NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089151

Metagenome / Metatranscriptome Family F089151

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089151
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 107 residues
Representative Sequence MDNFDLKKYLAEGKLYEQKSPKFKIGDFVQPKSRDKYVGQIEDVYINKPENLEIKDGEYVYSVDKLNHRGRNAMSFDFKESDLESISDPTEYIKSLTPYKRRN
Number of Associated Samples 91
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 3.67 %
% of genes near scaffold ends (potentially truncated) 33.94 %
% of genes from short scaffolds (< 2000 bps) 76.15 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (44.954 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(24.771 % of family members)
Environment Ontology (ENVO) Unclassified
(75.229 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.991 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.03%    β-sheet: 19.85%    Coil/Unstructured: 64.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF07992Pyr_redox_2 1.83
PF03420Peptidase_S77 1.83
PF02562PhoH 0.92
PF13521AAA_28 0.92
PF01467CTP_transf_like 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG1702Phosphate starvation-inducible protein PhoH, predicted ATPaseSignal transduction mechanisms [T] 0.92
COG1875Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domainsGeneral function prediction only [R] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms55.05 %
UnclassifiedrootN/A44.95 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10039877All Organisms → cellular organisms → Bacteria2125Open in IMG/M
3300000128|SA_S1_NOR08_45mDRAFT_c10052550All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1489Open in IMG/M
3300000174|SI60aug11_200mDRAFT_c1033465All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium933Open in IMG/M
3300000188|SI60aug11_150mDRAFT_c1005041All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium2486Open in IMG/M
3300000929|NpDRAFT_10001588Not Available10607Open in IMG/M
3300001450|JGI24006J15134_10147209Not Available776Open in IMG/M
3300001460|JGI24003J15210_10021950All Organisms → Viruses → Predicted Viral2418Open in IMG/M
3300001460|JGI24003J15210_10153207Not Available587Open in IMG/M
3300001472|JGI24004J15324_10037460All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1523Open in IMG/M
3300001472|JGI24004J15324_10052998All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1199Open in IMG/M
3300001589|JGI24005J15628_10085104All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1101Open in IMG/M
3300001589|JGI24005J15628_10174734Not Available626Open in IMG/M
3300003264|JGI26119J46589_1001470Not Available3545Open in IMG/M
3300006193|Ga0075445_10053194Not Available1601Open in IMG/M
3300006401|Ga0075506_1808965All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1310Open in IMG/M
3300006484|Ga0070744_10130474Not Available723Open in IMG/M
3300006484|Ga0070744_10236314All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium518Open in IMG/M
3300006735|Ga0098038_1056307All Organisms → Viruses1411Open in IMG/M
3300006736|Ga0098033_1009134All Organisms → Viruses → Predicted Viral3236Open in IMG/M
3300006749|Ga0098042_1055838Not Available1061Open in IMG/M
3300006753|Ga0098039_1011683All Organisms → Viruses → Predicted Viral3203Open in IMG/M
3300006802|Ga0070749_10407879All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium749Open in IMG/M
3300006919|Ga0070746_10262725All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300007344|Ga0070745_1011675Not Available4147Open in IMG/M
3300007345|Ga0070752_1175529All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon867Open in IMG/M
3300007538|Ga0099851_1005925Not Available5120Open in IMG/M
3300007540|Ga0099847_1078040Not Available1021Open in IMG/M
3300007542|Ga0099846_1106220All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1031Open in IMG/M
3300007555|Ga0102817_1104624Not Available623Open in IMG/M
3300007647|Ga0102855_1205608Not Available525Open in IMG/M
3300007862|Ga0105737_1068440Not Available874Open in IMG/M
3300007992|Ga0105748_10288293Not Available695Open in IMG/M
3300008050|Ga0098052_1116280All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300008470|Ga0115371_10159348All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300008470|Ga0115371_10712005All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300008470|Ga0115371_11088389All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300008470|Ga0115371_11246317Not Available518Open in IMG/M
3300008993|Ga0104258_1097222Not Available551Open in IMG/M
3300009026|Ga0102829_1318564Not Available520Open in IMG/M
3300009059|Ga0102830_1162996Not Available654Open in IMG/M
3300009149|Ga0114918_10406108Not Available742Open in IMG/M
3300009428|Ga0114915_1079968Not Available1000Open in IMG/M
3300009441|Ga0115007_10298723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp.1045Open in IMG/M
3300009606|Ga0115102_10663301All Organisms → Viruses → Predicted Viral1785Open in IMG/M
3300009677|Ga0115104_10689358All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300010148|Ga0098043_1063079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum1117Open in IMG/M
3300010148|Ga0098043_1183303All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium584Open in IMG/M
3300010155|Ga0098047_10011869All Organisms → Viruses → Predicted Viral3545Open in IMG/M
3300012345|Ga0157139_1000534All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1549Open in IMG/M
3300012969|Ga0129332_1435727All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1053Open in IMG/M
3300017708|Ga0181369_1049284Not Available946Open in IMG/M
3300017713|Ga0181391_1079849All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium749Open in IMG/M
3300017714|Ga0181412_1002926All Organisms → cellular organisms → Bacteria6059Open in IMG/M
3300017719|Ga0181390_1175463Not Available526Open in IMG/M
3300017721|Ga0181373_1066322Not Available646Open in IMG/M
3300017724|Ga0181388_1081618Not Available771Open in IMG/M
3300017735|Ga0181431_1009140Not Available2394Open in IMG/M
3300017741|Ga0181421_1035312All Organisms → Viruses → Predicted Viral1346Open in IMG/M
3300017742|Ga0181399_1071404Not Available882Open in IMG/M
3300017751|Ga0187219_1212445Not Available531Open in IMG/M
3300017752|Ga0181400_1007689All Organisms → cellular organisms → Bacteria3860Open in IMG/M
3300017752|Ga0181400_1162979All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage628Open in IMG/M
3300017753|Ga0181407_1008925All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium2887Open in IMG/M
3300017753|Ga0181407_1047852Not Available1122Open in IMG/M
3300017755|Ga0181411_1134716Not Available717Open in IMG/M
3300017758|Ga0181409_1141579All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium705Open in IMG/M
3300017760|Ga0181408_1196320Not Available513Open in IMG/M
3300017762|Ga0181422_1090346Not Available962Open in IMG/M
3300017762|Ga0181422_1237786Not Available541Open in IMG/M
3300017763|Ga0181410_1020070All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2210Open in IMG/M
3300017763|Ga0181410_1143163Not Available674Open in IMG/M
3300017772|Ga0181430_1061970All Organisms → Viruses → Predicted Viral1146Open in IMG/M
3300017786|Ga0181424_10184160All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium888Open in IMG/M
3300017950|Ga0181607_10729152Not Available513Open in IMG/M
3300018048|Ga0181606_10380112Not Available759Open in IMG/M
3300018603|Ga0192881_1001308All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1900Open in IMG/M
3300019009|Ga0192880_10040609All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1147Open in IMG/M
3300020185|Ga0206131_10276188All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium766Open in IMG/M
3300020253|Ga0211685_1005761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED2871945Open in IMG/M
3300020347|Ga0211504_1077841All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes759Open in IMG/M
3300020352|Ga0211505_1007603All Organisms → Viruses → Predicted Viral2974Open in IMG/M
3300020438|Ga0211576_10671193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium510Open in IMG/M
3300021169|Ga0206687_1853730All Organisms → Viruses → Predicted Viral1505Open in IMG/M
3300021957|Ga0222717_10069364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2250Open in IMG/M
3300021957|Ga0222717_10078549Not Available2091Open in IMG/M
(restricted) 3300023109|Ga0233432_10010337All Organisms → cellular organisms → Bacteria7546Open in IMG/M
(restricted) 3300023112|Ga0233411_10034453All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300024346|Ga0244775_10081114Not Available2771Open in IMG/M
3300024346|Ga0244775_10529985Not Available960Open in IMG/M
3300025072|Ga0208920_1018273All Organisms → cellular organisms → Bacteria1527Open in IMG/M
3300025120|Ga0209535_1008037All Organisms → cellular organisms → Bacteria6184Open in IMG/M
3300025120|Ga0209535_1030773All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium2540Open in IMG/M
3300025133|Ga0208299_1048834All Organisms → cellular organisms → Bacteria1626Open in IMG/M
3300025137|Ga0209336_10162662Not Available581Open in IMG/M
3300025138|Ga0209634_1039957All Organisms → Viruses → Predicted Viral2400Open in IMG/M
3300025138|Ga0209634_1064219All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1753Open in IMG/M
3300025138|Ga0209634_1074733Not Available1577Open in IMG/M
3300025168|Ga0209337_1188028Not Available853Open in IMG/M
3300025276|Ga0208814_1122254All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage622Open in IMG/M
3300025543|Ga0208303_1047140Not Available1063Open in IMG/M
3300025671|Ga0208898_1009177Not Available5059Open in IMG/M
3300026390|Ga0247558_106424All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1062Open in IMG/M
3300027280|Ga0208972_1019253All Organisms → Viruses → Predicted Viral1676Open in IMG/M
3300027631|Ga0208133_1071524Not Available823Open in IMG/M
3300027672|Ga0209383_1095299Not Available1005Open in IMG/M
3300028125|Ga0256368_1002113All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2714Open in IMG/M
3300028125|Ga0256368_1006653Not Available1855Open in IMG/M
3300031656|Ga0308005_10045597Not Available1144Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine24.77%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater19.27%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.09%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine9.17%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine4.59%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine3.67%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.67%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment3.67%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.83%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.83%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.83%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine1.83%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.83%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.83%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.92%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.92%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.92%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.92%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.92%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.92%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.92%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.92%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.92%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300000174Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 60 08/10/11 200mEnvironmentalOpen in IMG/M
3300000188Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 60 08/10/11 150mEnvironmentalOpen in IMG/M
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300003264Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10EnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006736Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006753Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007647Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008470Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563EnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300012345Freshwater microbial communities from Burnt River, Ontario, Canada - S22EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018603Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782239-ERR1711906)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020253Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX555982-ERR598945)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025072Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300026390Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 3R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027280Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_48_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027672Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300031656Marine microbial communities from water near the shore, Antarctic Ocean - #67EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1000814983300000115MarineTTELFLDNGDSVEVDVIELYNEIRKNNEDLAEGKLLKEDMKAPKFKIDDFVQPKSRDKYIGQIRDVYINKPENLEMKDGEYVYSVDKLNHRGRNAMSFSFKESDLESISDPTDYIKSLTPYKRRK*
DelMOSpr2010_1003987723300000116MarineMDNFDLKKYLAEGKLLKEDQSPKFKIGDFVQPKSRDKYIGQIGDVYINKPENLEMKDGEYVYSVDKLNHRGRNAMSFSFKESDLESISDPTDYIKSLTPYKRRK*
SA_S1_NOR08_45mDRAFT_1005255043300000128MarineEQDGKVFTPAITLKYLDNGKEDISWKLKRDLAEGKLLKEDQSPKFKIDDFVQPKSRDKYIGQIEDVYINKPENLEMKDGEYVYSVAKLNHRGKNAMSFNFKESDLESISDPTDYIKSLTPYKRKN*
SI60aug11_200mDRAFT_103346523300000174MarineEGKLHEENQSPKFKIGDYVQPIEGATYYFLDRPRGTISGKYVGQINDSFINKPENLETKDGEYLYHVEKLNYRGKMRSSYAFKESDLEIIPNPMEYIKSLEPYRRRN*
SI60aug11_150mDRAFT_100504133300000188MarineMDNFDFKKYLAEGKLHEENQSPKFKIGDYVQPIEGATYYFLDRPRGTISGKYVGQINDSFINKPENLETKDGEYLYHVEKLNYRGKMRSSYAFKESDLEIIPNPMEYIKSLEPYRRRN*
NpDRAFT_10001588153300000929Freshwater And MarineGKLLKEDQSPKFKIGDFVQPKSRDKYIGQIEDVYINKPENLEMKDDEYVYSVEKLNYRGRNAMSFDFKESDLESISDPTEYIKSLTPYKRRN*
JGI24006J15134_1014720913300001450MarineFDKIENPTDEEVLNFIDIEIEKYLAEGKLLKEDQSPKFKIGDFVQPKSRDKYIGQIEDVYINKPENLEMKDGEYVYSVEKLNYRGKNAMSFDFKESDLESISDPTDYIKSLTPYKRKN*
JGI24003J15210_1002195033300001460MarineMNNFDLKKYLAEGKLYEQKSPKFKIGDFVQPIKGATSYFLDKPSGTISSKYIGQIKNVQVNKPEKLKIKDGEYLYSVDQLNYRGKNAMSFKFKESDLELISDPTEYIKSLTPYKRRN*
JGI24003J15210_1015320723300001460MarineMDNFDLKKYLAEGKLYEQKSPKFKIGDFVQPKNRDKYIGQIENVYINKPENLEIKDGEYVYSVDKLNHRGRNAMSFDFKESDLESISDPTEYIKSLTPYKRKN*
JGI24004J15324_1003746023300001472MarineMDNFDLKKYLTEGRLFEENQSPKFKIGDFVQPKDRDKYIGQIEDVYINKPENLEIKDGEYLYSVAKLNHRGRNAMSFDFKESDLESISDPTEYIKSLTPYKRXN*
JGI24004J15324_1005299833300001472MarineMDNFDLRKYLAEGKLYEQKSPKFKIGDFVQPKNRDKYIGQIENVYINKPENLEIKDGEYVYSVDKLNHRGKNAMSFDFKESDLESISDPTEYIKSLTPYKRKN*
JGI24005J15628_1008510423300001589MarineMDNFDLRKYLAEGKLYEQKSPKFKIGDFVQPKNRDKYIGQIENVYINKPENLEIKDGEYVYSVDKLNHRGRNAMSFEFKESDLESISDPTEYIKSLTPYKRRN*
JGI24005J15628_1017473423300001589MarineFFDKIENPTDEEVLNFIDIEIEKYLAEGKLLKEDQSPKFKIGDFVQPKSRDKYIGQIEDVYINKPENLEMKDGEYVYSVEKLNYRGKNAMSFDFKESDLESISDPTDYIKSLTPYKRKN*
JGI26119J46589_100147023300003264MarineMNNFDLRKYLTEGKLHEENQSPKFKIDDFVQPIEGATYYFLDRPRGTISGKYVGQIEDVFINKPENLETKDGEYLYHVEKLNYRGKMKSSYAFKESDLESISDPTEYIKSLTPYKRRN*
Ga0075445_1005319423300006193MarineMDNFDLKKYLAEGKLLKENQSPKFKIDDFVQPKSRDKYIGQIEDVYINKPENLEMKDGEYVYSVAKLNHRGRNAMSFDFKESDLESISDPTDYIRSLTPSRRRN*
Ga0075506_180896513300006401AqueousDLKKYLAEGKLLKEDQSPKFKIGDFVQPKSRDKYIGQIGDVYINKPENLEMKDGEYVYSVDKLNHRGRNAMSFSFKESDLESISDPTDYIKSLTPYRRRN*
Ga0070744_1013047413300006484EstuarineMKNFDLTKYLAEGKLLKEDQSPKFKIGDFVQPKSRDKYVGQIEDVHINKPENLEMKDGEYVYSVEKLNHRGKNAMSFDFKESDLESISDPTDYIKSLTPYKRRN*
Ga0070744_1023631423300006484EstuarineKYLAEGKLYEQKSPKFKIGDFVQPIKGATSYFLDKPSGTISSKYIGQIKNVQVNKPEKLKIKDGEYLYSVDQLNYRGKNAMSFKFKESDLELISDPTEYIKSLTPYKRRN*
Ga0098038_105630713300006735MarineKEDMKAPKFKIDDFVQPKSRDKYIGQIEDVYINRPENLEIKDGEYVYSVAKLNHRGRNAMSFEFKESDLESISDPTEYIKSLTPYKRRN*
Ga0098033_100913443300006736MarineMNDFDLKKYLAEGKLLKEDMKAPKFKIDDFVQPKSRDKYIGQIEDVYINKPENLEIKDGEYVYSVAKLNHRGRNAMSFEFKESDLESISDPTDYIKSLTPYKKRN*
Ga0098042_105583813300006749Marine*IHFGKINNMNNFDLRKYLAENNLLKEDMKAPKFKIDDFVQPKSRDKYIGQIEDVYINRPENLEIKDGEYLYSVAKLNHRGRNAMSFDFKESDLESISDPTEYIKSLTPYKRRN*
Ga0098039_101168363300006753MarineMNDFDLKKYLAEGKLLKEDMKAPKFKIDDFVQPKSRDKYIGQIEDVYINKPENLEIKDGEYVYSVAKLNHRGRNAMSFEFKESDLESISDPTDYIKSLTPYK
Ga0070749_1040787923300006802AqueousMDNFDLKKYLAEGKLLKEDQSPKFKIGDFVQPKSRDKYIGQIGDVYINKPENLEMKDGEYVYSVDKLNHRGRNAMSFSFKESDLESISDPTDYIKSLTPYRRRN*
Ga0070746_1026272533300006919AqueousMDNFDLRKYLAEGKLFEEDQSPKFKIGNFVQPKSRDKYIGQIGDVYINKPENLEMKDGEYVYSVDKLNHRGRNAMSFSFKESDLESISDPTDYIKSLTPYRRRN*
Ga0070745_101167573300007344AqueousMDNFDLRKYLAEGKLFEEDQSPKFKIGDFVQPKSRDKYIGQIGDVYINKPENLEMKDGEYVYSVDKLNHRGRNAMSFSFKESDLESISDPTDYIKSLTPYRRRN*
Ga0070752_117552913300007345AqueousPKFKIGDFVQPKNRDKYIGQIEDVYINKPENLETKDGEYLYSVAKLNHRGKNAMSFNFKESDLESISDPTDYIKSLTPYRRRN*
Ga0099851_100592553300007538AqueousMDNFDLKKYLAEGRLLKEESLPTPKFKIGDYVQPIEGATYYFLDRPRGTISGKYVGQVEDVWINKPENLPTKDGEYLYSVKKLNYKGKMGAEYDFKESELESIPNPAEYIKSLQPYRRKN
Ga0099847_107804033300007540AqueousMDNFDLKKYLAENRLFEENPSPKFKIRDFVQPKVGATYYFLDHEFQHTDKDKYVGQIENVFVNKPENLRTKDGEYLYSVAKLNHRGKMTMAYDFKESDLESISDPTDYIRSLTPYRRRN*
Ga0099846_110622013300007542AqueousMDNFDLKKYLAEGRLLKEESLPTPKFKIGDYVQPIEGATYYFLDRPRGTISGKYVGQVEDVWINKPENLPTKDGEYLYSVKKLNYKGKMGAEYDFKESELESIPNPAE
Ga0102817_110462413300007555EstuarineMKNFDLTKYLAEGKLLKEDQSPKFKIGDFVQPKSRDKYVGQIEDVHINKPENLEMKDGEYVYSVEKLNHRGKNAMSFDFKESDLESISDPTDYIKSLTPYKRKN*
Ga0102855_120560813300007647EstuarineMNNFDLKKYLAEGKLYEQKSPKFKIGDFVQPIKGATSYFLDKPSGTISSKYIGQIKNVQVNKPEKLKIKDGEYLYSVDQLNYRGKNAMSFKFKESDLELISDPTEYIKSLTPYKKRN*
Ga0105737_106844013300007862Estuary WaterLGLERDELYEGKLHEQKSPKFKIGDFVQPIEGATSYLLDEPRGTISSKYVGQIKDVYINKPENLEMKDGEYLYSVDQLNYRGKNAMSFKFKESDLELISDPTEYIKSLTPYKRRN*
Ga0105748_1028829323300007992Estuary WaterMDNFDLRKYLAEGKLYEQKSPKFKIGDFVQPKNRDKYIGQIENVYINKPENLEIKDGEYVYSVDKLNHRGRNAMSFDFKESDLESISDPTEYIKSLTPYKRRN*
Ga0098052_111628043300008050MarineMNDFDLKKYLAEGKLLKEDMKAPKFKIDDFVQPKSRDKYIGQIEDVYINKPENLEIKDGEYVYSVAKLNHRGRNAMSFEFKESDLESISDPTDYIKS
Ga0115371_1015934813300008470SedimentDFVQPIEGATSYLLDKPRGTISSKYVGQIGDVYINKPENLEMKDGEYLYSVAKLNHRGKMAMSFGFKESDLELISYPTEYIKSLQPYRRRN*
Ga0115371_1071200523300008470SedimentNFDLRKYLAEGKLHEQKSPKFKIDDFVQPIEGATSYSLDKPRGTISSKYVGQIEDVYINKPENLEMKDGEYLYSVAKLNHRGKMAMSFGFKESDLESISDPTEYIKSLTPYRRRN*
Ga0115371_1108838923300008470SedimentMDNFDLRKYLAEGKLHEQKSPKFKIDDFVQPIEGATSYLLDKPRGTISSKYVGQIGDVYINKPENLEMIDGEYLYSVDKLNYRGKMAMSFGFKESDLELISDPTEYIKSLTPYRRRN*
Ga0115371_1124631723300008470SedimentGKTVDNCIPMEENQKSPKFKIGDFVQPKDRDKYIGQIEDVYVNKPENIEMKDGEYVYSVDKLNHRGRNAMSFDFKESDLESISDPTEYIKGLQPYRRRN*
Ga0104258_109722223300008993Ocean WaterMKDFDLRKYLAEGKLYEQKSPKFKIDDFVQPIEGATYYFLDRPRGTISGKYVGQIEDVFINKPENLETKDGEYLYHVEKLNYRGKMKSSYAFKESDLESISDPTEYIKSLTPHKRRN*
Ga0102829_131856413300009026EstuarineMNDFDLRKYLTEGKLHEENQSPKFKIDDFVQPIEGATYYFLDRPRGTISGKYVGQIEDVFINKPENLETKDGEYLYHVEKLNYRGKMKSSYAFKESDLESISDPTEYIKSLTPYKRKN*
Ga0102830_116299613300009059EstuarineMDNFDFKKYLAEGKLHEENQSPKFKIGDYVQPIEGATYYFLDRPRGTISGKYVGQINDSFINKPENLETKDGEYLYHVEKLNYRGKMKSSYAFKESDLESISDPT
Ga0114918_1040610823300009149Deep SubsurfaceGKLFEENQSPKFKIGDFVQPKVGSTMYFLRDRGTIKDKKKYIGQIENVVVNKPENLRTKDGEYLYAVKKLNHRGKDVMSFDFKESDLESIPNPTDYIQSLTPYKRRN*
Ga0114915_107996833300009428Deep OceanACWKGYKLSGTKKKDGKTVDNCIPMEENQKSPKFKIDDFVQPKDRNKYIGQIEDVYINKPENLEIKDGEYVYSVAKLNHRGRNAMSFDFKESDLESISDPTDYIRSLTPSRRRN*
Ga0115007_1029872313300009441MarineFRQYLAEGKLYEQKSPKFKADDFVQPIEGVTYYSLDKPRGTISSKYVGQIEDVYINKPENLEIKDGEYLYSVAKLNHRGRNAMSFDFKESDLESISDPTDYIRSLTPYKRRN*
Ga0115102_1066330133300009606MarineMNNFDLRKYLTEGKLHEENQSPKFKIDDFVQPIEGATYYFLDRPKGTISGKYVGQIEDVFINKPENLETKDGEYLYHVEKLNYRGKMKSSYAFKESDLEIIPNPMEYIKSLTPYKRRN*
Ga0115104_1068935833300009677MarineMNNFDLKKYLAEGKLYEQKSPKFKIGDFVQPIKGATSYFLDKPSGTISSKYIGQIKNVQVNKPEKLKIKDGEYLYSVDQLNYRGKNAMSFKFKESDLELISDPTEYIKSLTPYKRKN*
Ga0098043_106307923300010148MarineMDNFDLRKYLAEDKLLKEDMKAPKFKIDDFVQPKSRDKYIGQIEDVYINKPENLKIKDGEYVYSVAKLNHRGRNAMSFEFKESDLESISDPTDYIKSLTPYKRRN*
Ga0098043_118330323300010148MarineMNNFDLRKYLAENNLLKEDMKAPKFKIDDFVQPKSRDKYIGQIEDVYINRPENLEIKDGEYLYSVAKLNHRGRNAMSFDFKESDLESISDPTEYIKSLTPYKRRN
Ga0098047_1001186943300010155MarineVIKNSKTMNDFDLKKYLAEGKLLKEDMKAPKFKIDDFVQPKSRDKYIGQIEDVYINKPENLEIKDGEYVYSVAKLNHRGRNAMSFEFKESDLESISDPTDYIKSLTPYKKRN*
Ga0157139_100053433300012345FreshwaterLRKYLAEGRLLKEESLPTPKFKTGDYVQPIEGATYYFLDRPRGTISGKYVGQIEDVWINKPENLQTKDGEYLYSVEKLNYKGKMGAAYDFKESELESIPNPAEYIKSLQLYRRKN*
Ga0129332_143572723300012969AqueousMDNFDLKKYLAEGRLFEENQSPKFKIGDFVQPKDRDKYIGQIRDVYINKPENLEMKDGEYVYSVDKLNHRGRNAMSFSFKESDLESISDPTDYIKSLTPYKRRK*
Ga0181369_104928443300017708MarineMKNLKFKIGDFVQPKDQDKYVGQIEDVYINKPENLEIKDGEYVYSVAKLNHRGRMAMSFSFKESNLELISDPTDYIKSLTPYK
Ga0181391_107984913300017713SeawaterSDLGLERDELYEGKLHEQKSPKFKIGDFVQPIEGATSYLLDEPRGTISSKYVGQIKDVYINKPENLEMKDGEYLYSVTKLNYRGRMTMSSDFKESDLESISDPTDYIKSLTPYRRRN
Ga0181412_100292673300017714SeawaterMDNFDLRKYLAEGKLYEQKSPKFKIGDFVQPKVGSTMYFLRDRGTIKDKKKYIGQIENVFVNKPENLRTKDGEYLYAVQKLNHRGKDAMAFDFKESDLESIPNPTDYIQSLQPYKRRN
Ga0181390_117546313300017719SeawaterMNDFDLRKYLTEGKLHEENQSPKFKIDDFVQPIEGATYYFLDRPKGTISGKYVGQIEDVFINKPENLETKDGEYLYHVEKLNYRGKMKSSYAFKESDLEIIPNPMEYIKSLTPYKRRN
Ga0181373_106632223300017721MarineMKNLKFKIGDFVQPKDQDKYVGQIEDVYINKPENLEIKDGEYVYSVAKLNHRGRMAMSFSFKESNLELISDPTDYIKSLTPYKR
Ga0181388_108161823300017724SeawaterMDNFDLKKYLAEGKLYEQKSPKFKIGDFVQPIEGATSYLLDEPRGTISSKYVGQIKDVYINKPENLEMKDGEYLYSVTKLNYRGRMTMSSDFKESDLESISDPTEYIKSLTPYKRRN
Ga0181431_100914043300017735SeawaterMDNFDLKKYLAEGKLYEQKSPKFKIGDFVQPKSRDKYVGQIEDVYINKPENLEIKDGEYVYSVDKLNHRGKDAMSFDFKESDLESISDPTEYIKSLTPYKRRK
Ga0181421_103531213300017741SeawaterMDNFDLKKYLAEGKLYEQKSPKFKIGDFVQPKNRDKYIGQIEDVYINKPENLEMKDGEYLYSVAKLNYRGRNAMSFDFKESDLESISDPTEYIKSLTPYKRRN
Ga0181399_107140423300017742SeawaterMDNFDLKKYLAEGKLYEQKSPKFKIGDFVQPKSRDKYVGQIEDVYINKPENLEIKDGEYVYSVDKLNHRGKDAMSFDFKESDLESISDPTEYIKSLTPYKRRN
Ga0187219_121244513300017751SeawaterMDNFDLKKYLAEGKLYEQKSPKFKIGDFVQPKNRDKYIGQIENVYINKPENLEIKDDEYVYSVDKLNHRGRNAMSFDFKESDLESISDPTEYIKSLTPYKRKN
Ga0181400_100768963300017752SeawaterMDNFNLRKYLAEGKLHEQKSPKFKIGDFVQPKNRDKYIGQIEDVYINKPENLEMKDGEYLYSVAKLNYRGRMTMSSDFKESDLESISDPTDYIKSLTPYRRRN
Ga0181400_116297923300017752SeawaterMDNFDLRKYLAEGKLYEQKSPKFKIGDFVQPKSRDKYVGQIEDVYINKPENLEIKDGEYVYSVDKLNHRGKDAMSFDFKESDLESISDPTEYIKSLTPYKRRN
Ga0181407_100892533300017753SeawaterMDNFDLRKYLAEGKLYEQKSPKFKIGDFVQPKSRDKYVGQIEDVYINKPENLEIKDGEYVYSVDKLNHRGRNAMSFDFKESDLESISDPTEYIKSLTPYKRRN
Ga0181407_104785243300017753SeawaterMDNFDLRKYLAEGKLYEQKSPKFKIGDFVQPKVGSTMYFLRDRGTIKDKKKYIGQIENVFVNKPENLRTKDGEYLYAVQKLNHRGKDAMA
Ga0181411_113471613300017755SeawaterKVGSTMYFLRDRGTIKDKKKYIGQIENVFVNKPENLRTKDGEYLYAVQKLNHRGKDAMAFDFKESDLESIPNPTDYIQSLQPYKRRN
Ga0181409_114157913300017758SeawaterMDNFNLRKYLAEGKLHEQKSPKFKIGDFVQPKNRDKYISQIEDVYINKPENLEMKDGEYLYSVAKLNYRGRMTMSSDFKESDLESISDPTD
Ga0181408_119632013300017760SeawaterMDNFDLRKYLAEGKLYEQKSPKFKIGDFVQPKVGSTMYFLRDRGTIKDKKKYIGQIENVFVNKPENLRTKDGEYLYAVQKLNHRGKDAMAFDFKESDLESIPNPTDY
Ga0181422_109034633300017762SeawaterMDNFDLKKYLAEGKLYEQKSPKFKIGDFVQPKSRDKYVGQIEDVYINKPENLEIKDGEYVYSVDKLNHRGKDAMSFDFKESDLESISDPTEYIKSLTPY
Ga0181422_123778623300017762SeawaterMDNFNLRKYLAEGKLHEQKSPKFKIGDFVQPKNRDKYIGQIEDVYINKPENLEMKDGEYLYSVAKLNYRGRNAMSFDFKESDLESISDPTEYIKSLTPIK
Ga0181410_102007033300017763SeawaterLESDLGLERDELYEGKLHEQKSPKFKIGDFVQPIEGATSYLLDEPRGTISSKYVGQIKDVYINKPENLEMKDGEYLYSVTKLNYRGRMTMSSDFKESDLESISDPTDYIKSLTPYRRRN
Ga0181410_114316323300017763SeawaterMDNFDLKKYLVEGKLHEQKSPKFKIGDFVQPKNRDKYIGQIEDVYINKPENLEMKDGEYLYSVAKLNYRGRNAMSFDFKESDLESISDPTEYIKSLTPYKRRN
Ga0181430_106197013300017772SeawaterEGKLYEQKSPKFKIGDFVQPKSRDKYVGQIEDVYINKPENLEIKDGEYVYSVDKLNHRGRNAMSFDFKESDLESISDPTEYIKSLTPYKRRN
Ga0181424_1018416013300017786SeawaterDLKKYLAEGKLYEQKSPKFKIGDFVQPIEGATSYLLDEPRGTISSKYVGQIKDVYINKPENLEMKDGEYLYSVTKLNYRGRMTMSSDFKESDLESISDPTDYIKSLTPYRRRN
Ga0181607_1072915213300017950Salt MarshKYLAEGKLYEENQSPKFKIGDFVKPKNRDKYIGQIEDVYINKPENLETKDGEYLYSVAKLNHRGKNAMSFDFKESDLESISDPTDYIKSLTPYRRRN
Ga0181606_1038011213300018048Salt MarshMDNFDLKKYLAEGKLYEENQSPKFKIGDFVQPKNRDKYIGQIEDVYINKPENLETKDGEYLYSVAKLNHRGKNAMSFDFKESDLESISDPTDYI
Ga0192881_100130823300018603MarineMDNFDYKKYLAEGNLHEDMKAPRFKIGDYVQPIEGATSYLLDEPRGNISSKYVGQIGDVYINKPENLEMKDGEYLYSVTKLNHRGKMKMSFSFKESDLESISDPTDYIKSLTPYKRRN
Ga0192880_1004060923300019009MarineMDNFDYKKYLAEGNLHEDMKAPKFKIGDYVQPIEGATSYLLDEPRGNISSKYVGQIGDVYINKPENLEMKDGEYLYSVTKLNHRGKMKMSFSFKESDLESISDPTDYIKSLTPYKRRN
Ga0206131_1027618823300020185SeawaterMENFDLKKYLKEGKLHEENQPPKFKIGDYVQPIEGATTYMNDEPRGTITSKYIGVVEDVKVNRPEKLRIMDGEYLYAVEKLNSKGRNKNAYDFKESDLESIPNPMEYIKGLEPYRRRN
Ga0211685_100576123300020253MarineMDNFDLKKYLAEGKLHEQKSPKFKIDDFVQPIEGATSYLLDKPRGTISSKYVGQIGDVYINKPENLEMIDGEYLYSVDKLNYRGKMAMSFGFKESDLELISDPTE
Ga0211504_107784113300020347MarineLHEDMKAPKFKIGDYVQPIEGATSYLLDEPRGNISSKYVGQIGDVYINKPENLEMKDGEYLYSVTKLNHRGKMKMSFSFKESDLESISDPTDYIKSLTPYKRRN
Ga0211505_100760323300020352MarineMANFDLTKYLAEGKLHEDMKAPKFKIGDYVQPIEGATSYLLDEPRGNISSKYVGQIGDVYINKPENLEMKDGEYLYSVTKLNHRGKMKMSFSFKESDLESISDPTDYIKSLTPYKRRN
Ga0211576_1067119313300020438MarineMDNFDLRKYLAEGKLYEQKSPKFKIGDFVQPIKGATSYFLDKPSGTISSKYIGQIKNVQVNKPEKLKIKDGEYLYSVDQLNYRGKNAMSFKFKESDLELISDPTEYIKSLTPYKRRN
Ga0206687_185373023300021169SeawaterMNNFDLRKYLTEGKLHEENQSPKFKIDDFVQPIEGATYYFLDRPKGTISGKYVGQIEDVFINKPENLETKDGEYLYHVEKLNYRGKMKSSYAFKESDLEIIPNPMEYIKSLTPYKRRN
Ga0222717_1006936423300021957Estuarine WaterMNDFDLRKYLTEGKLHEENQSPKFKIDDFVQPIEGATYYFLDRPRGTISGKYVGQIEDVFINKPENLETKDGEYLYHVEKLNYRGKMKSSYAFKESDLESISDPTEYIKSLTPYKRRN
Ga0222717_1007854923300021957Estuarine WaterMDNFDLKKYLAEGKLYEQKSPKFKIGDFVQPKSRDKYVGQIEDVYINKPENLEIKDGEYVYSVDKLNHRGRNAMSFDFKESDLESISDPTEYIKSLTPYKRRN
(restricted) Ga0233432_10010337103300023109SeawaterMDNFDFKKYLAEGKLHEENQSPKFKIGDYVQPIEGATYYFLDRPRGTISGKYVGQINDSFINKPENLETKDGEYLYHVEKLNYRGKMRSSYAFKESDLEIIPNPMEYIKSLEPYRRRN
(restricted) Ga0233411_1003445323300023112SeawaterMKDFDLRKYLAEGKLYEQKSPKFKIGDFVQPKNRDKYIGQIEDVYINKPENLEIKDGEYVYSVDKLNHRGRNAMSFDFKESDLESISDPTEYIKSLTPHKRRN
Ga0244775_1008111413300024346EstuarineMDNFDLKKYLAEGKLYEQKSPKFKIGDFVQPIKGATSYFLDKPSGTISSKYIGQIKNVQVNKPEKLKIKDGEYLYSVDQLNYRGKNAMSFKFKESDLELISDPTEYIKSLTPYKRRN
Ga0244775_1052998523300024346EstuarineMKNFDLTKYLAEGKLLKEDQSPKFKIGDFVQPKSRDKYVGQIEDVHINKPENLEMKDGEYVYSVEKLNHRGKNAMSFDFKESDLESISDPTDYIKSLTPYKRRN
Ga0208920_101827343300025072MarineMNDFDLKKYLAEGKLLKEDMKAPKFKIDDFVQPKSRDKYIGQIEDVYINKPENLEIKDGEYVYSVAKLNHRGRNAMSFEFKESDLESISDPTDYIKSLTPYKKRN
Ga0209535_100803743300025120MarineMDNFDLKKYLAEGKLYEQKSPKFKIGDFVQPKNRDKYIGQIENVYINKPENLEIKDGEYVYSVDKLNHRGRNAMSFDFKESDLESISDPTEYIKSLTPYKRKN
Ga0209535_103077333300025120MarineMENFDLKKYLAEGKLLKEDQSPKFKIGDFVQPKSRDKYIGQIEDVYINKPENLEMKDGEYVYSVEKLNYRGKNAMSFDFKESDLESISDPTDYIKSLTPYKRKN
Ga0208299_104883423300025133MarineMNDFDLKKYLAEGKLLKEDMKAPKFKIDDFVQPKSRDKYIGQIEDVYINKPENLEIKDGEYVYSVAKLNHRGRNAMSFEFKESDLESISDPTDYIKSLTPYKRRK
Ga0209336_1016266213300025137MarineMDNFDLKKYLTEGRLFEENQSPKFKIGDFVQPKDRDKYIGQIEDVYINKPENLEIKDGEYLYSVAKLNHRGRNAMSFDFKESDLESISDPTEYIKSLTPYKR
Ga0209634_103995733300025138MarineMDNFDLRKYLAEGKLYEQKSPKFKIGDFVQPKNRDKYIGQIENVYINKPENLEIKDGEYVYSVDKLNHRGKNAMSFDFKESDLESISDPTEYIKSLTPYKRKN
Ga0209634_106421933300025138MarineMDNFDLKKYLTEGRLFEENQSPKFKIGDFVQPKDRDKYIGQIEDVYINKPENLEIKDGEYLYSVAKLNHRGRNAMSFDFKESDLESISDPTEYIKSLTPYKRRN
Ga0209634_107473323300025138MarineMDNFDLKKYLAEGKLLKEDQSPKFKIGDFVQPKSRDKYIGQIEDVYINKPENLEMKDGEYVYSVEKLNYRGKNAMSFDFKESDLESISDPTDYIKSLTPYKRKN
Ga0209337_118802813300025168MarineNFYENVVRFFDKIENPTDEEVLNFIDIEIEKYLAEGKLLKEDQSPKFKIGDFVQPKSRDKYIGQIEDVYINKPENLEMKDGEYVYSVEKLNYRGKNAMSFDFKESDLESISDPTDYIKSLTPYKRKN
Ga0208814_112225413300025276Deep OceanKKGGKTVDNCIPMEENQKSPKFKIGDFVQPKDRDKYIGQIEDVYVNKPENIEMKDGEYVYSVDKLNHRGRNAMSFDFKESDLESISDPTEYIKGLQPYRRRN
Ga0208303_104714013300025543AqueousMDNFDLKKYLAENRLFEENPSPKFKIRDFVQPKVGATYYFLDHEFQHTDKDKYVGQIENVFVNKPENLRTKDGEYLYSVAKLNHRGKMTMAYDFKESDLESISDPTDYISSLTPYRRRN
Ga0208898_100917773300025671AqueousMDNFDLRKYLAEGKLFEEDQSPKFKIGDFVQPKSRDKYIGQIGDVYINKPENLEMKDGEYVYSVDKLNHRGRNAMSFSFKESDLESISDPTDYIKSLTPYRRRN
Ga0247558_10642423300026390SeawaterMLEENQKSPKFKIDDFVQPKSRDKYIGQIEDVYINKPENLEIKDGEYIYSVAKLNHRGKNAMSFEFKESDLESISDPTEYIKSLTPYKRRK
Ga0208972_101925313300027280MarineMNNFDLRKYLTEGKLHEENQSPKFKIDDFVQPIEGATYYFLDRPRGTISGKYVGQIEDVFINKPENLETKDGEYLYHVEKLNYRGKMKSSYAFKESDLESISDPTEYIKSLTPYKRRN
Ga0208133_107152423300027631EstuarineMKNFDLTKYLAEGKLLKEDQSPKFKIGDFVQPKSRDKYVGQIEDVHINKPENLEMKDGEYVYSVEKLNHRGKNAMSFDFKESDLESISDPTEYIKSLTPYKRKN
Ga0209383_109529923300027672MarineMDNFDLKKYLAEGKLHEQKSPKFKIDDFVQPIEGATSYLLDKPRGTISSKYVGQIGDVYINKPENLEMKDGEYLYSVDKLNYRGKMAMSFGFKESDLELISDPTE
Ga0256368_100211323300028125Sea-Ice BrineMDNFDFKKYLSEGKLHEENQSPKFKIDDFVQPIEGATYYFLDRPRGTISGKYVGQIEDVFINKPENLETKDGEYLYHVEKLNSRGKMKSSYAFKESDLEIIPNPMEYIKSLTPYRRRN
Ga0256368_100665333300028125Sea-Ice BrineMDNFDLKKYLAEGKLHEQKSPKFKADDFVQPIEGVTYYSLDKPRGTISSKYVGQIKDVYINKPENLEMKDGEYLYSVAKLNHRGRNEMSFDFKESDLESISDPTDYIRSLTPHKRRN
Ga0308005_1004559733300031656MarineMDNFDLRKYLAEGKINEQKSPKFKIDDFVQPIEGATSYLLDKPRGTISSKYVGQIGDVYINKPENLEMIDGEYLYSVDKLNYRGKMAMSFGFKESDLELISDPTEYIKSLQPYRRRN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.