Basic Information | |
---|---|
Family ID | F089241 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 109 |
Average Sequence Length | 45 residues |
Representative Sequence | IFGTDRVYFMRVNGNKLMVKSPGVIVPMTGATSVVEFELVKAD |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 5.66 % |
% of genes near scaffold ends (potentially truncated) | 82.57 % |
% of genes from short scaffolds (< 2000 bps) | 87.16 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (64.220 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.936 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.440 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.716 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.76% Coil/Unstructured: 73.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF01565 | FAD_binding_4 | 28.44 |
PF13924 | Lipocalin_5 | 3.67 |
PF13181 | TPR_8 | 2.75 |
PF05598 | DUF772 | 1.83 |
PF09265 | Cytokin-bind | 1.83 |
PF01527 | HTH_Tnp_1 | 1.83 |
PF03401 | TctC | 0.92 |
PF04392 | ABC_sub_bind | 0.92 |
PF13359 | DDE_Tnp_4 | 0.92 |
PF03734 | YkuD | 0.92 |
PF14827 | dCache_3 | 0.92 |
PF00578 | AhpC-TSA | 0.92 |
PF02705 | K_trans | 0.92 |
PF07045 | DUF1330 | 0.92 |
PF07238 | PilZ | 0.92 |
PF13174 | TPR_6 | 0.92 |
PF16884 | ADH_N_2 | 0.92 |
PF00872 | Transposase_mut | 0.92 |
PF01850 | PIN | 0.92 |
PF13546 | DDE_5 | 0.92 |
PF04909 | Amidohydro_2 | 0.92 |
PF04828 | GFA | 0.92 |
PF13371 | TPR_9 | 0.92 |
PF01654 | Cyt_bd_oxida_I | 0.92 |
PF02667 | SCFA_trans | 0.92 |
PF01548 | DEDD_Tnp_IS110 | 0.92 |
PF13676 | TIR_2 | 0.92 |
PF06226 | DUF1007 | 0.92 |
PF17200 | sCache_2 | 0.92 |
PF00300 | His_Phos_1 | 0.92 |
COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
---|---|---|---|
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.83 |
COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.92 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
COG2031 | Short chain fatty acids transporter | Lipid transport and metabolism [I] | 0.92 |
COG2978 | p-Aminobenzoyl-glutamate transporter AbgT | Coenzyme transport and metabolism [H] | 0.92 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.92 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.92 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.92 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.92 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.92 |
COG3683 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.92 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.92 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 64.22 % |
Unclassified | root | N/A | 35.78 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459007|GJ8XV2H01AXW24 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Tessaracoccus → Tessaracoccus antarcticus | 510 | Open in IMG/M |
3300000567|JGI12270J11330_10009175 | All Organisms → cellular organisms → Bacteria | 6688 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10145772 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300000890|JGI11643J12802_11296451 | Not Available | 573 | Open in IMG/M |
3300001471|JGI12712J15308_10081304 | Not Available | 821 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100168494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2071 | Open in IMG/M |
3300004091|Ga0062387_100943620 | Not Available | 656 | Open in IMG/M |
3300005541|Ga0070733_11179192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
3300005713|Ga0066905_100994472 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300005764|Ga0066903_100315343 | All Organisms → cellular organisms → Bacteria | 2491 | Open in IMG/M |
3300005764|Ga0066903_101938111 | Not Available | 1130 | Open in IMG/M |
3300005764|Ga0066903_103011505 | Not Available | 913 | Open in IMG/M |
3300005764|Ga0066903_106551011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
3300006175|Ga0070712_101459929 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300006176|Ga0070765_101951152 | Not Available | 550 | Open in IMG/M |
3300006755|Ga0079222_12267306 | Not Available | 541 | Open in IMG/M |
3300009094|Ga0111539_12891288 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300010043|Ga0126380_10426871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 994 | Open in IMG/M |
3300010046|Ga0126384_11895839 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300010048|Ga0126373_12628850 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300010159|Ga0099796_10269587 | Not Available | 713 | Open in IMG/M |
3300010343|Ga0074044_10009528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7501 | Open in IMG/M |
3300010343|Ga0074044_10207653 | Not Available | 1300 | Open in IMG/M |
3300010359|Ga0126376_10301099 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
3300010359|Ga0126376_12097506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium oxalatiphilum | 609 | Open in IMG/M |
3300010360|Ga0126372_11633253 | Not Available | 684 | Open in IMG/M |
3300010361|Ga0126378_10852128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1019 | Open in IMG/M |
3300010362|Ga0126377_11883205 | Not Available | 674 | Open in IMG/M |
3300010362|Ga0126377_12875935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 555 | Open in IMG/M |
3300010362|Ga0126377_12922316 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300010366|Ga0126379_10950922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 963 | Open in IMG/M |
3300010398|Ga0126383_12215637 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300010398|Ga0126383_13669996 | Not Available | 501 | Open in IMG/M |
3300010400|Ga0134122_11647758 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300010868|Ga0124844_1153499 | Not Available | 868 | Open in IMG/M |
3300011120|Ga0150983_11887247 | Not Available | 549 | Open in IMG/M |
3300012159|Ga0137344_1006578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1646 | Open in IMG/M |
3300012177|Ga0153943_1106242 | Not Available | 600 | Open in IMG/M |
3300012361|Ga0137360_10456147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1084 | Open in IMG/M |
3300012582|Ga0137358_10841915 | Not Available | 606 | Open in IMG/M |
3300012917|Ga0137395_10604554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 792 | Open in IMG/M |
3300012971|Ga0126369_11989455 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300014968|Ga0157379_12174434 | Not Available | 551 | Open in IMG/M |
3300015371|Ga0132258_10635180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2684 | Open in IMG/M |
3300015374|Ga0132255_101229131 | Not Available | 1129 | Open in IMG/M |
3300016270|Ga0182036_10190108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1497 | Open in IMG/M |
3300016270|Ga0182036_11262260 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300016270|Ga0182036_11292190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300016294|Ga0182041_11369891 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300016319|Ga0182033_10407908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1150 | Open in IMG/M |
3300016357|Ga0182032_10387700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1127 | Open in IMG/M |
3300016387|Ga0182040_10229780 | Not Available | 1382 | Open in IMG/M |
3300016750|Ga0181505_10700902 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300017966|Ga0187776_10128548 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
3300017970|Ga0187783_11222660 | Not Available | 541 | Open in IMG/M |
3300017970|Ga0187783_11244884 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300018089|Ga0187774_10087768 | Not Available | 1499 | Open in IMG/M |
3300020170|Ga0179594_10179369 | Not Available | 790 | Open in IMG/M |
3300020580|Ga0210403_10642703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 854 | Open in IMG/M |
3300021180|Ga0210396_10208379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1745 | Open in IMG/M |
3300021377|Ga0213874_10014920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2040 | Open in IMG/M |
3300021403|Ga0210397_10106493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1902 | Open in IMG/M |
3300021404|Ga0210389_10199425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1561 | Open in IMG/M |
3300021439|Ga0213879_10113018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 769 | Open in IMG/M |
3300021475|Ga0210392_11518131 | Not Available | 501 | Open in IMG/M |
3300021477|Ga0210398_10630884 | Not Available | 869 | Open in IMG/M |
3300025588|Ga0208586_1013497 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
3300025915|Ga0207693_10077140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2609 | Open in IMG/M |
3300027783|Ga0209448_10194015 | Not Available | 674 | Open in IMG/M |
3300027787|Ga0209074_10469402 | Not Available | 541 | Open in IMG/M |
3300027854|Ga0209517_10004206 | All Organisms → cellular organisms → Bacteria | 19054 | Open in IMG/M |
3300027854|Ga0209517_10577893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
3300027903|Ga0209488_10108286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2086 | Open in IMG/M |
3300027911|Ga0209698_11047351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 607 | Open in IMG/M |
3300028704|Ga0307321_1013168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1412 | Open in IMG/M |
3300028716|Ga0307311_10014738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1897 | Open in IMG/M |
3300028754|Ga0307297_10137939 | Not Available | 825 | Open in IMG/M |
3300031474|Ga0170818_106064630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 582 | Open in IMG/M |
3300031543|Ga0318516_10246958 | Not Available | 1032 | Open in IMG/M |
3300031546|Ga0318538_10413359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 730 | Open in IMG/M |
3300031561|Ga0318528_10519974 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300031561|Ga0318528_10625120 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300031573|Ga0310915_10516391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 848 | Open in IMG/M |
3300031680|Ga0318574_10734198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300031715|Ga0307476_10316860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → unclassified Nitrobacter → Nitrobacter sp. Nb-311A | 1145 | Open in IMG/M |
3300031763|Ga0318537_10277834 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300031765|Ga0318554_10528271 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300031796|Ga0318576_10264457 | Not Available | 812 | Open in IMG/M |
3300031823|Ga0307478_11794538 | Not Available | 504 | Open in IMG/M |
3300031890|Ga0306925_10209608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 2102 | Open in IMG/M |
3300031890|Ga0306925_10517094 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1270 | Open in IMG/M |
3300031897|Ga0318520_10087829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1722 | Open in IMG/M |
3300031912|Ga0306921_10844109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1043 | Open in IMG/M |
3300031941|Ga0310912_10423072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1038 | Open in IMG/M |
3300031942|Ga0310916_10205002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1651 | Open in IMG/M |
3300031946|Ga0310910_11158603 | Not Available | 601 | Open in IMG/M |
3300032042|Ga0318545_10315776 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300032054|Ga0318570_10479164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300032091|Ga0318577_10526830 | Not Available | 563 | Open in IMG/M |
3300032160|Ga0311301_12287084 | Not Available | 616 | Open in IMG/M |
3300033289|Ga0310914_11176291 | Not Available | 668 | Open in IMG/M |
3300033289|Ga0310914_11891659 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300033290|Ga0318519_10551393 | Not Available | 697 | Open in IMG/M |
3300033813|Ga0364928_0020816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1311 | Open in IMG/M |
3300033887|Ga0334790_116809 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300034817|Ga0373948_0137052 | Not Available | 603 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.17% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.50% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.50% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.59% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.75% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.75% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.83% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.83% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.83% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.83% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.83% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.83% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.83% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.92% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.92% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.92% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.92% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.92% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.92% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.92% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.92% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.92% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.92% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.92% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
3300012177 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaG | Host-Associated | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
L02_01044150 | 2170459007 | Grass Soil | HVDAASSQAIFDTDRVYFIRVDGNKMMVKSPGVIVPMTGATSIVEFELVKAD |
JGI12270J11330_100091758 | 3300000567 | Peatlands Soil | VQQRLTAHVDTASSQALTGTERVYFMRVEGNRLTMKSPGVIVPMTGKTSIVEIELVKAD* |
AF_2010_repII_A1DRAFT_101457722 | 3300000597 | Forest Soil | TARVDAASSQAIFGTDRVYFMRVDGNKLMVKSPGVIVPMTGATSVVEFELLKAD* |
JGI11643J12802_112964511 | 3300000890 | Soil | SSQAIFDTDRVYFIRVDGSKMMVKSPGVIVPMTGATSIVEFELVKSD* |
JGI12712J15308_100813041 | 3300001471 | Forest Soil | AIFNTDRVYFLRRDGDKMIVKSPGVIVPMTGATSIVEFELVKAD* |
JGIcombinedJ26739_1001684941 | 3300002245 | Forest Soil | KLTAHVDTASSQAITGTERVYFMRVEGNRLTMKSPGVIVPMTGKTSIVEIELVKAD* |
Ga0062387_1009436201 | 3300004091 | Bog Forest Soil | DRVYFMRINDKKLMVKSPGVVVPMTGATSVVEFELVKAD* |
Ga0070733_111791922 | 3300005541 | Surface Soil | VYFIRIAGNKMTVKSPGVIVPMTGKTSVVEFELVKAD* |
Ga0066905_1009944722 | 3300005713 | Tropical Forest Soil | GTDRVYFMRVNGNKLMVKSPGVIVPMTGATSVVEFELVKAD* |
Ga0066903_1003153432 | 3300005764 | Tropical Forest Soil | MRVEGNKLRVKSPGVVVPMTGATSVVEFDLVRAE* |
Ga0066903_1019381111 | 3300005764 | Tropical Forest Soil | AINNTDRVYFMRVNGNKLTVKSPGVINPATGAIIVIEGEHVKVD* |
Ga0066903_1030115052 | 3300005764 | Tropical Forest Soil | RVDAASSEAINNTDRVYFIRATGDRLLFKSPGVIVPMTGATSVVEFEMVKAN* |
Ga0066903_1065510112 | 3300005764 | Tropical Forest Soil | MRVNGNKLMVKSPGVIVPMTGATSVVEFELVKTD* |
Ga0075019_111563621 | 3300006086 | Watersheds | GLEVTARVDTASSPALPGTNRVYFMKVVGAKLTMKSPGVIEPMTGVTSALVIELLRAD* |
Ga0070712_1014599292 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ERDGIKMTAHVDIASSQAITGSDRVYFMRVEGNKLMMKSPGVVVPMTGRNKRR* |
Ga0070765_1019511521 | 3300006176 | Soil | ADRVFFIRVEDNRLVMKSPGVVVPMTGATSSVEIELVQAD* |
Ga0079222_122673062 | 3300006755 | Agricultural Soil | MAIKVTAHVDAASSQAITGNDRVYFMRLDGNKLTVKSPGVVVPMTGATSIVEFDL* |
Ga0111539_128912881 | 3300009094 | Populus Rhizosphere | AIFDTDRVYFIRVDGNKMMVKSPSVIVPMTGATSIVEFELVKSD* |
Ga0116221_10818831 | 3300009523 | Peatlands Soil | GLKATARVDTASNPALPGTDRVYFMKVEGNKLTMKSPGVIEPMTGVTSALVIELVKAD* |
Ga0126380_104268711 | 3300010043 | Tropical Forest Soil | VYFMRVDGNKLMVKSPGVIVPMTGATSVVEFELMKAD* |
Ga0126384_118958392 | 3300010046 | Tropical Forest Soil | DRVYFMRIDGNKLMVKSPGVIVPMTGATSVVEFELVKVD* |
Ga0126373_126288502 | 3300010048 | Tropical Forest Soil | AASSQAIFGTDRVYFMRVDGNKSPGVIVPMTGATSVVEFELVKAD* |
Ga0099796_102695871 | 3300010159 | Vadose Zone Soil | LPVDAASSEAINNTDRVYLMRVDGKKLTVKSPGVIVPMTGATSVVEIELVKAD* |
Ga0074044_1000952812 | 3300010343 | Bog Forest Soil | QAIFDTDRVYVIRVTGNKMIVKSPGVIVPMTGKTSVVEFELVKAD* |
Ga0074044_102076532 | 3300010343 | Bog Forest Soil | QAIFDTDRVYVIRVTGNKMIVKSPGVIVPMTGKTSVVEFELVKSD* |
Ga0126376_103010993 | 3300010359 | Tropical Forest Soil | RVYFMRVDGNKLVVKSPGVIVPMTGATSIVEFELVKAD* |
Ga0126376_120975062 | 3300010359 | Tropical Forest Soil | MRVEGNKLVAKSPGVIVPMTGAKSVVEFELVKAD* |
Ga0126372_116332532 | 3300010360 | Tropical Forest Soil | SSQAIAGTDRVYFMRVDGNKLVVKSPGVIVPMTGATSVVEFELVKAD* |
Ga0126378_108521282 | 3300010361 | Tropical Forest Soil | RVYFMRVDGNKLMVKSPGVIVPMTGATSVVEFELVKAD* |
Ga0126377_118832052 | 3300010362 | Tropical Forest Soil | VDASSSQAIFDTDRVFLIRVDGNKMMVKSPGVLVPMTGAISVVEFDLMKAD* |
Ga0126377_128759351 | 3300010362 | Tropical Forest Soil | DGLKVIARVYTASSQAITGSDRVYFIRVEGDKLQVKSPSDVGPMTGATSVVEFDLVKAE* |
Ga0126377_129223162 | 3300010362 | Tropical Forest Soil | VYFMRVNGNKLMVKSPGVIVPMTGATSVVEFELVKAD* |
Ga0126379_109509221 | 3300010366 | Tropical Forest Soil | GTDRVYFMRVNGDKLMVKSPGVIVPMTGATSVVEFELVKAD* |
Ga0126383_122156372 | 3300010398 | Tropical Forest Soil | IFGTDRVYFMRIDGNKLMVKSPGVIVPMTGATSVVEFELVKAD* |
Ga0126383_136699961 | 3300010398 | Tropical Forest Soil | YFMRIDGNKLMVKSPGVIVPMTGATSVVEFELVKVD* |
Ga0134122_116477582 | 3300010400 | Terrestrial Soil | VYSIQVNGNKMVVKGTVTVPMTGQKSIVEFDLVKSD* |
Ga0124844_11534992 | 3300010868 | Tropical Forest Soil | RVYFVRVDGNKLMVKSPGVIVPMTGATSVVEFELVKAD* |
Ga0150983_118872471 | 3300011120 | Forest Soil | LKATARVDSASSPALPGTDRVYFMKVVGNKLTMKSPGVIEPMTGVTSALVIELVKAD* |
Ga0137344_10065781 | 3300012159 | Soil | RVYLIRVDGNKMMVKSPGVIVPMTGTTSVVEFDCVRAD* |
Ga0153943_11062421 | 3300012177 | Attine Ant Fungus Gardens | LTAHVDAASSQAIFATDRVYLMRVNGNKMTVKSQGAIVPMTGATSVVEFELVKDD* |
Ga0137360_104561473 | 3300012361 | Vadose Zone Soil | RVNGNKLLVKSPGVIVPMTGSTSVVEFEMLKADSGP* |
Ga0137358_108419151 | 3300012582 | Vadose Zone Soil | FMRVNGNKLLVKSPGVIVPMTGATSVVEFEMVKAE* |
Ga0137395_106045542 | 3300012917 | Vadose Zone Soil | YFMRVNGNKLLVKSPGVIVPMTGSTSVVEFEMLKADSGP* |
Ga0126369_119894552 | 3300012971 | Tropical Forest Soil | DAASSQAIFGTDRVYFMRIDGNKLMVKSPGVIVPMTGATSVVEFELVKVD* |
Ga0157379_121744341 | 3300014968 | Switchgrass Rhizosphere | MEPGHLWLDRVYFVRVNGNKMMVKSPGVIVPMTGATSVVEFELVKAD* |
Ga0132258_106351801 | 3300015371 | Arabidopsis Rhizosphere | VDAASSQAIFDTDRVYFIRVDNNKMTVTGRVVVPMSGATSIVEFELEKAE* |
Ga0132255_1012291311 | 3300015374 | Arabidopsis Rhizosphere | VKIFDTDRVYFIRVDGNKMMVKSPGVIVPMTGATSIVEFELVKAD* |
Ga0182036_101901081 | 3300016270 | Soil | IFGTDRVYFMRVNGNKLMVKSPGVIVPMTGATSVVEFELVKAD |
Ga0182036_112622602 | 3300016270 | Soil | VYFMRIDGNKLMVKSPGVIVPMTGATSVVEFELVKAD |
Ga0182036_112921902 | 3300016270 | Soil | FGTDRVYFMRLDGNKLVVKSPGVIVPMTGATSVVEFELVKAD |
Ga0182041_113698912 | 3300016294 | Soil | FGTDRVYFMRIDGNKLMVKSPGVIVPMTGATSVVEFELVKAD |
Ga0182033_104079081 | 3300016319 | Soil | ASSQAIFGTDRVYFMRIDGNKLMVKSPGVIVPMTGATSVVEFELVKVD |
Ga0182032_103877001 | 3300016357 | Soil | YFMRVNGNKLMVKSPGVIVPMTGATSVVEFELVKAD |
Ga0182040_102297801 | 3300016387 | Soil | QAIFDTDRVYFIWVNGNKMMVKGTVTVPMTGQKSIVEFDLVKSD |
Ga0181505_107009021 | 3300016750 | Peatland | AIFGTDRVYFVRVNGNEMTMKSPGVIVPMTGQTSVVEFDLVRSD |
Ga0187776_101285481 | 3300017966 | Tropical Peatland | LTGTNRVYFVRVDGNKLIVKSPSVFVPATGQTSVVELEFVKTD |
Ga0187783_112226601 | 3300017970 | Tropical Peatland | VDAASSQAIFDTDRVYFIRVNGNKMMVKGNVIVPMTGQTSVVEFELVKSD |
Ga0187783_112448842 | 3300017970 | Tropical Peatland | SSQAIAGNERVYFMRVEGSKLTVKSPGVVVPMTGAISVVEFELVKSE |
Ga0187774_100877681 | 3300018089 | Tropical Peatland | VYFVRVNGNKLIVKSPSVFVPATGQTSVVELEFVKTD |
Ga0179594_101793692 | 3300020170 | Vadose Zone Soil | DRVYIMRVNGNKLTVKSPGVIVPMTGATSIVEFELVKAD |
Ga0210403_106427032 | 3300020580 | Soil | KITVHVDAAPSQAITGMDRPYFVRVDGSKAVFKSPGVIVPMTGAMSVVEFEMVKADY |
Ga0210396_102083793 | 3300021180 | Soil | TDRVYFFRRDGDKMIVKSPGVIVPMTGATSIVEFELVKAD |
Ga0213874_100149203 | 3300021377 | Plant Roots | IFDTDRVYFIRVDGNKMTVKSPGVIVPMTGQMNVVEFELVKSE |
Ga0210397_101064932 | 3300021403 | Soil | RVYFLRRYGDKMIVKSPGVIVPMTGATSIVEFELVKAD |
Ga0210389_101994251 | 3300021404 | Soil | YFLRRDGDKMIVKSPGVIVPMTGATSIVEFELVKAD |
Ga0213879_101130181 | 3300021439 | Bulk Soil | YFIRVDGNKMMVKGSVIVPMTGQTSIVEFELVKSD |
Ga0210392_115181312 | 3300021475 | Soil | YFIRVNDNKLMVKSPGVIVPMTGQTSIVEFDLVKSD |
Ga0210398_106308843 | 3300021477 | Soil | TAHVDTASSQAITGTERVYFMRVEGNRLTMKSPGVIVPMTGKTSIVEIELVKAD |
Ga0208586_10134972 | 3300025588 | Arctic Peat Soil | LTAHVDTVSSQAITGNDRVYFMRVEGNKLNVKSPGVIVPMTGKKSVVEFDLVKAD |
Ga0207693_100771405 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ITGDERVFFIRVEDNRLVMKSPGVVVPMTGATSSVEIELVQAD |
Ga0209448_101940151 | 3300027783 | Bog Forest Soil | DRVYFMRINDKKLMVKSPGVVVPMTGATSVVEFELVKAD |
Ga0209074_104694022 | 3300027787 | Agricultural Soil | MAIKVTAHVDAASSQAITGNDRVYFMRLDGNKLTVKSPGVVVPMTGATSIVEFDL |
Ga0209517_100042065 | 3300027854 | Peatlands Soil | VQQRLTAHVDTASSQALTGTERVYFMRVEGNRLTMKSPGVIVPMTGKTSIVEIELVKAD |
Ga0209517_105778932 | 3300027854 | Peatlands Soil | ASSQAITGTDRVYFMRVDGNKLMMKSPGVIVPMTGATSVVEIELVKAD |
Ga0209488_101082862 | 3300027903 | Vadose Zone Soil | LPVDAASSEAINNTDRVYLMRVDGKKLTVKSPGVIVPMTGATSVVEIELVKAD |
Ga0209698_110473511 | 3300027911 | Watersheds | KLTAHVDAASSQAIFDTDRIYFIRVDNNKMTVTGRVVVPMTGATSIVEFELVYASDERRL |
Ga0307321_10131681 | 3300028704 | Soil | MEGAARLDKMMVKSPGVIVPMTGATSIVEFELVKDD |
Ga0307311_100147384 | 3300028716 | Soil | EGAARLDKMMVKSPGVIVPMTGATSIVEFELVKDD |
Ga0307297_101379392 | 3300028754 | Soil | LTARVDAASSQAIFDTDRVYFIRFDGNKMMVKSPSVIVPMTGATSIVEFELVKAD |
Ga0311338_118613191 | 3300030007 | Palsa | GLKATARVDTASSPALPGTDRVYFMKVEGGKLTMKSPGVIEPMTGITSALVIELAKAD |
Ga0170818_1060646302 | 3300031474 | Forest Soil | SSQVIFDTDRIYSIRIDNNKMTATGKVVVPMTGATSIVEFELVKAD |
Ga0318516_102469582 | 3300031543 | Soil | LTARVDAASSQAIFGTDRVYFMRIDGNKLMVKSPGVIVPMTGATSVVEFELVKVD |
Ga0318538_104133592 | 3300031546 | Soil | TDRVYFIRVNGNEMMVKGTVTVPMTGQKSIVEFALVKSD |
Ga0318528_105199742 | 3300031561 | Soil | VYFMRLDGNKLVVKSPGVIVPMTGATSVVEFELVKAD |
Ga0318528_106251202 | 3300031561 | Soil | SSQAIFGTDRVYFMRLDGNKLMVKSPGVIVPMTGATSVVEFELVKAD |
Ga0310915_105163912 | 3300031573 | Soil | FMRVNGNKLMVKSPGVIVPMTGATSVVEFELVKAD |
Ga0318574_107341982 | 3300031680 | Soil | RVYFMRVDGNKLMAKSPGVIVPMTGATSVVEFELVKAD |
Ga0307476_103168602 | 3300031715 | Hardwood Forest Soil | FIRVDGDKMKVKSPGVIVPMTGATSIVEFELVKAD |
Ga0318537_102778341 | 3300031763 | Soil | DRVYFMRIDGNKLMVKSPGVIVPMTGATSVVEFELVKAD |
Ga0318554_105282711 | 3300031765 | Soil | AIFGTDRVYFMRIDGNKLMVKSPGVIVPMTGATSVVEFELVKAD |
Ga0318576_102644571 | 3300031796 | Soil | RVYFMRVDGDKLTVKSPGVVVPVTGATSVVEFELVKTE |
Ga0307478_117945382 | 3300031823 | Hardwood Forest Soil | FNTDRVYFLRRDGDKMIVKSPGVIVPMTGATSIVEFELVKAD |
Ga0306925_102096081 | 3300031890 | Soil | FMHVDGNKLTVKSPGVVVPVTGAISVIEFELIRAQ |
Ga0306925_105170943 | 3300031890 | Soil | ASNQAIFDSDRVYFIRVHGNKMMVKSPGVIMTGQTSVVEFELVKAD |
Ga0318520_100878292 | 3300031897 | Soil | LTARVDAASSQAIFGTDRVYFMRIDGNKLMVKSPGVIVPMTGATSVVEFELVKAD |
Ga0306921_108441091 | 3300031912 | Soil | VYFMRIDGNKLMVKSPGVIVPMTGATSVVEFELVKVD |
Ga0310912_104230721 | 3300031941 | Soil | SSQAIFDTDRVYFIWVNGNKMMVKGTVTVPMTGQKSIVEFDLVKSN |
Ga0310916_102050022 | 3300031942 | Soil | AIFGTDRVYFMRVNGNKLMVKSPGVIVPMTGATSVVEFELVKAD |
Ga0310910_111586031 | 3300031946 | Soil | AHVDAASSQTIFDTDRVYFIRVNGNEMMVKGTVTVPMTGQKSIVEFALVKSD |
Ga0318545_103157761 | 3300032042 | Soil | AASSQAIFGTDRVYFMRIDGNKLMVKSPGVIVPMTGATSVVEFELVKAD |
Ga0318570_104791641 | 3300032054 | Soil | FMRLDGNKLVVKSPGVIVPMTGATSVVEFELVKAD |
Ga0318577_105268302 | 3300032091 | Soil | HVDAASSQAIVGNDRIYFVRVRGNKITFKSPGVIVPMTGKTSVVEFEMTRSQ |
Ga0311301_122870841 | 3300032160 | Peatlands Soil | ASSQAIFDTDRVYFVRVNGNKMMVKSPGVIVPMTGQTSVVEFDLVKAD |
Ga0310914_111762913 | 3300033289 | Soil | AIFDTDRVYFIWVNGNKMMVKGTVTVPMTGQKSIVEFDLVKSD |
Ga0310914_118916591 | 3300033289 | Soil | VDAASSQAIFGTDRVYFMRLDGNKLMVKSPGVIVPMTGATSVVEFELVKAD |
Ga0318519_105513932 | 3300033290 | Soil | RVYFMRLDGNKLVVKSPGVIVPMTGATSVVEFELVKAD |
Ga0364928_0020816_1198_1311 | 3300033813 | Sediment | VYFIRVDGNKMMVKSPGVIVPMTGATSIVEFELVKAD |
Ga0334790_116809_1_162 | 3300033887 | Soil | AHVDAASSQAIFDTDRVYFIRVEGNKMTVKSPGVIVPMTGATSIVEFELVKAD |
Ga0373948_0137052_78_215 | 3300034817 | Rhizosphere Soil | VKIFDTDRVYFIRVDGNKMMVKSPGVIVPMTGATSIVEFELVKAD |
⦗Top⦘ |