Basic Information | |
---|---|
Family ID | F089202 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 109 |
Average Sequence Length | 42 residues |
Representative Sequence | MKNAGMKIKHPKLRGEWAELRFMTRAAEHGLCVTKPWGE |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 66.67 % |
% of genes near scaffold ends (potentially truncated) | 94.50 % |
% of genes from short scaffolds (< 2000 bps) | 87.16 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.156 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.349 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.688 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.303 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.84% β-sheet: 0.00% Coil/Unstructured: 67.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF02604 | PhdYeFM_antitox | 2.75 |
PF01642 | MM_CoA_mutase | 1.83 |
PF01541 | GIY-YIG | 1.83 |
PF13302 | Acetyltransf_3 | 1.83 |
PF01381 | HTH_3 | 1.83 |
PF12762 | DDE_Tnp_IS1595 | 1.83 |
PF12760 | Zn_Tnp_IS1595 | 1.83 |
PF07883 | Cupin_2 | 1.83 |
PF00670 | AdoHcyase_NAD | 1.83 |
PF00575 | S1 | 0.92 |
PF02597 | ThiS | 0.92 |
PF01797 | Y1_Tnp | 0.92 |
PF12867 | DinB_2 | 0.92 |
PF00773 | RNB | 0.92 |
PF03129 | HGTP_anticodon | 0.92 |
PF01569 | PAP2 | 0.92 |
PF11645 | PDDEXK_5 | 0.92 |
PF15780 | ASH | 0.92 |
PF02371 | Transposase_20 | 0.92 |
PF05163 | DinB | 0.92 |
PF13517 | FG-GAP_3 | 0.92 |
PF13671 | AAA_33 | 0.92 |
PF01011 | PQQ | 0.92 |
PF03989 | DNA_gyraseA_C | 0.92 |
PF00296 | Bac_luciferase | 0.92 |
PF05221 | AdoHcyase | 0.92 |
PF13413 | HTH_25 | 0.92 |
PF14534 | DUF4440 | 0.92 |
PF03745 | DUF309 | 0.92 |
PF13424 | TPR_12 | 0.92 |
PF05198 | IF3_N | 0.92 |
PF13520 | AA_permease_2 | 0.92 |
PF10017 | Methyltransf_33 | 0.92 |
PF00483 | NTP_transferase | 0.92 |
COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
---|---|---|---|
COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 2.75 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 2.75 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 2.75 |
COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 1.83 |
COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.92 |
COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.92 |
COG0290 | Translation initiation factor IF-3 | Translation, ribosomal structure and biogenesis [J] | 0.92 |
COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.92 |
COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.92 |
COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.92 |
COG0557 | Exoribonuclease R | Transcription [K] | 0.92 |
COG1547 | Predicted metal-dependent hydrolase | Function unknown [S] | 0.92 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.92 |
COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.92 |
COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.92 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.92 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.92 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.92 |
COG4776 | Exoribonuclease II | Transcription [K] | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.07 % |
Unclassified | root | N/A | 11.93 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001154|JGI12636J13339_1004691 | All Organisms → cellular organisms → Bacteria | 2240 | Open in IMG/M |
3300004114|Ga0062593_100586271 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300004153|Ga0063455_101101069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300004635|Ga0062388_101740027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300005186|Ga0066676_10845829 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Haloferacales → Haloferacaceae → Haloferax → Haloferax sulfurifontis | 617 | Open in IMG/M |
3300005436|Ga0070713_100047451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3530 | Open in IMG/M |
3300005468|Ga0070707_101504256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
3300005526|Ga0073909_10519658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
3300005534|Ga0070735_10291024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
3300005537|Ga0070730_10704434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
3300005538|Ga0070731_10272009 | Not Available | 1125 | Open in IMG/M |
3300005541|Ga0070733_10258623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1146 | Open in IMG/M |
3300005598|Ga0066706_11020758 | Not Available | 636 | Open in IMG/M |
3300005610|Ga0070763_10550394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
3300005610|Ga0070763_10867483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300005712|Ga0070764_10056104 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
3300005712|Ga0070764_10255695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
3300005938|Ga0066795_10021713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1831 | Open in IMG/M |
3300006028|Ga0070717_10512502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1085 | Open in IMG/M |
3300006046|Ga0066652_101649294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300006052|Ga0075029_100104566 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
3300006176|Ga0070765_100271747 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
3300006176|Ga0070765_100589971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
3300006854|Ga0075425_100157474 | All Organisms → cellular organisms → Bacteria | 2604 | Open in IMG/M |
3300009012|Ga0066710_104187857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300009137|Ga0066709_100725500 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
3300009137|Ga0066709_104344677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300009143|Ga0099792_10054688 | All Organisms → cellular organisms → Bacteria | 1958 | Open in IMG/M |
3300009143|Ga0099792_11250661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300009700|Ga0116217_10795752 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium F11 | 582 | Open in IMG/M |
3300010326|Ga0134065_10204385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
3300010339|Ga0074046_10685003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300012209|Ga0137379_10537532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1076 | Open in IMG/M |
3300012210|Ga0137378_10776674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
3300012350|Ga0137372_10016516 | All Organisms → cellular organisms → Bacteria | 6986 | Open in IMG/M |
3300012351|Ga0137386_10529765 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300012362|Ga0137361_11866397 | Not Available | 518 | Open in IMG/M |
3300012929|Ga0137404_10159949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1881 | Open in IMG/M |
3300012958|Ga0164299_10223505 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300012976|Ga0134076_10289557 | Not Available | 707 | Open in IMG/M |
3300014968|Ga0157379_12365276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300015193|Ga0167668_1050152 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300015374|Ga0132255_100339730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2171 | Open in IMG/M |
3300017943|Ga0187819_10211328 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
3300017975|Ga0187782_10747167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
3300018088|Ga0187771_11332077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300018090|Ga0187770_11783556 | Not Available | 504 | Open in IMG/M |
3300018482|Ga0066669_10020031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3714 | Open in IMG/M |
3300020580|Ga0210403_11102395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
3300020583|Ga0210401_11108206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300021170|Ga0210400_11037127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
3300021171|Ga0210405_10978804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
3300021180|Ga0210396_10492441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
3300021401|Ga0210393_10175057 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
3300021402|Ga0210385_11523250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300021405|Ga0210387_10704106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
3300021406|Ga0210386_11058381 | Not Available | 690 | Open in IMG/M |
3300021406|Ga0210386_11069170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300021420|Ga0210394_10067854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3093 | Open in IMG/M |
3300021420|Ga0210394_11732779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300021432|Ga0210384_10652595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 943 | Open in IMG/M |
3300021432|Ga0210384_10886141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 792 | Open in IMG/M |
3300021433|Ga0210391_11419365 | Not Available | 533 | Open in IMG/M |
3300021477|Ga0210398_10230997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1508 | Open in IMG/M |
3300021479|Ga0210410_10280528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1495 | Open in IMG/M |
3300021479|Ga0210410_11024271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 715 | Open in IMG/M |
3300021559|Ga0210409_10824397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 801 | Open in IMG/M |
3300021858|Ga0213852_1212084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300021861|Ga0213853_11121426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
3300025916|Ga0207663_10422081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1024 | Open in IMG/M |
3300026078|Ga0207702_12462468 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300026313|Ga0209761_1298439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300026342|Ga0209057_1036248 | All Organisms → cellular organisms → Bacteria | 2513 | Open in IMG/M |
3300026356|Ga0257150_1053848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
3300027432|Ga0209421_1095557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
3300027660|Ga0209736_1045628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1259 | Open in IMG/M |
3300027795|Ga0209139_10367749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300027826|Ga0209060_10259614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
3300027842|Ga0209580_10506874 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300027862|Ga0209701_10437924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
3300027867|Ga0209167_10269472 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300027882|Ga0209590_10466386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
3300027882|Ga0209590_10870163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300027882|Ga0209590_11037636 | Not Available | 510 | Open in IMG/M |
3300027986|Ga0209168_10160005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1139 | Open in IMG/M |
3300028010|Ga0265358_102297 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300028015|Ga0265353_1011826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 801 | Open in IMG/M |
3300028016|Ga0265354_1003342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1807 | Open in IMG/M |
3300028652|Ga0302166_10073285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
3300028828|Ga0307312_10829996 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300028906|Ga0308309_10353955 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
3300028906|Ga0308309_10521761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1028 | Open in IMG/M |
3300030706|Ga0310039_10037736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2195 | Open in IMG/M |
3300031446|Ga0170820_15506849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
3300031708|Ga0310686_101225214 | All Organisms → cellular organisms → Bacteria | 3859 | Open in IMG/M |
3300031715|Ga0307476_10976415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
3300031718|Ga0307474_10703069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
3300032770|Ga0335085_12350949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300032782|Ga0335082_10616953 | Not Available | 946 | Open in IMG/M |
3300032783|Ga0335079_10693169 | Not Available | 1065 | Open in IMG/M |
3300032783|Ga0335079_12076394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300032805|Ga0335078_10443666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1688 | Open in IMG/M |
3300032892|Ga0335081_10276234 | Not Available | 2244 | Open in IMG/M |
3300032892|Ga0335081_10803914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 1123 | Open in IMG/M |
3300032892|Ga0335081_12087534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300033158|Ga0335077_10162056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2553 | Open in IMG/M |
3300033158|Ga0335077_10750344 | Not Available | 999 | Open in IMG/M |
3300033826|Ga0334847_036429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.35% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.93% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.17% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 8.26% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.34% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.67% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.75% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.75% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.83% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.83% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.83% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.83% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.83% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.92% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.92% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.92% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.92% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.92% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.92% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.92% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028010 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 | Host-Associated | Open in IMG/M |
3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12636J13339_10046911 | 3300001154 | Forest Soil | MKNHGMKIKHSKLRGEWAEMCFMIRAAEHGLSVTKPWSELSRYDFVVEYK |
Ga0062593_1005862712 | 3300004114 | Soil | MKIKHAKRRGEWAELCFMARAAEHGLCISKPWGETAHYDFVVETG |
Ga0063455_1011010691 | 3300004153 | Soil | MNEKAMEIKHPKRRGEWAEMRFMAAAAEHGLSVMKPWGETAQY |
Ga0062388_1017400272 | 3300004635 | Bog Forest Soil | MTNQGIDIAHAKLRGEWAELRFMSRAAEHGLTITKPWGDSAR |
Ga0066676_108458291 | 3300005186 | Soil | LISPGMSIRHPKARGEWAELRFMLRATELGLRVTKPWGDNSPYDL |
Ga0070713_1000474511 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MMSPGMLIRHPKARGEWAELRFMTRATELGLRVTKPWGDN |
Ga0070707_1015042562 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNKGIDIKHPKLRGEWAELRFMARAAEHGLCVTKPWGDTARYDFA |
Ga0073909_105196583 | 3300005526 | Surface Soil | MKNLGMYIRHPKARGEWAELRFMTRATELGFIVTKPWGDSAP |
Ga0070735_102910241 | 3300005534 | Surface Soil | MTIDGLNIKHPKIRGEWAELRFMARAAEQGFAVNKPWGES |
Ga0070730_107044342 | 3300005537 | Surface Soil | MSIRHAKARGEWAELRFMERATELGLRVTKPWGDNAPYDFAV |
Ga0070731_102720092 | 3300005538 | Surface Soil | LKNEGMKIKHPKLRGEWAELRFMTRAAERGLRVSK |
Ga0070733_102586231 | 3300005541 | Surface Soil | MTNQGIDIQHPKLRGEWAELRFMARAAEHGLCIAKPWGDMARYDFAVEHN |
Ga0066706_110207582 | 3300005598 | Soil | MTKKNGINPKHSKLRGELAELRFMTRAAELGLRVIKPWGDS |
Ga0070763_105503942 | 3300005610 | Soil | MTNQGIDIQHPKLRGEWAELRFMARAAEHGLCIAKPWGDMARYDFAVEHNG |
Ga0070763_108674831 | 3300005610 | Soil | VRKTTGEKIKHHKLRGEWAELRFMAMAAEHGLQVTKPWGEMA |
Ga0070764_100561041 | 3300005712 | Soil | MKNDGMKIKHAKLRGEWAEMCFMTRAAEHGLSVTRPWGEMSRYDFAVEYK |
Ga0070764_102556951 | 3300005712 | Soil | MTNQGIDIQHPKLRGEWAELRFMARAAEHGLCIAKPWGDMARYDFAV |
Ga0066795_100217133 | 3300005938 | Soil | MKIRLPKERGEWAELRFMTKATEHGFKLTKPWEEV* |
Ga0070717_105125021 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MMSPGMLIRHPKARGEWAELRFMTRATELGLRVTKPWGDNAPYD |
Ga0066652_1016492941 | 3300006046 | Soil | MNELAMQIKQPKRRGEWVELRFMAAAAENGLHVTKPWG |
Ga0075029_1001045661 | 3300006052 | Watersheds | MKNPGMYIRHPKARGEWAELRFMTRATELGLIVTKPWGD |
Ga0070765_1002717474 | 3300006176 | Soil | VRKTTGEKIKHHKRRGEWAELRFMAMAAEHGLQVTKPWGEMAR |
Ga0070765_1005899713 | 3300006176 | Soil | MKNDGMKIKHPKRRGEWAELRFMTRAAEQGLCVTKPWGETARYDF |
Ga0075425_1001574741 | 3300006854 | Populus Rhizosphere | MKNKGMKIKHPKLRGEWAELRFMTRAAEHGLCVTKP |
Ga0066710_1041878571 | 3300009012 | Grasslands Soil | MKIKHPKLRGEWAELRFMSCAAEHGLCVTKPWGETARYDFAVEH |
Ga0066709_1007255001 | 3300009137 | Grasslands Soil | MKNKGMKIKHPKLRGEWAELRFMTCAAEHGLCVTKPWGETAHYDFAVENQG |
Ga0066709_1043446772 | 3300009137 | Grasslands Soil | MTNEGRDIKNHKKRGEWAELQFMARAAEHGLNVARPWGDSQRYDVGIEY |
Ga0099792_100546884 | 3300009143 | Vadose Zone Soil | MPNRGIDIQQSKARGEWAELRFMARTAEHGLYITKPWGDSAPYDFAVDHNG |
Ga0099792_112506611 | 3300009143 | Vadose Zone Soil | MPNRGIDIQQAKARGEWAELRFMARTAEHGLYITKPWGDSAPYDFAVDHNG |
Ga0116217_107957522 | 3300009700 | Peatlands Soil | MKNPGMYIRHPKARGEWAELRFMTRATELDFIVAKPWGDMA |
Ga0134065_102043851 | 3300010326 | Grasslands Soil | MNELAMQIKQPKRRGEWVELRFMAAAAENGLHVTKPWGDSAQ |
Ga0074046_106850031 | 3300010339 | Bog Forest Soil | MTISRTTLRHAKARGEWAELRFMTRAAEQGVRVTKPWGDNSPYDFAV |
Ga0137388_109496091 | 3300012189 | Vadose Zone Soil | MKKRRSHIKKPKQRGEWAELRFMMLAAERGLSVAKPWG |
Ga0137379_105375322 | 3300012209 | Vadose Zone Soil | MNELAMKIKQPKRRGEWVELRFMAAAAENDLHVTKPWGDSAQYDFILEY |
Ga0137378_107766741 | 3300012210 | Vadose Zone Soil | MTNEGRDIKNHKKRGEWAELQFMARAAEHGLNVARPWGDSQRYDVGIEYK |
Ga0137372_1001651613 | 3300012350 | Vadose Zone Soil | MTNFGAKIKHPKLRGEWAKLCFMVQAAEHGLQVG* |
Ga0137386_105297652 | 3300012351 | Vadose Zone Soil | LKIRDPKQRGEWAELRFMAKAMEHGYRLTRPWGGYLPYDV |
Ga0137361_118663971 | 3300012362 | Vadose Zone Soil | MTKKSGINPKHSKLRGEVAELRFMTRAAELGLRVIKPWGD |
Ga0137404_101599493 | 3300012929 | Vadose Zone Soil | MNNEGMNIRHAKSRGEWAELRFMTRATALGFRVTKPWGD |
Ga0164299_102235052 | 3300012958 | Soil | MGNPGMKIKHAKRRGEWAELCFMARAAEHGLCISKPWGETAHYDFVV |
Ga0134076_102895571 | 3300012976 | Grasslands Soil | MTKKNGINPKHSKLRGELAELRFMTRAAELGLRVI |
Ga0157379_123652761 | 3300014968 | Switchgrass Rhizosphere | MANQGIDIQHPMLRGEWAELCFMVKAAEHGLFVTKPWGDMAPYDFAVEYR |
Ga0167668_10501521 | 3300015193 | Glacier Forefield Soil | VEIYKKEIMKNYGMKIKHPKRRGEWAELRFMARAAEEGLQVSK |
Ga0132255_1003397304 | 3300015374 | Arabidopsis Rhizosphere | MLIRHPKARGEWAELRFMTRATELGLRVTKPWGDN |
Ga0187819_102113282 | 3300017943 | Freshwater Sediment | MTNRGIDIKHPKQRGEWAELRFMTRAAEHGLSITKPWGEMTHYDF |
Ga0187782_107471671 | 3300017975 | Tropical Peatland | MKNNGMKIKHPKLRGEWAELCFMTRAAEHGLCVTKPW |
Ga0187771_113320771 | 3300018088 | Tropical Peatland | MQNPGTTIPHAKARGEWAELRFMARAAELGLRVTKPW |
Ga0187770_117835561 | 3300018090 | Tropical Peatland | MNHVPSPGGQRILNPKLRGEWAELRFLQTAIERGFRVTKPWGE |
Ga0066669_100200314 | 3300018482 | Grasslands Soil | MNELAMQIKQPKRRGEWVELRFMAAAAENGLHVTKPWGDSAQI |
Ga0210403_111023951 | 3300020580 | Soil | MTNQGIDIQHPKLRGEWAELRFMARAAEHGLCIAKPWG |
Ga0210401_111082061 | 3300020583 | Soil | MTNKGIDIKPAKERGEWAELRFMARAAEEGLVVTKPWGESSRYDF |
Ga0210400_110371272 | 3300021170 | Soil | MFCPGMSIRYPKQRGEWAELLFMARATEHGLVVAKPWGESSHYDF |
Ga0210405_109788042 | 3300021171 | Soil | MTIDGTSIKHCKMRGEWAELRFMARAAEHGLCVSKPWGDSARYDFAVEYGG |
Ga0210396_104924411 | 3300021180 | Soil | MKNNGMKIKHPKLRGEWAEMCFMARAAEHGLCVTRPWGEMSRYDFAVE |
Ga0210393_101750571 | 3300021401 | Soil | MNLHHAKTRGEWAELRFMTRATELGLRVIKPWGDNSAYDL |
Ga0210385_115232502 | 3300021402 | Soil | MTNRGIDIKHPKQRGEWAELRFMARAAEHGLCITKPWGEMAHYDFCH |
Ga0210387_107041061 | 3300021405 | Soil | MTDNGSNIHHPKARGEWAELRFMARASERGLYVAKPWGDTAPYDLAV |
Ga0210386_110583811 | 3300021406 | Soil | MKNNGMKIKHPKLRGEWAEMCFMARAAEHGLCVTRPWGEM |
Ga0210386_110691702 | 3300021406 | Soil | MTNQGIDIQHPKLRGEWAELRFMARAAEHGLCIAKPWGDMARYDF |
Ga0210394_100678541 | 3300021420 | Soil | VRKTTGEKIKHHKLRGEWAELRFMAMAAEHGLQVTKPWGEMAR |
Ga0210394_117327791 | 3300021420 | Soil | MECPGMNIKHPKQRGEWAEMRFMARAAEHGLVVTKPWGESTHYDFAV |
Ga0210384_106525951 | 3300021432 | Soil | MKITGASIKAPKQRGEWAELRFMARASEHGLSISKPWGDS |
Ga0210384_108861412 | 3300021432 | Soil | MKITGASIKEPKQRGEWAELRFMARASEHGLSISKPWGDS |
Ga0210391_114193652 | 3300021433 | Soil | MKNNGMKIKHPKLRGEWAEMCFMTRAAEHGLCVTRPW |
Ga0210398_102309971 | 3300021477 | Soil | MTNQGIDIQHPKLRGEWAELRFMARAAEHGLCIAKPWGDMARYDFA |
Ga0210410_102805283 | 3300021479 | Soil | MKNNGMKIKHPKLRGEWAEMCFMTRAAEHGLCVTRPWGEMSRYDFAVEYKG |
Ga0210410_110242712 | 3300021479 | Soil | MTSRGADIKNHKMRGEWAELRFMARAAEFGLRVTKPWGDSAHYDFAVEHKG |
Ga0210409_108243971 | 3300021559 | Soil | MTNRGVDIKNRKQRGEWAEMCFMARAAAHGLCVAKPYGDS |
Ga0213852_12120841 | 3300021858 | Watersheds | MPNPSCPIRHAKARGEWAELRFMTRAAELGLRVTKPWGDNAPYDLAV |
Ga0213853_111214261 | 3300021861 | Watersheds | MQNPSCPIRHAKARGEWAELRFMTRAAELGLRVTKPWGDNAPYDLAV |
Ga0207663_104220811 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSPGMLIRHPKARGEWAELRFMTRATELGLRVTKPWG |
Ga0207702_124624681 | 3300026078 | Corn Rhizosphere | MKIKHAKRRGEWAELCFMARAAEHGLCISKPWGETAHYD |
Ga0209761_12984392 | 3300026313 | Grasslands Soil | MTKKSGINPKHSKLRGEVAELRFMTRAAELGLRVIKPWGDSARYDF |
Ga0209057_10362484 | 3300026342 | Soil | MTKKNGINPKHSKLRGELAELRFMTRAAELGLRVIKPWGDSAR |
Ga0257150_10538481 | 3300026356 | Soil | MPKGKYIQHPKLRGEWAELRFMQRATEHGFRVTKPWGE |
Ga0209421_10955571 | 3300027432 | Forest Soil | MSLHQVNIENSKQRGEWAELLFMARAAEQGLAIARPW |
Ga0209736_10456281 | 3300027660 | Forest Soil | MNQGIDIQHHKLRGEWAELRFMARATEHGLSIAKPWGE |
Ga0209139_103677491 | 3300027795 | Bog Forest Soil | MTNKGIDIQHPKLRGEWAELRFMARAAEHGLCIAKPWGDMAR |
Ga0209060_102596141 | 3300027826 | Surface Soil | LKNKGMKIKHPKLRGEWAELRFMTRAAEHGLRVSKPWGETAHYD |
Ga0209580_105068742 | 3300027842 | Surface Soil | MNDLGMSIKHAKRRGEWAELRFMACAAERGLCVSKPWGDTSHYDFV |
Ga0209701_104379243 | 3300027862 | Vadose Zone Soil | MPNRGIDIQQAKARGEWAELRFMARTAEHGLYITKPWGDSA |
Ga0209167_102694722 | 3300027867 | Surface Soil | MTNRGIDIKHPKQRGEWAELIFMARAAEHGLCITKPWGEMAHYDFAIEHHGHF |
Ga0209590_104663861 | 3300027882 | Vadose Zone Soil | MAKKGINIKHSKLRGEVAELRFMARAADQGLRVIKPWGDSS |
Ga0209590_108701631 | 3300027882 | Vadose Zone Soil | MKNKGMKIKHPKLRGEWAELRFMTCAAEHGLCVTKPWGE |
Ga0209590_110376362 | 3300027882 | Vadose Zone Soil | MTNEGRDIKNHKKRGEWAELQFMARAAEHGLNVARP |
Ga0209168_101600051 | 3300027986 | Surface Soil | LKNEGMKIKHPKLRGEWAELRFMTRAAEHGLRVSKPWGETAHYDFAVEHEGH |
Ga0265358_1022972 | 3300028010 | Rhizosphere | MKNRGIDIKHPKQRGEWAELRFMARAAEHGLCITKPW |
Ga0265353_10118262 | 3300028015 | Soil | MKNRGIDIKHPKQRGEWAELRFMARAAEHGLCITKPWGEMSH |
Ga0265354_10033425 | 3300028016 | Rhizosphere | MINKGSQIKNSKLRGEWAELRFLTRAVEHGLMVSKPWGDSA |
Ga0302166_100732851 | 3300028652 | Fen | MRIRKPKERGEWAELRFMAKAAELGFKLSKPWGDSAPYDVAIEHR |
Ga0307312_108299962 | 3300028828 | Soil | MKNKGNNIKHAKQRGEWAEMRFMARAAERGLQVSKPWGESASYDF |
Ga0308309_103539551 | 3300028906 | Soil | VRKTTGEKIKHHKRRGEWAELRFMAMAAEHGLQVTKPWGEMARYDFAVEY |
Ga0308309_105217613 | 3300028906 | Soil | MLIRHAKARGEWAELRFMTRATELGFRVTKPWGDCAPY |
Ga0310039_100377361 | 3300030706 | Peatlands Soil | MTNSINIPHAKARGEWAELRFMARAAELGLRVTKPWGDNAPY |
Ga0170820_155068491 | 3300031446 | Forest Soil | MKNPGINIPHAKARGEWAELRFMTRATELGFRVTKPW |
Ga0310686_1012252144 | 3300031708 | Soil | MTNRGIDIKHPKQRGEWAELRFMTRAAEHGLSITKP |
Ga0307476_109764151 | 3300031715 | Hardwood Forest Soil | MTNRGIDIKHPKQRGEWAELIFMARAAEHGLCITKPWG |
Ga0307474_107030691 | 3300031718 | Hardwood Forest Soil | MKNNGMKIKHPKLRGEWAEMCFMTRAAEHGFSVTRPWGEMSRYDFA |
Ga0335085_123509491 | 3300032770 | Soil | MENRGMRIKHPKLRGEWAELRFMARAAEQGLQVTKPWGE |
Ga0335082_106169533 | 3300032782 | Soil | MANPGLNIKLPKARGEWAELRFMARAAEQGLTVTKPW |
Ga0335079_106931692 | 3300032783 | Soil | VRKTTGEKIKHHKLRGEWAELRFMAMAAEHGLQVT |
Ga0335079_120763941 | 3300032783 | Soil | MQIPGMHIRLAKARGEWAELRFMQRALELGFIVTKPWGD |
Ga0335078_104436661 | 3300032805 | Soil | MASEERFIQLPKARGEWAELRFMARAAEHGLTVSKRWGESKHYDFVVEYDR |
Ga0335081_102762342 | 3300032892 | Soil | LSGEEDWVRKTTGEKIKHHKLRGEWAELRFMAMAAEHG |
Ga0335081_108039142 | 3300032892 | Soil | MYIRHPKARGEWAELCFMIRATVLGFIVAKPWGDMAPFDLI |
Ga0335081_120875342 | 3300032892 | Soil | MKNAGMKIKHPKLRGEWAELRFMTRAAEHGLCVTKPWGETAKYDFAVEYDGHF |
Ga0335077_101620563 | 3300033158 | Soil | MKNAGMKIKHPKLRGEWAELRFMTRAAEHGLCVTKPWGE |
Ga0335077_107503441 | 3300033158 | Soil | VRKTTGEKIKHHKLRGEWAELRFMAMAAEHGLQVTKP |
Ga0334847_036429_407_559 | 3300033826 | Soil | MTNTGSEIQHTKKRGEWAELRFMARAAEYGLCVAKPWGDSSEYDVAVEYEG |
⦗Top⦘ |