Basic Information | |
---|---|
Family ID | F089581 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 109 |
Average Sequence Length | 41 residues |
Representative Sequence | LLDQIAEPLRVAARADEVVRGPAEHPSGVDGITVGITV |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 96.33 % |
% of genes from short scaffolds (< 2000 bps) | 91.74 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (51.376 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.688 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.018 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.046 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.18% β-sheet: 6.06% Coil/Unstructured: 75.76% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF04909 | Amidohydro_2 | 32.11 |
PF13280 | WYL | 5.50 |
PF12802 | MarR_2 | 4.59 |
PF10009 | DUF2252 | 2.75 |
PF03706 | LPG_synthase_TM | 0.92 |
PF13412 | HTH_24 | 0.92 |
PF01022 | HTH_5 | 0.92 |
PF00005 | ABC_tran | 0.92 |
PF01458 | SUFBD | 0.92 |
PF03781 | FGE-sulfatase | 0.92 |
COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
---|---|---|---|
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
COG0719 | Fe-S cluster assembly scaffold protein SufB | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 51.38 % |
Unclassified | root | N/A | 48.62 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10363038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
3300003218|JGI26339J46600_10134304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10286098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 670 | Open in IMG/M |
3300004635|Ga0062388_100339827 | Not Available | 1274 | Open in IMG/M |
3300005338|Ga0068868_101570544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 617 | Open in IMG/M |
3300005434|Ga0070709_10998792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 665 | Open in IMG/M |
3300005434|Ga0070709_11487671 | Not Available | 550 | Open in IMG/M |
3300005454|Ga0066687_10599202 | Not Available | 654 | Open in IMG/M |
3300005455|Ga0070663_100012280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 5412 | Open in IMG/M |
3300005535|Ga0070684_100525803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1097 | Open in IMG/M |
3300005602|Ga0070762_10535398 | Not Available | 771 | Open in IMG/M |
3300005602|Ga0070762_11186779 | Not Available | 528 | Open in IMG/M |
3300005610|Ga0070763_10715058 | Not Available | 587 | Open in IMG/M |
3300006173|Ga0070716_101252538 | Not Available | 598 | Open in IMG/M |
3300006176|Ga0070765_100296873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1492 | Open in IMG/M |
3300006573|Ga0074055_11870376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
3300006755|Ga0079222_10564488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 857 | Open in IMG/M |
3300006806|Ga0079220_10849564 | Not Available | 699 | Open in IMG/M |
3300006881|Ga0068865_100207835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1523 | Open in IMG/M |
3300006893|Ga0073928_10164631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1774 | Open in IMG/M |
3300006954|Ga0079219_12029614 | Not Available | 548 | Open in IMG/M |
3300009672|Ga0116215_1398738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 596 | Open in IMG/M |
3300009700|Ga0116217_10446805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 816 | Open in IMG/M |
3300009700|Ga0116217_10648880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 655 | Open in IMG/M |
3300009792|Ga0126374_10320721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1048 | Open in IMG/M |
3300009839|Ga0116223_10898702 | Not Available | 505 | Open in IMG/M |
3300010043|Ga0126380_10354620 | Not Available | 1069 | Open in IMG/M |
3300010048|Ga0126373_12507480 | Not Available | 575 | Open in IMG/M |
3300010371|Ga0134125_12508633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
3300010373|Ga0134128_13202165 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300010375|Ga0105239_10488388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1399 | Open in IMG/M |
3300012199|Ga0137383_10802218 | Not Available | 687 | Open in IMG/M |
3300012201|Ga0137365_10580013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 822 | Open in IMG/M |
3300012208|Ga0137376_10167997 | Not Available | 1892 | Open in IMG/M |
3300012917|Ga0137395_10739097 | Not Available | 712 | Open in IMG/M |
3300012961|Ga0164302_10135904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1424 | Open in IMG/M |
3300012989|Ga0164305_10385621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1068 | Open in IMG/M |
3300016270|Ga0182036_10690187 | Not Available | 825 | Open in IMG/M |
3300017928|Ga0187806_1051969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1248 | Open in IMG/M |
3300017930|Ga0187825_10378109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis pithecellobii | 541 | Open in IMG/M |
3300017974|Ga0187777_10600909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 775 | Open in IMG/M |
3300017995|Ga0187816_10554897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 517 | Open in IMG/M |
3300018007|Ga0187805_10635864 | Not Available | 505 | Open in IMG/M |
3300018047|Ga0187859_10826036 | Not Available | 533 | Open in IMG/M |
3300018062|Ga0187784_10099882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae | 2361 | Open in IMG/M |
3300018090|Ga0187770_11654391 | Not Available | 523 | Open in IMG/M |
3300020581|Ga0210399_10909458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 713 | Open in IMG/M |
3300021180|Ga0210396_10423735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1169 | Open in IMG/M |
3300021401|Ga0210393_11183116 | Not Available | 616 | Open in IMG/M |
3300021406|Ga0210386_11253473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 625 | Open in IMG/M |
3300021407|Ga0210383_10057643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3240 | Open in IMG/M |
3300021407|Ga0210383_10851608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 778 | Open in IMG/M |
3300021474|Ga0210390_10258086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1476 | Open in IMG/M |
3300021478|Ga0210402_10285041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1528 | Open in IMG/M |
3300021478|Ga0210402_11609903 | Not Available | 576 | Open in IMG/M |
3300021860|Ga0213851_1573378 | Not Available | 553 | Open in IMG/M |
3300024219|Ga0247665_1014279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 937 | Open in IMG/M |
3300025905|Ga0207685_10815432 | Not Available | 515 | Open in IMG/M |
3300025907|Ga0207645_10674008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 703 | Open in IMG/M |
3300025928|Ga0207700_11662973 | Not Available | 564 | Open in IMG/M |
3300025929|Ga0207664_10388559 | Not Available | 1240 | Open in IMG/M |
3300026557|Ga0179587_11036034 | Not Available | 540 | Open in IMG/M |
3300027505|Ga0209218_1110591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
3300027609|Ga0209221_1007249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2836 | Open in IMG/M |
3300027648|Ga0209420_1005788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 4933 | Open in IMG/M |
3300027725|Ga0209178_1426697 | Not Available | 507 | Open in IMG/M |
3300027767|Ga0209655_10260179 | Not Available | 564 | Open in IMG/M |
3300027775|Ga0209177_10436930 | Not Available | 532 | Open in IMG/M |
3300027855|Ga0209693_10268538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 835 | Open in IMG/M |
3300027857|Ga0209166_10085688 | Not Available | 1774 | Open in IMG/M |
3300027857|Ga0209166_10112397 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
3300027869|Ga0209579_10298219 | Not Available | 869 | Open in IMG/M |
3300027882|Ga0209590_10186235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1306 | Open in IMG/M |
3300028146|Ga0247682_1026472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1025 | Open in IMG/M |
3300028380|Ga0268265_12115913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis pithecellobii | 570 | Open in IMG/M |
3300028759|Ga0302224_10422821 | Not Available | 542 | Open in IMG/M |
3300028768|Ga0307280_10062132 | Not Available | 1187 | Open in IMG/M |
3300030007|Ga0311338_10265078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1921 | Open in IMG/M |
3300031572|Ga0318515_10778809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 505 | Open in IMG/M |
3300031681|Ga0318572_10385325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 833 | Open in IMG/M |
3300031708|Ga0310686_106860314 | Not Available | 614 | Open in IMG/M |
3300031708|Ga0310686_117009115 | Not Available | 693 | Open in IMG/M |
3300031769|Ga0318526_10335268 | Not Available | 618 | Open in IMG/M |
3300031770|Ga0318521_10828097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
3300031778|Ga0318498_10289239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
3300031781|Ga0318547_10189006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1226 | Open in IMG/M |
3300031859|Ga0318527_10083054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1298 | Open in IMG/M |
3300031860|Ga0318495_10478842 | Not Available | 544 | Open in IMG/M |
3300031897|Ga0318520_10226690 | Not Available | 1109 | Open in IMG/M |
3300031910|Ga0306923_12214568 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300032008|Ga0318562_10095703 | Not Available | 1680 | Open in IMG/M |
3300032008|Ga0318562_10664369 | Not Available | 600 | Open in IMG/M |
3300032042|Ga0318545_10113332 | Not Available | 954 | Open in IMG/M |
3300032060|Ga0318505_10493874 | Not Available | 578 | Open in IMG/M |
3300032076|Ga0306924_11488653 | Not Available | 718 | Open in IMG/M |
3300032091|Ga0318577_10587542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
3300032261|Ga0306920_102027914 | Not Available | 805 | Open in IMG/M |
3300032261|Ga0306920_102155878 | Not Available | 776 | Open in IMG/M |
3300032770|Ga0335085_10484835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1414 | Open in IMG/M |
3300032892|Ga0335081_12182217 | Not Available | 584 | Open in IMG/M |
3300033134|Ga0335073_11319080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 712 | Open in IMG/M |
3300033289|Ga0310914_11191884 | Not Available | 663 | Open in IMG/M |
3300033290|Ga0318519_10069008 | Not Available | 1828 | Open in IMG/M |
3300033290|Ga0318519_11080663 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300034163|Ga0370515_0474784 | Not Available | 528 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.42% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.50% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.59% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.59% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.59% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.67% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.67% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.75% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.75% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.75% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.75% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.83% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.83% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.83% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.92% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.92% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.92% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.92% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_103630382 | 3300001356 | Peatlands Soil | RALLEQIAEPLRVAARADTVVSGPAGHPSGVAGITVGITP* |
JGI26339J46600_101343042 | 3300003218 | Bog Forest Soil | HDAQAQALLDQIAEPLRVAARADAVVRGPAEHASGVPGITVGIAV* |
JGIcombinedJ51221_102860982 | 3300003505 | Forest Soil | ALLDEIAEPLRLAARADAVLRGDAGHPSGVDGVTVAITV* |
Ga0062388_1003398272 | 3300004635 | Bog Forest Soil | EAARALLDQIAEPLRVAARADEVVRGPAEHPSGVDGITVGITV* |
Ga0068868_1015705442 | 3300005338 | Miscanthus Rhizosphere | AARSLLDQIAEPLRIAARADALILGPAGHPSGVDGITVGIAV* |
Ga0070709_109987922 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | QADDAQARSLLDQIAEPLRVAARADALVRGPAEHPSGVAGISVEIVV* |
Ga0070709_114876712 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ARSLLDQIAEPLRIAARADALVLGPAECPSGVDGIAVGITV* |
Ga0066687_105992022 | 3300005454 | Soil | ARARSLLDQIAEPLRVAARADALVLGPASHPSGVDGITVGIAV* |
Ga0070663_1000122801 | 3300005455 | Corn Rhizosphere | AARSLLDQIAEPLRIAARADALILGHAGHPSGVDGITVGIAV* |
Ga0070684_1005258032 | 3300005535 | Corn Rhizosphere | AHDDAARSLLDQIAEPLRIAARADALVLAPAGHPSGVDGITVGIAV* |
Ga0070762_105353982 | 3300005602 | Soil | AQAGALLDQIAEPLRVAARADEVVRGPAGHPSGAAGITVRIVS* |
Ga0070762_111867791 | 3300005602 | Soil | TPAAETLLDQIAEPLRIAARARTLVRAPATDPTGASTHPSGVDGITIGITA* |
Ga0070763_107150582 | 3300005610 | Soil | DQIAVPLRVAARADEVVRGPADHPSGVDGITVGITV* |
Ga0070716_1012525382 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ARSLLDQIAEPLRIAARADALILGPAECPSGVDGITVGITV* |
Ga0070765_1002968731 | 3300006176 | Soil | LLDKIAEPLRVAARAETVVRGPAEHPSGVAGITVGITV* |
Ga0070765_1022862752 | 3300006176 | Soil | AAAAALLDEIAEPLRLAARADAVLRGDAGHPSGVDGVTVAVTV* |
Ga0074055_118703761 | 3300006573 | Soil | LLDQIAEPLRVAARADALVLGPAEQPSGVDGITVGIAV* |
Ga0079222_105644882 | 3300006755 | Agricultural Soil | LDQIAEPLRIAARADALVLGPADHPSGVDGITVGIAV* |
Ga0079220_108495641 | 3300006806 | Agricultural Soil | AGSLLDQIAEPLRVAARADAMVRGVADHPSGVDGITVGITV* |
Ga0068865_1002078351 | 3300006881 | Miscanthus Rhizosphere | DQIAEPLRIAARADALVLGPAGHPSGIDGITVGIAV* |
Ga0073928_101646311 | 3300006893 | Iron-Sulfur Acid Spring | AAEALLGQIAEPLRVAARADQVIRGPAAHPSGVDGITVGIGP* |
Ga0079219_120296141 | 3300006954 | Agricultural Soil | QARSLLDQIAEPLRIAARADALVLGPAEYPSGVDGITVGIAI* |
Ga0116215_13987381 | 3300009672 | Peatlands Soil | AEALLDQIAEPLRIAARADAVVRGPAQQPSGVAGITVGIAV* |
Ga0116217_104468051 | 3300009700 | Peatlands Soil | LLDQIAEPLRVAARADAVVHGPAEQPSGIDGITVGIAV* |
Ga0116217_106488802 | 3300009700 | Peatlands Soil | HDEAARALLEQIAEPLRVAARADTVVSGPAGHPSGVAGITVGITP* |
Ga0126374_103207212 | 3300009792 | Tropical Forest Soil | ADDARARSLLDQIAEPLRAAARADAIAHGVAGYPSGVPGISVEIVA* |
Ga0116223_108987021 | 3300009839 | Peatlands Soil | RALLEQIAEPLRVAARADAVISGPAEYPSGVAGITVGIVP* |
Ga0126380_103546202 | 3300010043 | Tropical Forest Soil | LIAEPLRLAARADAVARGEAGHPSGVDGITVAVTPR* |
Ga0126373_125074801 | 3300010048 | Tropical Forest Soil | LLDVIAEPLRLAARADLVVRGDAAHPSGVDDVTLAIVPARPAV* |
Ga0134125_125086331 | 3300010371 | Terrestrial Soil | QAHDDAARSLLDQIAEPLRIAARADALVLAPAGHPSGVDGITVGIAV* |
Ga0134128_132021652 | 3300010373 | Terrestrial Soil | LDQIAEPLRVAARADALVRGPAEHPSGVAGISVEIVV* |
Ga0105239_104883881 | 3300010375 | Corn Rhizosphere | DAARSLLDQIAEPLRIAARADALILGPAGHPSGVDGITVGIAV* |
Ga0137383_108022182 | 3300012199 | Vadose Zone Soil | DLLDLIAEPLRLAARADAVARGEAGHPSGVDGVTVAVTPR* |
Ga0137365_105800131 | 3300012201 | Vadose Zone Soil | RSLLGQIAEPLRVAARADTLVRGPAEHPSGVDGITVGIAV* |
Ga0137376_101679971 | 3300012208 | Vadose Zone Soil | HDARARSLLDQIAEPLRVAARADALVLGPASHPSGIEGITVGIAV* |
Ga0137395_107390972 | 3300012917 | Vadose Zone Soil | DQIAEPLRVAARADALVLGPADHPSGVDGITVGIAV* |
Ga0164302_101359042 | 3300012961 | Soil | HDAAARSLLDQIAEPLRIAARADALILGPAGHSSGVDGITVGIAV* |
Ga0164305_103856212 | 3300012989 | Soil | DDAARSLLDQIAEPLRIAARADALVLAPAGHPSGVDGITVGIAV* |
Ga0182036_106901872 | 3300016270 | Soil | ARSLLDQIAEPLRVAARADALVLGPAEHPSGVDGITVGIAV |
Ga0187806_10519692 | 3300017928 | Freshwater Sediment | LLDQIAEPLRIAARAGAVVRGPAEHASGVAGITVGIAV |
Ga0187825_103781091 | 3300017930 | Freshwater Sediment | QIAEPLRVAARADAVVRGPAEHFSGVAGITVGIVP |
Ga0187777_106009091 | 3300017974 | Tropical Peatland | QIAEPLRVAARAGAVVRGPAEHPSGVDGITVGIAV |
Ga0187816_105548972 | 3300017995 | Freshwater Sediment | AARALLDQIAEPLRVAARADEVVRGPATHPSGVDGITVAITV |
Ga0187805_106358642 | 3300018007 | Freshwater Sediment | VDEIGKPLRLAARADAVLRGDAGHPSGVDGVTVAIEV |
Ga0187859_108260361 | 3300018047 | Peatland | AGALLDQIAEPLRIAARADTVVRGTTAHPSGVAGITVGIAV |
Ga0187784_100998821 | 3300018062 | Tropical Peatland | LARIAEPLRVAARADVVRLGPADHPSGVDGITVGVTV |
Ga0187770_116543911 | 3300018090 | Tropical Peatland | GALLDQVAEPLRIAARADEVIRGEAGHPGGVPGITVGVVP |
Ga0210399_109094582 | 3300020581 | Soil | QIAEPLRVAARAGAVVRGPAEHPSGVDGISVGIAV |
Ga0210396_104237351 | 3300021180 | Soil | ARAEALLGRIAEPLRIAARADAVIRGRAEHPSGVAGITVGITVGR |
Ga0210393_111831161 | 3300021401 | Soil | DQIAEPLRIAARADAVVRGPAEHFSGVDGITVGIVP |
Ga0210386_112534732 | 3300021406 | Soil | AAAAALLDEIAEPLRLAARADAVLRGDAGHPSGVDGVTVAVTV |
Ga0210383_100576433 | 3300021407 | Soil | AALLDEIAEPLRLAARADAVLRGDAGHPSGVDGVTVAVTV |
Ga0210383_108516082 | 3300021407 | Soil | ALLARIAEPLRIAARADAVIRGRAEHPSGVAGITVGITVGR |
Ga0210390_102580861 | 3300021474 | Soil | DEAAEALLDQIAEPLRIAARADAVVRGPAEHLSGVDGITVGIVP |
Ga0210402_102850411 | 3300021478 | Soil | QALLDQIAEPLRVAARAGAVVRGPAEHPSGVDGISVGIAV |
Ga0210402_116099033 | 3300021478 | Soil | DRIDEPLRIAARADTVVRGTAGHPSGVAGITVGIAV |
Ga0213851_15733781 | 3300021860 | Watersheds | QALLDQIAEPLRLAARADAVVRGPAAHPSGVEGITVGIVA |
Ga0247665_10142792 | 3300024219 | Soil | DQIAEPLRIAARADALILGPAGHPSGVDGITVGIAV |
Ga0207685_108154322 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | QIAEPLRVAARADAVVRGTASHPSGVDGITVGITV |
Ga0207645_106740081 | 3300025907 | Miscanthus Rhizosphere | ARSLLDQIAEPLRVAARADAVVRGTAGHPSGVAGITVGIAV |
Ga0207700_116629731 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | DAQAQALLDQIAEPLRVAARADAVVRGTAGHPSGVAGITVGITA |
Ga0207664_102572442 | 3300025929 | Agricultural Soil | TAAAAALLDEIAEPLRLAARADALLRGDAGHPSGVDGVTVAVAV |
Ga0207664_103885591 | 3300025929 | Agricultural Soil | LDQIAEPLRIAARADALVLGPAECPSGVDGIAVGITV |
Ga0179587_110360341 | 3300026557 | Vadose Zone Soil | RSLLDQIAEPLRVAARADALVLGPAEYPSGVDGITVGIAV |
Ga0209218_11105911 | 3300027505 | Forest Soil | AHDENAAALLDQIAEPLRIAARADTVVRGPAEHFSGVAGITVGIVP |
Ga0209221_10072491 | 3300027609 | Forest Soil | DPDAEQLLSIIAEPLRVAARADAVVFGEADHASGVDGITVAIAV |
Ga0209420_10057887 | 3300027648 | Forest Soil | LLDQIAEPLRVAARAEEVIRGPAEHPSGVAGITVGITP |
Ga0209178_14266972 | 3300027725 | Agricultural Soil | LDQIAEPLRVAARADAVVRGTAGHPSGVAGITVGIEV |
Ga0209655_102601792 | 3300027767 | Bog Forest Soil | LLDQIAEPLRVAARADEVVRGPAEHPSGVDGITVGITV |
Ga0209177_104369302 | 3300027775 | Agricultural Soil | QARSLLDQIAEPLRIAARADALVLGPAEYPSGVDGITVGIAI |
Ga0209693_102685381 | 3300027855 | Soil | QIAEPLRVAARAETVVRGPAEHPSGVAGITVGILPETT |
Ga0209166_100856883 | 3300027857 | Surface Soil | AAALLDQVAESLRVAARADAVLRGPAEYPSGVDGITVGIVA |
Ga0209166_101123973 | 3300027857 | Surface Soil | ADGPKAEALLAQIAEPLRIAARADAMVRGSAEHPSGVDGITVGISV |
Ga0209579_102982191 | 3300027869 | Surface Soil | QAEALLAQIAEPLRLAARADAVVRAPAAHPSGVDGITVGIVP |
Ga0209590_101862351 | 3300027882 | Vadose Zone Soil | QTSALLDQIAEPLRVAARADALVRGPAGHPSGVAGITVGIAV |
Ga0247682_10264721 | 3300028146 | Soil | LLDQIAEPLRIAARADALILGPAGHPSGVDGITVGIAV |
Ga0268265_121159131 | 3300028380 | Switchgrass Rhizosphere | DVAARSLLDQIAEPLRIAARADALILGPAGHPSGVDGITVGIAV |
Ga0302224_104228212 | 3300028759 | Palsa | TAAAETLLDQIAEPLRIAARAGTLVRAPATHPSGVDAITGGIVA |
Ga0307280_100621321 | 3300028768 | Soil | SLLDQIGEPLRVAARADALVLGPADHPSGVDGITVGIAV |
Ga0311338_102650781 | 3300030007 | Palsa | AAEALLDQIAEPLRIAVRADALVRGAAEHPSGVDGITVAIAPQVS |
Ga0318515_107788092 | 3300031572 | Soil | LDRIAEPLRVAARADELVRGPADHPSGVDGISVGILP |
Ga0318572_103853251 | 3300031681 | Soil | LDQIAEPLRVAARADALVLGPAEHPSGVRGITVGIAL |
Ga0310686_1068603142 | 3300031708 | Soil | QARDAQTEALLAQIAEPLRLAARADVVVRGPAAHPSGVEGITVGIVP |
Ga0310686_1170091151 | 3300031708 | Soil | DEAAEALLDQIAEPLRIAARADSVVRGPAEHPGGVAGITVGIVA |
Ga0318526_103352682 | 3300031769 | Soil | RSTASAQALLDQIAEPLRVAARADAVLRGPAEHPSGVDGITVGIVP |
Ga0318521_108280971 | 3300031770 | Soil | LLDQIAEPLRVAARADTVVRGPAEHPSGVDGITVSIVP |
Ga0318498_102892392 | 3300031778 | Soil | ALLDQIAEPLRVAARADEVVRGPATYPSGVAGITVGITV |
Ga0318547_101890062 | 3300031781 | Soil | AHDEPADALLNQIAEPLRVAARADAVVRGAATYPSGVAGVTVAIAP |
Ga0318527_100830541 | 3300031859 | Soil | LLDQIAEPLRVAARAEAVVLAPAEHPSGVAGITVGIAV |
Ga0318495_104788421 | 3300031860 | Soil | LDLIAEPLRLAARADAVARGEAGHPSGVDGVTVSIVPARG |
Ga0306919_103707102 | 3300031879 | Soil | TPAADLLDLIAEPLRLAARADAVARGEAGHPSGVDGVTVAVTPR |
Ga0318520_102266902 | 3300031897 | Soil | LDRIAEPLRIAARAEAVVRAPAAHPSGVAGITVGIVA |
Ga0306923_122145682 | 3300031910 | Soil | QIAEPLRVAARADEVVRGPAGHPSGVAAITVGIVPSDG |
Ga0318562_100957032 | 3300032008 | Soil | DQIAEPLRVAARADALVLGPAEHPSGVDGITVGIAV |
Ga0318562_106643691 | 3300032008 | Soil | PAAADLLDVIAEPLRLAARADAIVRGAASHPSGVEGITVGIAV |
Ga0318545_101133322 | 3300032042 | Soil | DTPAARALLDQIAEPLRVAARAGAVVRGPADHPSGVDGIMVGIAV |
Ga0318505_104938742 | 3300032060 | Soil | SHDAAAQALLDQIAEPLRVAARADAVLRGPAEHPSGVDGITVGIVP |
Ga0306924_114886533 | 3300032076 | Soil | RDAQAGALLDQIGEPLRVAARADALVRGPAGHPSGVPGITVAIEA |
Ga0306924_120197811 | 3300032076 | Soil | TAAAAALLDEIAEPLRLAARADAVLRGDAGHPSGVDGVTVAITV |
Ga0318577_105875421 | 3300032091 | Soil | QIAEPLRVAARADALVLGPAEHPSGVRGITVGIAV |
Ga0306920_1020279141 | 3300032261 | Soil | LLDLIAEPLRLAARADAVARGEAGHPSGVDGVTVAVTPR |
Ga0306920_1021558782 | 3300032261 | Soil | HDAEARALLDRIAEPLRIAARAEAVVRAPAAHPSGVAGITVGIVA |
Ga0335085_104848351 | 3300032770 | Soil | ARSLLDQIAEPLRVAARADALVLGPAEHPSGVGGITVGITV |
Ga0335081_121822172 | 3300032892 | Soil | AHDAQAAALLDQIAEPLRIAARADAVVLAPAEHPSGVAGITVAIEA |
Ga0335073_113190802 | 3300033134 | Soil | ALLDQIAAPLRIAARADTLVRGPAGYPAGVPDITVAIAP |
Ga0310914_111918842 | 3300033289 | Soil | QIAEPLRVAARADEVVRGPAEHLSGVAGITVGINP |
Ga0318519_100690082 | 3300033290 | Soil | RTPEAADLLDVIAEPLRLAARADAIVRGAASHPSGVEGITVGIAV |
Ga0318519_110806631 | 3300033290 | Soil | VQAHDDAARALLDQIAGPLRIAARADEVIRGSADQPSGVDGISVGIVP |
Ga0370515_0474784_3_113 | 3300034163 | Untreated Peat Soil | DQIAEPLRIAARARTLVRAPAIHPSGVDGITIGITV |
⦗Top⦘ |