVAGAQFQSEQRYGISLTL
Ga0114129_1249803213300009147Populus RhizosphereVKKLWYSPTLRSVVVYGASGLGFAGANLILARVLPTAEYGLFTLVIALINLSFALAPAGVDGMVNRHRLDAGPRLLRRTLEAGLIVGVGFVLIAEIGYHMSVPLILVVFLSTLAGGAMLVAGAQFQSEQRYGISLSLSQSPNLFLILAA
Ga0105238_1305811913300009551Corn RhizospherePAGVDGIVNRRQLEAGPALLRRTLTAAIPVGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAGAVILSHARQAWLPLVIAGLGFLLAALSGWSVLFRERAMKPARETGFPWTEAFSFAGLNAAGLVLIQLERLVI
Ga0126307_1121868113300009789Serpentine SoilVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRHLEAGPALLRRTLTAAIPLGLIFVLIAELAYQMSALMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAGAVILSHGQQAWMPLVIAGLGFLLAAVLGWSV
Ga0126304_1091184013300010037Serpentine SoilRGERVRKLWYSPTLRSAVVYGASGLGFAGANLILARVLANEEYGLFTLVIALVNLSFALAPLGVDGMVNRRHMDAGPRLLRRTLSAGLIVGTAFVIIAEVAYDMSIPLVLVVFVSTVAGGLMAVAGAQFQSEQRYGISLALTQSPNLALLIAAGAVLASGTRRVGLPLAICAFGFVLAALVGWWVLFRERPMKAGGES
Ga0126309_1007483313300010039Serpentine SoilVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRHLEAGPALLRRTLTASVPIGLIFAIVAELAYQMSPLMLLVLLVSTTAGGAMAVAAAQFQSERRYAISLALSQSPNLVLL
Ga0126309_1073474213300010039Serpentine SoilMVYGASGLGFAGANLVLARLLPTTEYALFTLVVALASLGYSLAPGGVDGIVNRRHLEAGPRLLRRTLSASLLVGLVFVLIGRVSYDMSPAMLLILFVSTIAGGAMAVAGAQFQSERRFGISLALTQSPNLVLIVAALAVIATGIREALLPLVISAVGFVLAAGYGWSVLFRERARK
Ga0126308_1084976713300010040Serpentine SoilVYGASGLGFAGANLVLARFLPTAEYAVFTLVIALANLGYALAPVGVDGIVNRRHLDAGPRLLRRTMGASVLVGIAFVIAAQLGYHLSPPMVVILFVSTVAGGAMAVAGAQFQSERRFGISLALTQSPNLALLVAAMVVVVSHDHGAWLPLAISMLGFVLAAVYGWWVLF
Ga0126312_1102586113300010041Serpentine SoilMGVYGASGVGFAAANLILARFLPTAQYAVFTLVTALANLGYALAPSGVDGIVNRRHLDAGPRLLRRTLSASLLVGGAFVIAAQLGYHLSGWMVLILLVSTVAGGAMAVAGAQFQSERRY
Ga0126310_1064314213300010044Serpentine SoilVVIYGASGLGFAGANLILARALPMAQYGLFTLVVALVNLSFALAPAGVDGVVNRRRLEAGPRLLKRTLTAAVLVSTGFVIIAEIGYHMSIPLLLVVFVSAVAGGAMAVAGAQFQSEQRYGISLALTQSPNLAMLVAALIVVVSGVRGVWLP
Ga0134125_1233446613300010371Terrestrial SoilVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRHLEAGPALLRRTLTAAIPVGLIFVLVAELAYQMSPLMLLVLFVSTVAGGAMA
Ga0134125_1306509213300010371Terrestrial SoilGEYALFTLVIALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPLGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAGAVILSHARQAWLPLVIAGLVFLLAALSGWIVLFRERAMKPARETWFPWTEAFSF
Ga0105239_1342379413300010375Corn RhizosphereVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPVGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAIS
Ga0134124_1152552413300010397Terrestrial SoilVKKLWYSPTLRSVVIYGASGLGFAGANLILARVLPATEYGLFTLVVALTNLSFALAPLGVDGIVNRRQLEAGPRLLKRTLTAAALVSTAFVIIAEVGYQLSLPLLLVVFTSTFAGGAMAVAGAQFQSEQRYGISLSLTQSPNLAMLVAALAVVVTGGRGVGLPLTICTLGFVVAALFGW
Ga0134127_1304472513300010399Terrestrial SoilVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPVGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSER
Ga0134122_1180321013300010400Terrestrial SoilVKKLWYSPTLRSVVIYGASGLGFAGANLILARVLPATEYGLFTLVVALTNLSFALAPLGVDGIVNRRQLEAGPRLLKRTLTAAALVSTAFVIIAEVGYQLSLPLLLVVFTSTFAGGAMAVAGAQFQSEQRYGISLSLTQSPNLAMLVAALAVVVTGGRGVGLPLTICT
Ga0134121_1096617313300010401Terrestrial SoilVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPVGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAGAVILSQARQAWL
Ga0134123_1107944213300010403Terrestrial SoilVKSLWRSPTLRSVVIYGASGLGFAGANLILARVLPTAEYALFTLVIALVNLSYPLAPAGMDGIVNRRHLEAGPSVLKRALVAGLVTSLVFLIIAGFLYRLGLPLLLIVFAATIGGGAMAVAGAQFQSEQRFGISLAITLSPNFMLMVAALVVVATGIREALLALGVSAVGFVLAAVIGWG
Ga0150985_11475225333300012212Avena Fatua RhizosphereVVIYGASGLGFAGANLILARALPTAQYGLFTLVVALMNLSFALAPAGVDGVVNRRRLEAGPRLLKHTLTAAVLVTSGFVIIAEIGYHMSIPLLLVVFVSAVAGGAMMVAGAQFQSEQRYGISLTLTQSPNL
Ga0150985_12192099823300012212Avena Fatua RhizosphereVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRPLEAGPALLRRTLTAAIPVGLIFVIVAELAYQMSALMLLVLFVSTVAGGAMAVSAAQFQSERRYGISLGLSQSPNLVLLVAAAAVILS
Ga0150984_12178524913300012469Avena Fatua RhizosphereVVYGASGVGFSGANLILARVLPTAEYGLFTLAIAIINLAYSLAPAGVDGIVNRHRVDTGPYLLRRTISASLLVAAAFVVIARVSYHMPLSILVMLMISTVAGGVMTVAAAQFQSERRYGISLSVFQSPNL
Ga0136615_1035401913300012678Polar Desert SandVKKLLLSPMLRSVIIYGASGLGFAGANLILARVLPTTEYGLFTLVIALTNLSFAMAPIGVDGVVNRRHLEAGPDLLKRTLAAGFLTSLFALTIAGFAYEIGTTLLLFVFVTTVGGGAMLVAAAQFQSEQRYGISLALTQSPNVVLIVAALV
Ga0157300_111730423300012884SoilVKKLWYSPTLRSALVYGASGLGFAGANLILARVLPTGEYGLFTLVIALVNLSFALAPLGVDGMVNRRHMDAGPRLLRRTLLAGLIVGAAFVVIAEVAYDMSIPLVLVVFVSTIAGGSM
Ga0157285_1003444713300012897SoilVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTGEYALFTLVIALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPLGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAGAVILSHARQAWLPLVIAGLGFLLAALSGWSVLFRERAMKPAKETWFPWTEAFSFAGLNAAG
Ga0157308_1002777013300012910SoilVKKLWYSPTLRSALVYGASGLGFAGANLILARVLPTGEYGLFTLVIALVNLSFALAPLGVDGMVNRRHMDAGPRLLRRTLLAGLIVGAAFVVIAEVAYDMSIPLVLVVFVSTIAGGSMAVAGAQFQSEQRYGISLTLTQSPNL
Ga0162653_10000027333300012937SoilVRKLWYSPTLRSVVIYGASGLGFAGANLILARVLATAEYGLFTLVIALVNLSFALAPLGVDGIVNRRRMDTGFPLLKHALTAALSVGAAFVVIAAVGYHMSMPLVLVVFVSTVAGGIMAVAGAQFQSEQRYGISLMLTQSPNLTLIIAAAAVVASGTREVGLPR
Ga0164300_1113907313300012951SoilHHDGIQGQWGGRVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRHLEAGPALLRRTLTAAIPVGLIFVLVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAGAVILLHAR
Ga0164303_1001604613300012957SoilVYGAAGLGFSGANLIMAQVLPTAEYGVFTLVIALSNLGSTLAPAGVDGIVQRRSLDAGPELLRRTMAASVAVGVVFTIVAGLAYTITLPMVAIVLTSTIAGGAMVVAGAQFQSERRFGLSLMLTQSPNLVLLIAG
Ga0164299_1121303813300012958SoilSVVIYGASGLGFAGANLILARVLPATEYGLFTLVVALTNLSFALAPLGVDGIVKHHQLEAGPRLLKRTLTAADLVSTAFVIIAEVGYQLSLPLLLVVFTSTFAGGAMAVAGAQFQSEQRYGISLSLTQSPNLAMLVAALAVVVTGGRGVGLPLTICTLGFVLAALFGWSVLFRERRTKPATESSFPWGEA
Ga0164299_1141540913300012958SoilVYGAAGLGFSGANLIMAQVLPTAEYGVFTLVIALSNLGSTLAPAGVDGIVQRRSLDAGPELLRRTMAASVAVGVVFTIVAGLAYSITLPMVAIVLTSTIAGGAMVVAGAQFQSERRFGLSLMLTQSPNLVLLIAGLVVLA
Ga0157378_1270440113300013297Miscanthus RhizosphereQWGWRVKKLWYSPTLRSVVIYGASGLGFAGANLILARVLPATEYGLFTLVVALTNLSFALAPLGVDGIVNRRQLEAGPRLLKRTLTAAALVSTAFVIIAEVRYQLSLPLLLVVFTSTFAGGAMAVAGAQFQSEQRYGISLSLTQSPNLAMLVAALAVVVTGGRGVGLPLTICTLGFVVAALF
Ga0137403_1089312513300015264Vadose Zone SoilVTKLWHSPTLRSVVVYGASGLGFAGANLMLARFLPTEEYGLFTLVIALANLGYSLAPAGVDGIVQRRHLDAGPVLLRRTMTASFLVGLAFVLIAETGYQMSMPMLLVLFVSTVAGGAMAVAGAQFQSERRYGISLALTQSPNLALLVAAVVV
Ga0132255_10393375013300015374Arabidopsis RhizosphereVKKLWYSPTLRSVVIYGASGLGFAGANLILARVLPATEYGLFTLVVALTNLSFALAPLGVDGIVNRRQLEAGPRLLKRTLTAAALVSTAFVIIAEVGYQLSLPLLLVVFTSPFAGGAMAV
Ga0184604_1000510833300018000Groundwater SedimentVTSLWHSPTLRSVVIYGSSGLGFAGANLILARVLPTTEYALFTLVIALVNLSFALAPGGVDGMVNRRQLEAGPSLLKRTLGAGLVTGLIFLLIAGPVYHLSVPLLLVVFAATVGGGAMAVAGAQFQSEQRFGISLALTQSPNLTLMLAALVVVVTGTREAQ
Ga0184620_1016081213300018051Groundwater SedimentVRSLWHSPTLRSVVIYGASGLGFAGANLILARVLPTTEYALFTLVIALVNLSFALAPGGVDGMVNRRQLEAGPSLLKRTLGAGLVTGLIFLLIAGPVYHLSVPLLLVVFAATVGGGAMAVAGAQFQSEQRFGISLALTQSPNLTLMLAALVVVVTGARAAQLPLAISALGFVLAGAIGWWVLFRER
Ga0184621_1005026923300018054Groundwater SedimentVTSLWHSPTLRSVVIYGASGLGFAGANLILARVLPTTEYALFTLVIALVNLSFALAPGGVDGMVNRRQLEAGPSLLKRTLGAGLVTGLIFLLIAGPVYHLSVPLLLVVFAATVGGGAMAVAGAQFQSEQRFGISL
Ga0184619_1034044513300018061Groundwater SedimentMRELWRSPTLRTVVVYGTSGLGFAGANLVLARFLPTAEYAVFTLVIALANLGYSLAPAGVDGIVNRRHLDAGPRLLRRTLAASLLVGVAFMIAAQLGYSLSTVMALILFVSTVAGGAMQVAGAQFQSE
Ga0184617_101322413300018066Groundwater SedimentVAELLSERVHIMRQLWRSPTLRTVAVYGASGVGFAGANLLLARFLPTAEYAVFTLVIALANLGYSLAPAGVDGIVNRRHLDAGPRLLRRTLGASLLVGVPFVIAAQLSYHVSALMVLILFVSTVA
Ga0184618_1022210313300018071Groundwater SedimentVAELLSERVHIMRQLWRSPTLRTVAVYGASGVGFAGANLLLARFLPTAEYAVFTLVIALISLGYSLAPAGVDGIVNRRHLDAGPTLLRRTLGASLLVGVAFVIAAQLGYRLSAPMALILFVSTVAGGAMAVAGAQFQSERRYGISLALTQSPNLALLIAALAVIASHDQRAWLPLSISMLGFVLAAVYGWWVLFRERATKPVRGSWFP
Ga0184609_1056542813300018076Groundwater SedimentVTSLWHSPTLRSVVIYGASGLGFAGANLILARVLPTTEYALFTLVIALVNLSFALAPGGVDGMVNRRPLEAGPSLLKRTLAAGLVTGLIFLFIAGSVYHLSVPLLLVVFAATVGGGAMAVAGAQFQSEQ
Ga0190265_1241593413300018422SoilKSVKSSWHSPTLRSLVIYGASGLGFAGANLILARVLPTAEYALFTLVLALVNLSFPLAPAGMDGIVNRRHLEAGPSVLKRTLGAGLVTGVIFMLIAGLLYRLGLPMLLIVFAATVGGGAMAVAGAQFQSEQRFGISLALTQSPNLMLMVAALVVVATGIREAQLALSISALGFVLAGIIGWSVLFRERSAKPYRETWFPWGEALSFAG
Ga0173481_1038755323300019356SoilVKKLWYSPTLRSAVVYGASGLGFAGANLILARVLPTGEYGLFTLVIALVNLSFALAPLGVDGMVNRRHMDAGPRLLRRTLLAGLIVGAAFVVIAEVAYDMSIPLVLVVFVSTIAGGSM
Ga0193715_102034223300019878SoilVAELLSERVRIMRQLWRSPTLRTVAVYGASGVGFAGANLLLARFLPTAEYAVFTLVIALISLGYSLAPAGVDGIVNRRHLDAGPALLRRTLGASLLVGVAFVIAARLGYRLSAPMVLILFVSTVAGGAMAVAGAQFQSERRYGISLALTQSPNLALLIAALAVIASHDRRAWLPLSISMLGFLLAAIYG
Ga0193713_106775013300019882SoilVAELLSERVRIMRQLWRSPTLRTVAVYGASGVGFAGANLLLARFLPTAEYAVFTLVIALISLGYSLAPAGVDGIVNRRHLDAGPALLRRTLGASLLVGVAFMIAAQLGYRLSAPMVLILFVSTVAGGAMAVAGAQFQSERRYGISLALTQSPNLALLIAALAVIAS
Ga0210378_1013043813300021073Groundwater SedimentVRRLWHSPTLRSVVIYGASGLGFAGANLILARVLPTAEYALFTLVIALVNLSFALAPGGVDGIVNRRHLEAGPGVLKRTLAGGLVTGLIFMLIAGLVYHLRMPMLLVIFAATVGGGA
Ga0210381_1037419023300021078Groundwater SedimentVAELLSERVRIMRQLWRSPTLRTVAVYGASGVGFAGANLLLARFLPTAEYAVFTLVIALISLGYSLAPAGVDGIVNRRHLDAGPALLRRTLGASLLVGVAFVIAARLGYRLSAPMVLILFVSTVAGGAMAVAGA
Ga0210382_1021379313300021080Groundwater SedimentMRQLWRSPTLRTVVVYGTSGLGFAGANLVLARFLPTAEYAAFTLVIALANLGYSLAPAGVDGIVNRRHLDAGPRLLRRTLGASLLVGVAFVIAAQLGYDIGAGMALILFVSTVAGGAMAVAGAQFQSERRY
Ga0193750_104285223300021413SoilMRQLWRSPTLRTVVVYGTSGLGFAGANLVLARFLPTAEYAVFTLVIALANLGYSLAPAGVDGIVNRRHLDAGPRLLRRTLGASLLVGVAFVIAAQLGYDISAGMALILFVSTVAGGAMAVAGAQFQSERRYGISLALTQSPNLALLVAALAVVASHNRRAWLPLSISMLGF
Ga0193695_100506513300021418SoilMRQLWRSPTLRTVAVYGASGVGFAGANLLLARFLPTAEYAVFTLVIALISLGYSLAPAGVDGIVNRRHLDAGPALLRRTLGASLLVGVAFMIAAQLGYRLSAPMVLILFVSTVAGGAMAVAGAQFQSERRYGISLALTQSPNLALLIAAL
Ga0222623_1009137513300022694Groundwater SedimentVTSLWHSPTLRSVVIYGASGLGFAGANLILARVLPTTEYALFTLVIALVNLSFALAPGGVDGMVNRRHLEAGPSLLKRTLGAGLVTGLIFLLIAGPVYHLSVPLLLVVFAATVGGGAMAVAGAQFQSEQRFGISLALTQSPNLTLMLAALVVVVTGTREAQLPLAISALGFVLAGAIG
Ga0222623_1012837023300022694Groundwater SedimentVAELLSERVRIMRQLWRSPTLRTVAVYGASGVGFAGANLLLARFLPTAEYAVFTLVIALISLGYSLAPAGVDGIVNRRHLDAGPALLRRTLGASLLVGVAFVIAARLGYRLSAPMVLILFVSTVAGGAMAVAGAQFQSERRYGISLALTQS
Ga0207660_1082254513300025917Corn RhizosphereVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPVGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAG
Ga0207706_1018704933300025933Corn RhizosphereVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPVGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAGAVILSQARQAWLPLV
Ga0207709_1046560613300025935Miscanthus RhizosphereVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTAEYALFTLVIALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPVGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAA
Ga0207661_1191767213300025944Corn RhizosphereYGASGLGFAGANLILARVLPTGEYGLFTLVIALVNLSFALAPLGVDGMVNRRHMDAGPRLLRRTLTAGLIVGTAFVVIAEVAYDMSIPLMLVVFVSTVAGGSMAVAGAQFQSEQRYGISLALTQSPNLALLIAAGAVLASDTRRVGLPLAICALGFLVAALVGWWVLFRERPMKAAVE
Ga0207639_1073400723300026041Corn RhizosphereVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTGEYALFTLVIALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPVGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAGAVILSQARQAWLPLVIAGLGFLLAALSGWSVLFRERAVKPARETWFPWTEAFSFAGLNA
Ga0207678_1037081813300026067Corn RhizosphereVKKLWYSPTLRSVVIYGASGLGFAGANLILARVLPATEYGLFTLVVALTNLSFALAPLGVDGIVNRRQLEAGPRLLKRTLTAAALVSTAFVIIAEVGYQLSLPLLLVVFTSTFAGGAMAVAGAQFQSEQRYGISL
Ga0209974_1000689013300027876Arabidopsis Thaliana RhizosphereVKKLWYSPTLRSVVIYGASGLGFAGANLVLARLLPTGEYALFTLVIALANLGYSLAPAGVDGIVNRRQLEAGPALLRRTLTAAIPLGLIFVVVAELAYQMSPLMLLVLFVSTVAGGAMAVSAAQFQSERRYAISLGLSQSPNLVLLVAAGAVILSQ
Ga0307295_1014986213300028708SoilVAELLSERVRIMRQLWRSPTLRTVAVYGASGVGFAGANLLLARFLPTAEYAVFTLVIALISLGYSLAPAGVDGIVNRRHLDAGPALLRRTLGASLLVGVAFVIAARLGYRLSAPMVLILFVSTVAGGAMAVAGAQFQSERRYGISLALTQSPNLALLIAALAVIASHDRRAWLPLSISM
Ga0307293_1017882613300028711SoilMRQLWHSPTLRTVVVYGASGVGFAGANLLLARFLPTAEYAVFTLVIALANLGYSLAPAGVDGIVNRRHLDAGPRLLRRTLSASVLVGVAFVIAAQLGYDISTGMVLILFVSTVAGGAMAVAGAQF
Ga0307293_1018177413300028711SoilVAELLSERVRIMRQLWRSPTLRTVAVYGASGVGFAGANLLLARFLPTAEYAVFTLVIALISLGYSLAPAGVDGIVNRRHLDAGPALLRRTLGASLLVGVAFVIAARLGYRLSAPMVLILFVSTVAGGAMAVAGAQFQSERRYGISLALTQSPNLALLIA
Ga0307311_1017038023300028716SoilVTSLWHSPTLRSVVIYGASGLGFAGANLILARVLPTTEYALFTLVIALVNLSFALAPGGVDGMVNRRQLEAGPSLLKRTLGAGLVTGLIFLLIAGPVYHLSVPLLLVVFAATVGGGAMAVAGAQFQSEQRFGISLALTQSPNLTLMLAAL
Ga0307317_1004713013300028720SoilVAELLSERVRIMRQLWRSPTLRTVAVYGASGVGFAGANLLLARFLPTAEYAVFTLVIALISLGYSLAPAGVDGIVNRRHLDAGPALLRRTLGASLLVGVAFVIAARLGYRLSAPMVLILFVSTVAGGAMAVAGAQFQSERRYGISLALTQSPNLALLIAALAVIASHDRRAWLPLSIS
Ga0307316_1005719923300028755SoilVAELLSERVRIMRQLWRSPTLRTVAVYGASGVGFAGANLLLARFLPTAEYAVFTLVIALISLGYSLAPAGVDGIVNRRHLDAGPALLRRTLGASLLVGVAFVIAARLGYRLSAPMVLILFVSTVAGGAMAVA
Ga0307323_1004737023300028787SoilVAELLSERVRIMRQLWRSPTLRTVAVYGASGVGFAGANLLLARFLPTAEYAVFTLVIALISLGYSLAPAGVDGIVNRRHLDAGPALLRRTLGASLLVGVAFVIAARLGYRLSAPMVLILFVSTVAGGAMAVAGAQFQSERRFGISLALTQSPNLALLIAALVVIVS
Ga0307290_1002868813300028791SoilVAELLSERVRIMRQLWRSPTLRTVAVYGASGVGFAGANLLLARFLPTAEYAVFTLVIALISLGYSLAPAGVDGIVNRRHLDAGPALLRRTLGASLLVGVAFVIAARLGYRLSAPMVLILFVSTVAGGAMAVAGAQFQSERRFGISLALTQSPNLALLIAALVVIVSNDRRAWLPLSISMLGFLLAAIYGWGVLFRERATKPVRGSWFP
Ga0307290_1004835113300028791SoilVTSLWHSPTLRSVVIYGASGLGFAGANLILARVLPTTEYALFTLVIALVNLSFALAPGGVDGMVNRRQLEAGPSLLKRTLGAGLVTGLIFLLIAGPVYHLSVPLLLVVFAATVGG
Ga0307284_1010127713300028799SoilVRQLWRSPTLRTVVVYGASGLGFAGANLLLARFLPTAEYAVFTLVIALISLGYALAPAGVDGIVNRRHLDAGPALLRRTLGASLLVGVAFVIAARLGYDINTGMALILFVSTVAGGAMAVAGAQFQSERRFGISLALTQSPNLALLIAALVVIASSDRRAWLPL
Ga0307302_1024168123300028814SoilVTSLWHSPTLRSVVIYGSSGLGFAGANLILARVLPTTEYALFTLVIALVNLSFALAPGGVDGMVNRRQLEAGPSLLKRTLGAGLVTGLIFLLIAGPVYHLSVPLLLVVFAATVGGGAMAVAGAQFQSEQRFGISLALTQSPNLTLMLAALVVVVTGAREA
Ga0307296_1022856913300028819SoilMRQLWHSPTLRTVVVYGASGVGFAGANLLLARFLPTAEYAVFTLVIALANLGYSLAPAGVDGIVNRRHLDAGPRLLRRTLSASVLVGVAFVIAAQLGYDISTGMVLILFVSTVAGGAMAVAGAQFQSERRYGISLALTQSPNLALLIA
Ga0307310_1071622313300028824SoilVTGSPPEDRSPQPPLVLHRDGIESHRDESVTSLWHSPTLRSVVIYGSSGLGFAGANLILARVLPTTEYALFTLVIALVNLSFALAPGGVDGMVNRRQLEAGPSLLKRTLGAGLVTGLIFLLIAGPVYHLSVPLLLVVFAATVGGGAMAVAGAQFQSEQRFGISLALTQSPN
Ga0307278_1036620223300028878SoilVTSLWHSPTLRSVVIYGASGLGFAGANLILARVLPTTEYALFTLVIALVNLSFALAPGGVDGMVNRRHLEAGPSLLKRTLGAGLVTGLIFLLIAGPVYHLSVPLLLVVFAATVGGGAMAVAGAQFQ
Ga0307277_1003141233300028881SoilVAELLSERVRIMRQLWRSPTLRTVAVYGASGVGFAGANLLLARFLPTAEYAVFTLVIALISLGYSLAPAGVDGIVNRRHLDAGPALLRRTLGASLLVGVAFVIAARLGYRLSAPMVLILFVSTVAGGAMAVAGAQFQSERRYGISLALTQSPNLALLIAALAVIASHDRRAWLPLS
Ga0307308_1002728613300028884SoilVRQLWRSPTLRTVVVYGASGLGFAGANLLLARFLPTAEYAVFTLVIALISLGYALAPAGVDGIVNRRHLDAGPALLRRTLGASLLVGVAFVIAARLGYDINTGMALILFVSTVAGGAMAVAGAQFQSERRFGISLALTQSPNLALLIAALVVIASND
Ga0307304_1052445123300028885SoilVRQLWRSPTLRTVVVYGASGLGFAGANLLLARFLPTAEYAVFTLVIALISLGYALAPAGVDGIVNRRHLDAGPALLRRTLGASLLVGVAFVIAAQLGYDINTGMALILFVSTVAGGAMAVAGAQFQSERRFGISLALTQSPNLALLI
Ga0299906_1101129423300030606SoilLKSLWYSPTLRGALVYGASGLGFAGANLILARVLPTSEYAVFTLVIALVNLAFALAPLGIDGMVNRRHLEAGPQLLKRTLVGGLATGLVFIAIGAFAYDLDTALLFLIFVSTVAGGAMS
Ga0302046_1039304623300030620SoilLKSLWYSPTLRGALVYGASGLGFAGANLILARVLPTSEYAVFTLVIALVNLAFALAPLGIDGMVNRRHLEAGPQLLKRTLVGGLATGLVFIAIGAFAYDLDTALLFLIFVSTVAGGAMSVAGSQFQSEQRYGISLALTQSPNLALLAAALAAVVAREKTAGIPLLIGSAGFLLAGSYG
Ga0310888_1033565523300031538SoilVKKLWYSPTLRSVVIYGASGLGFAGANLILARVLPATEYGLFTLVVALTNLSFALAPLGVDGIVNRRQLEAGPRLLKRTLTAAALVSTAFVIIAEVGYQLSLPLLLVVFTSTFAGGAMAVAGAQFQSEQRYGISLSLTQSPNLAMLVAALAVVVTGGRGVGLPLTICTLGFVVAALFGWSVLFRERRTKPATESSFPWGEAL
Ga0310887_1107272713300031547SoilLVVALTNLSFALAPLGVDGIVNRRQLEAGPRLLKRTLTAAALVSTAFVIIAEVGYQVSLPLLLVVFTSTFAGGAMAVAGAQFQSEQRYGISLSLTQSPNLAMLVAALAVVVTGGRGVGLPLTICTLGFVVAALFGWSVLFRERRTKPATESSFPWGEALSYAGLNAAGLVL
Ga0307405_1002793633300031731RhizosphereVRKLWYSPTLRSVGIYGASGLGFAGANLVLARLLPTTEYGLFTLVIALANLGYSLAPVGIDGVVNRRHLEAGPALLRRSLTAAVLVGLLFVVVAELAYQMSSMTLLVLFVCTVAGGAMTVAGAQFQSERRYAISLALTQSPNLVLLVAAGAVIA
Ga0307405_1097606613300031731RhizosphereVKKLWYSPTLRSVFVYGVSGLGFAGANLMLARLLPTTEYALFTLVLALANLGYSLAPAGVDGIVNRRLLDAGPRLLRRTLFASLPVGVIFVLVARIAYHMSPLMLVVLFVSTVAGGAMAVAGAHFQSERRFGISLALTQSPNLVLLVAALAVVVSKDRKAWLPLIISAL
Ga0307410_1197322813300031852RhizosphereVRKLWYSPTLRSVVIYGASGLGFAGANLMLARLLPTVEYGLFTLVIALANLGYSLAPAGVDGIVNRRHLEAGPALLRRTLTASVPVGLIFVAVAELAYQMSPLMLLVLFVSTVAGGAMAVAAAQFQ
Ga0307412_1182627913300031911RhizosphereVKKLWYSPTLRSVFVYGVSGLGFAGANLMLARLLPTTEYALFTLVLALANLGYSLAPAGVDGIVNRRLLDAGPRLLRRTLFASLPVGVIFVLVARIAYHMSPLMLVVLFVSTVAGGAMAVAGAHFQSER
Ga0308175_10237812513300031938SoilVIKLKKLCHSPTLRSAVVYGASGLGFSGSNLILARVLPTDEYALFTLAIALVNLAFALAPLGVDGIVNRRQLDAGPALLRRTVSASVVVALIFVIIAEVAYHMNPTVLLLIFVSTVGGGAMAVAGAQFQAEQRFGISLALTQSPNLTLLVAALAVLLFKDREAWLPLTISAIGFVISALYGW
Ga0310885_1006566223300031943SoilVKKLWYSPTLRSVVIYGASGLGFAGANLILARVLPATEYGLFTLVVALTNLSFALAPLGVDGIVNRRQLEAGPRLLKRTLTAAALVSTAFVIIAEVGYQLSLPLLLVVFTSTFAGGAMAVAGAQFQSEQRYGISLSLTQSPNLAMLVAALAVVVTGGRGVGLPLTICTLGFVVAALFGWSVLFRERRTKPATESSFPWG
Ga0310903_1023843013300032000SoilVKKLWYSPTLRSVVIYGASGLGFAGANLILARVLPATEYGLFTLVVALTNLSFALAPLGVDGIVNRRQLEAGPRLLKRTLTAAASVSTAFVIIAEVGYQLSLPLLLVVFTSTFAGGAMAVAGAQFQSEQRYGISLSLTQSPNLAMLVAALAV
Ga0370548_012790_3_6083300034644SoilVGFAGANLLLARFLPTAEYAVFTLVIALISLGYSLAPAGVDGIVNRRHLDAGPALLRRTLGASLLVGVAFVIAARLGYRLSAPMVLILFVSTVAGGAMAVAGAQFQSERRYGISLALTQSPNLALLIAALAVIASHDRRAWLPLSISMLGFLLAAIYGWGVLFRERATKPVRGSWFPWGEALSFAGLNGAGLFLIQLERLVI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.