Basic Information | |
---|---|
Family ID | F089474 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 109 |
Average Sequence Length | 44 residues |
Representative Sequence | LHRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNP |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 94.50 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 97.25 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.083 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (39.450 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.872 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (67.890 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 55.56% β-sheet: 0.00% Coil/Unstructured: 44.44% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF16363 | GDP_Man_Dehyd | 87.16 |
PF01370 | Epimerase | 10.09 |
PF02655 | ATP-grasp_3 | 0.92 |
PF09913 | DUF2142 | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.08 % |
Unclassified | root | N/A | 0.92 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001333|A21PFW6_1036979 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300001537|A2065W1_11010551 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300004081|Ga0063454_101960188 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300004643|Ga0062591_100229776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1394 | Open in IMG/M |
3300005440|Ga0070705_101057184 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300005458|Ga0070681_11005554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
3300005543|Ga0070672_101139135 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300005552|Ga0066701_10740856 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 588 | Open in IMG/M |
3300005561|Ga0066699_11187752 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300005937|Ga0081455_10657378 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300006163|Ga0070715_10127546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1220 | Open in IMG/M |
3300006237|Ga0097621_101828913 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300006797|Ga0066659_11870474 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300006800|Ga0066660_11405603 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300006871|Ga0075434_102076818 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300009137|Ga0066709_100007033 | All Organisms → cellular organisms → Bacteria | 9643 | Open in IMG/M |
3300009553|Ga0105249_11352361 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300010084|Ga0127461_1075245 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300010086|Ga0127496_1004744 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300010087|Ga0127492_1079883 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300010092|Ga0127468_1101104 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300010093|Ga0127490_1012348 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300010095|Ga0127475_1024643 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300010099|Ga0127450_1065245 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300010104|Ga0127446_1105168 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300010112|Ga0127458_1108123 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300010117|Ga0127449_1142021 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300010119|Ga0127452_1107555 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300010122|Ga0127488_1164910 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300010128|Ga0127486_1013152 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300010140|Ga0127456_1220943 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300010142|Ga0127483_1144298 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300010145|Ga0126321_1245184 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300010359|Ga0126376_10542687 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 1086 | Open in IMG/M |
3300011106|Ga0151489_1274728 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300011998|Ga0120114_1047634 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300012189|Ga0137388_10683167 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300012198|Ga0137364_11318238 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300012211|Ga0137377_10004760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10735 | Open in IMG/M |
3300012224|Ga0134028_1035675 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300012224|Ga0134028_1179134 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300012358|Ga0137368_10245815 | Not Available | 1239 | Open in IMG/M |
3300012359|Ga0137385_11422191 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300012374|Ga0134039_1034891 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
3300012379|Ga0134058_1147549 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300012383|Ga0134033_1238443 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300012385|Ga0134023_1038216 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 626 | Open in IMG/M |
3300012385|Ga0134023_1120780 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300012386|Ga0134046_1248134 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300012389|Ga0134040_1107668 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300012390|Ga0134054_1232325 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300012391|Ga0134035_1112509 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300012393|Ga0134052_1187286 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300012395|Ga0134044_1001684 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300012395|Ga0134044_1069057 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300012395|Ga0134044_1076838 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300012398|Ga0134051_1356249 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300012399|Ga0134061_1068922 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300012399|Ga0134061_1347142 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300012400|Ga0134048_1280158 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300012402|Ga0134059_1203222 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
3300012402|Ga0134059_1224194 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
3300012402|Ga0134059_1370348 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300012403|Ga0134049_1070968 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300012407|Ga0134050_1017338 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300012407|Ga0134050_1062347 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300012410|Ga0134060_1358428 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300012469|Ga0150984_104108164 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300012469|Ga0150984_108577099 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 820 | Open in IMG/M |
3300012898|Ga0157293_10094943 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300012918|Ga0137396_10778671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → environmental samples → uncultured Nocardioides sp. | 704 | Open in IMG/M |
3300012929|Ga0137404_10796914 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300012972|Ga0134077_10458287 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300012985|Ga0164308_10479627 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 1036 | Open in IMG/M |
3300015359|Ga0134085_10453268 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300015371|Ga0132258_10667560 | All Organisms → cellular organisms → Bacteria | 2615 | Open in IMG/M |
3300019255|Ga0184643_1129421 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
3300019269|Ga0184644_1024159 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300019279|Ga0184642_1097232 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300019279|Ga0184642_1724738 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300019875|Ga0193701_1012945 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
3300020000|Ga0193692_1116612 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300020001|Ga0193731_1117839 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300021080|Ga0210382_10356240 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300025911|Ga0207654_11008058 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300025916|Ga0207663_10926118 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 697 | Open in IMG/M |
3300026095|Ga0207676_10429480 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
3300027748|Ga0209689_1346095 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300028711|Ga0307293_10282614 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300028713|Ga0307303_10185350 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300028718|Ga0307307_10307006 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300028791|Ga0307290_10345879 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300028793|Ga0307299_10274303 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300028796|Ga0307287_10192057 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300028802|Ga0307503_10609629 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300028807|Ga0307305_10275205 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300028807|Ga0307305_10410417 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300028811|Ga0307292_10075033 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
3300028811|Ga0307292_10204006 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300028814|Ga0307302_10120172 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
3300028814|Ga0307302_10623897 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300028881|Ga0307277_10249260 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300028884|Ga0307308_10434897 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300030785|Ga0102757_11280384 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300030903|Ga0308206_1024942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → environmental samples → uncultured Nocardioides sp. | 1043 | Open in IMG/M |
3300030993|Ga0308190_1022892 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300031058|Ga0308189_10414573 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300031094|Ga0308199_1129381 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300031366|Ga0307506_10276265 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 39.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 22.94% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.42% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.59% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.75% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.83% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.92% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.92% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001333 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illumina | Environmental | Open in IMG/M |
3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010084 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010086 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010087 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010092 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010093 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010095 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010099 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010104 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010112 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010119 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010122 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300030785 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A21PFW6_10369791 | 3300001333 | Permafrost | LPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDSMTLHGN |
A2065W1_110105511 | 3300001537 | Permafrost | LPRRIGVAAAIVFVAAVLCVPAAEAKAHMLIGIQDDAMTLRGNPTFTFPTLKQLR |
Ga0063454_1019601881 | 3300004081 | Soil | LHKRVGVFAAIVFLAAALSVPAAQAKRHMLIGLQDDAMTLFGN |
Ga0062591_1002297761 | 3300004643 | Soil | LFRRIGVAAAIILVAAGLAVPAAQAKAHMLVGLQDDAMTLRGNPTFTFSTLK |
Ga0070705_1010571841 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LPRRIGVFAAIVLVAAGLAVPAAQAQRHLLVGVQDDAMTLRGNPTFTFST |
Ga0070681_110055541 | 3300005458 | Corn Rhizosphere | LRRRMGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMALHGNPQFTFSTLKS |
Ga0070672_1011391352 | 3300005543 | Miscanthus Rhizosphere | LRRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNPS |
Ga0066701_107408562 | 3300005552 | Soil | LHRRFGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAM |
Ga0066699_111877521 | 3300005561 | Soil | LRRRLGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMVLRGNPIFTF |
Ga0081455_106573782 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LRRRIGVIVATALVAVGLCVPTAQAQRRLLVGMQDDAMVLRGDPTFTFR |
Ga0070715_101275462 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMTLHGNPQFTFST |
Ga0097621_1018289132 | 3300006237 | Miscanthus Rhizosphere | LHRRLGVLAAIVFLAAALSVPAAQAKRHMLIGLQDDAMTLFGNPTFTFR |
Ga0066659_118704741 | 3300006797 | Soil | LPRRLGVLAAIVFAAAGLCVPAASAKAHMLVGIQDDALT |
Ga0066660_114056032 | 3300006800 | Soil | VALLVAAGLSAPAATASRHMLVGIQDEANTLYGNPDQ |
Ga0075434_1020768181 | 3300006871 | Populus Rhizosphere | LHRRIGVVAATVLVAAGLCVPAATAARHLLVGIQDDAMVLRGNPTFTFGMLKQLR |
Ga0066709_1000070331 | 3300009137 | Grasslands Soil | LHRRFGVFAAIVLVSAGLSVPAAQAQRHLLVGIQDDAM |
Ga0105249_113523612 | 3300009553 | Switchgrass Rhizosphere | MGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMTLHGNPQFTFSTLKSL |
Ga0127461_10752451 | 3300010084 | Grasslands Soil | LPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGNPTFT |
Ga0127496_10047441 | 3300010086 | Grasslands Soil | LRRRIGVFAAIVLVAAGLAVPAAQAQRHLLVGVQDDAMTLRGN |
Ga0127492_10798832 | 3300010087 | Grasslands Soil | LPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGNPTVTFQ |
Ga0127468_11011042 | 3300010092 | Grasslands Soil | LRRRVGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMTLRGDPTFT |
Ga0127490_10123481 | 3300010093 | Grasslands Soil | LHKRVGVFAAIVFLAAALSVPAAQAKRHMLIGLQDD |
Ga0127475_10246431 | 3300010095 | Grasslands Soil | LRRRVGVFAAIVLVAAGLAVPAAQAQRHLLVGVQDDAMTLRGNP |
Ga0127450_10652451 | 3300010099 | Grasslands Soil | LAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMVLRGNPQFTFST |
Ga0127446_11051682 | 3300010104 | Grasslands Soil | LRRRVGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMTLRGDP |
Ga0127458_11081232 | 3300010112 | Grasslands Soil | LRRSLGVLAAIILFAAGLSVPAAQAKQHMLVGLQDDAMVLY |
Ga0127449_11420212 | 3300010117 | Grasslands Soil | LPRRIGVAAAIVFVAAVLCVPVAQAKAHMLVGIQDDAMTLHGNPT |
Ga0127452_11075552 | 3300010119 | Grasslands Soil | LFRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGNPTVTF |
Ga0127488_11649102 | 3300010122 | Grasslands Soil | LAAIVLVAAGFAVPAAQAQRHLLVGIQDDAMVLRGNPQ |
Ga0127486_10131522 | 3300010128 | Grasslands Soil | LPRRLGVFAAIVLVVAGLSVPAAQAKRHLLVGIQDDSMTLRGNP |
Ga0127456_12209432 | 3300010140 | Grasslands Soil | LPRRIGVAAAIVFVAAVLYVPVAQAKAHMLVGIQDDAMTLHGNPTFTFPTLK |
Ga0127483_11442982 | 3300010142 | Grasslands Soil | LHKRVGVFAAIVFLAAALSVPAAQAKRHMLIGLQD |
Ga0126321_12451842 | 3300010145 | Soil | LPKRLGVLAAIVLLAAGLSVPAAQAKRGMLIGIQDDAMVLFGN |
Ga0126376_105426871 | 3300010359 | Tropical Forest Soil | LPKNIGVFAATVFLAAALAVPAAQAKNHMLVGMQDD |
Ga0151489_12747282 | 3300011106 | Soil | LRRRIGVAAAIVLVAASLAEPAAQAKQHMLVGIQDDAMTL |
Ga0120114_10476342 | 3300011998 | Permafrost | LPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDSMTLHGNPTFTFPTL |
Ga0137388_106831671 | 3300012189 | Vadose Zone Soil | LPRRIGVAAAIVFVAAVLCVPAAEAKAHMLIGIQDDAMTLRGDPTFTFPTLKQLRT |
Ga0137364_113182382 | 3300012198 | Vadose Zone Soil | VVAAAIVLIAAGLAVPAAQAKAHMLVGIQDDSMTLHGNPTFTFTTLK |
Ga0137377_100047601 | 3300012211 | Vadose Zone Soil | LAAIVLVAAGLCVPAASAKAHMLVGIQDDALTLHGNPTFTFPTLKQ |
Ga0134028_10356751 | 3300012224 | Grasslands Soil | LHRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNPTFTF |
Ga0134028_11791341 | 3300012224 | Grasslands Soil | LPRRIGVAAAIAFAAAGLCVPVASAKAHMLVGIQD |
Ga0137368_102458152 | 3300012358 | Vadose Zone Soil | LPRRIGVFAAIVLVAAGLCVPAAQAQRHLLVGMQDDSMA |
Ga0137385_114221911 | 3300012359 | Vadose Zone Soil | LPRRIGVAAAIVFVAAGLCVPVASAKAHMLVGIQDDAMTLRGNPTFTFPTLKQL |
Ga0134039_10348912 | 3300012374 | Grasslands Soil | LRRRVGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMTLRGDPTFTFPILK |
Ga0134058_11475491 | 3300012379 | Grasslands Soil | LRRRIGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDA |
Ga0134033_12384432 | 3300012383 | Grasslands Soil | LRRRIGVFAAIVLVAAGLAVPAAQAQRHLLVGVQDDAMTLRGNP |
Ga0134023_10382161 | 3300012385 | Grasslands Soil | LHRRFGVFAAIVFVAAALSVPAAQAKNHMLIGMQDDA |
Ga0134023_11207802 | 3300012385 | Grasslands Soil | LAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMVLRGNPQFTFSTLKQLR |
Ga0134046_12481342 | 3300012386 | Grasslands Soil | LLRRTAFIAALVLVAAGLAIPAAQAKQHMLVGIQDDAMTLRGNPTV |
Ga0134040_11076681 | 3300012389 | Grasslands Soil | VVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMTLRGNPTFTFSTLK |
Ga0134054_12323251 | 3300012390 | Grasslands Soil | LFRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTL |
Ga0134035_11125091 | 3300012391 | Grasslands Soil | LRRRLGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMTLRGNPTFTFSTLKQLR |
Ga0134052_11872862 | 3300012393 | Grasslands Soil | LRRRLGVFAAIVLVAAGLAVPAAQAQRHLLVGVQDDAMTLRGNPQFT |
Ga0134044_10016841 | 3300012395 | Grasslands Soil | LRRSLGVLAAIILLAAGLSVPAAQAKQHMLVGLQDDAMVL |
Ga0134044_10690571 | 3300012395 | Grasslands Soil | LRKRIGVFAAIALLAAALSVPAAQAKRHMLIGLQDDAMVL |
Ga0134044_10768382 | 3300012395 | Grasslands Soil | LRRRIGVFAAIVLVAAGLAVPAAQAQRHLLVGVQDDAMTLRGNPTFTFSTLKQ |
Ga0134051_13562492 | 3300012398 | Grasslands Soil | LRRRLGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMTLRGDPTFTFPILKQLR |
Ga0134061_10689222 | 3300012399 | Grasslands Soil | LRRRIGVFAAIFFLAAGLSVPAAQAKRHMLIGIQDD |
Ga0134061_13471422 | 3300012399 | Grasslands Soil | LPRRIGVAAAIVFVAAVLCVPVAQAKAHMLVGIQD |
Ga0134048_12801582 | 3300012400 | Grasslands Soil | LHRRFGVFAAIVFVAAALSVPAAQAKNHMLIGMQDD |
Ga0134059_12032221 | 3300012402 | Grasslands Soil | LHRRLGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDATVLHGNPTFTF |
Ga0134059_12241942 | 3300012402 | Grasslands Soil | LRRQLGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDD |
Ga0134059_13703482 | 3300012402 | Grasslands Soil | LPRRIGVAAAIVFVAAGLCVPAASAKAHMLIGIQDDAMTLRGNP |
Ga0134049_10709681 | 3300012403 | Grasslands Soil | LPRRIGVAAAIVFVAAGLCVPAASAKAHMLIGIQDDAM |
Ga0134050_10173382 | 3300012407 | Grasslands Soil | LRRRLGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMTLRGDPTFTFPILKQL |
Ga0134050_10623471 | 3300012407 | Grasslands Soil | LPRRIGVAAAIVFVAAVLCVPVAQAKAHMLVGIQDDAMTLH |
Ga0134060_13584282 | 3300012410 | Grasslands Soil | LRRRLGVFAAIVLVAAGLAVPAAQAQRHLLVGVQDDAMTLRGNSQFTFS |
Ga0150984_1041081641 | 3300012469 | Avena Fatua Rhizosphere | LLRRAGILTAIALVVVGLAVPAAQAKRHMLVGIQDD |
Ga0150984_1085770991 | 3300012469 | Avena Fatua Rhizosphere | LRRRIGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAM |
Ga0157293_100949432 | 3300012898 | Soil | LRRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTL |
Ga0137396_107786711 | 3300012918 | Vadose Zone Soil | LPSRIGVAAAIVFVAASLCVPVASAKAHMLVGIQDDAMTLQGNPT |
Ga0137404_107969142 | 3300012929 | Vadose Zone Soil | LPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGN |
Ga0134077_104582872 | 3300012972 | Grasslands Soil | LRRRLGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMTLR |
Ga0164308_104796271 | 3300012985 | Soil | LRRRIGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMTLHGNPQ |
Ga0134085_104532682 | 3300015359 | Grasslands Soil | LAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNPAFTFGTLK |
Ga0132258_106675604 | 3300015371 | Arabidopsis Rhizosphere | LPKRIGVILATALAAVGLCVPAAQAQRHLLVGLQDD |
Ga0184643_11294212 | 3300019255 | Groundwater Sediment | LPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQD |
Ga0184644_10241592 | 3300019269 | Groundwater Sediment | LPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGNP |
Ga0184642_10972321 | 3300019279 | Groundwater Sediment | LRRRIGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMTLH |
Ga0184642_17247382 | 3300019279 | Groundwater Sediment | LRRRIGVAAAIVLVAAGLAVPAAQAKPHMLVGIQDDAMTLRGNPTFTFGTLK |
Ga0193701_10129451 | 3300019875 | Soil | LPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGTPTFTFQ |
Ga0193692_11166121 | 3300020000 | Soil | LRRRIGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMTLHG |
Ga0193731_11178392 | 3300020001 | Soil | LPRRIGVAAAIVFVAASLCVPAASAKAHMLVGIQD |
Ga0210382_103562402 | 3300021080 | Groundwater Sediment | LLRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGN |
Ga0207654_110080581 | 3300025911 | Corn Rhizosphere | MGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMTLHGNP |
Ga0207663_109261182 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMALHGNPQFTFST |
Ga0207676_104294803 | 3300026095 | Switchgrass Rhizosphere | MGVAAAIVLVAEGLAVPAAQAKQHMLVGIQDDAMTLHG |
Ga0209689_13460952 | 3300027748 | Soil | LPRRIGVAAAIVFVAAGLCVPVASAKAHMLVGIQDDAMTLHGNPTFTFPTLKQL |
Ga0307293_102826141 | 3300028711 | Soil | LFRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNPTFTFSTLK |
Ga0307303_101853501 | 3300028713 | Soil | LLRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDSMTLRGNPTFTFSTLK |
Ga0307307_103070061 | 3300028718 | Soil | LPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGNPTLT |
Ga0307290_103458791 | 3300028791 | Soil | LFRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDD |
Ga0307299_102743032 | 3300028793 | Soil | LPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGNPTFTFQTLK |
Ga0307287_101920571 | 3300028796 | Soil | LRKRIGVFAAIALLAAALSVPAAQAKRHMLIGLQDDAMVLF |
Ga0307503_106096292 | 3300028802 | Soil | LRRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNPSFTFP |
Ga0307305_102752051 | 3300028807 | Soil | LFRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNPTFTF |
Ga0307305_104104172 | 3300028807 | Soil | LPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAM |
Ga0307292_100750331 | 3300028811 | Soil | LFRRIGVAAAIVFVAAGLSVPAAQAKAHMLVGIQDDAMTL |
Ga0307292_102040061 | 3300028811 | Soil | LPRRIGVAAAIVLVAAGLAVPAASAKAHMLIGIQDDAMT |
Ga0307302_101201721 | 3300028814 | Soil | LPRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGLQDDAMTLRGNPTSTF |
Ga0307302_106238972 | 3300028814 | Soil | LPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGNTTFTFQT |
Ga0307277_102492602 | 3300028881 | Soil | LPRRIGVAAAIVLVAAGLAVPAASAKAHMLVGIQDDA |
Ga0307308_104348972 | 3300028884 | Soil | LRRRIGVAAAIVFVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNPT |
Ga0102757_112803842 | 3300030785 | Soil | LHRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNP |
Ga0308206_10249422 | 3300030903 | Soil | LRRRIGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMTLHGNPQFT |
Ga0308190_10228921 | 3300030993 | Soil | LRRRIGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMALHGNP |
Ga0308189_104145732 | 3300031058 | Soil | LPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRG |
Ga0308199_11293811 | 3300031094 | Soil | LPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGNPTFTF |
Ga0307506_102762652 | 3300031366 | Soil | LRRRIGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMT |
⦗Top⦘ |