NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089704

Metagenome / Metatranscriptome Family F089704

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089704
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 88 residues
Representative Sequence MTDMNVPARNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV
Number of Associated Samples 80
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.63 %
% of genes near scaffold ends (potentially truncated) 26.85 %
% of genes from short scaffolds (< 2000 bps) 75.93 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.815 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(81.481 % of family members)
Environment Ontology (ENVO) Unclassified
(83.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(91.667 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.91%    β-sheet: 27.27%    Coil/Unstructured: 56.82%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF12833HTH_18 26.85
PF03401TctC 19.44
PF13180PDZ_2 11.11
PF13365Trypsin_2 9.26
PF03449GreA_GreB_N 1.85
PF02754CCG 1.85
PF00929RNase_T 0.93
PF00884Sulfatase 0.93
PF14707Sulfatase_C 0.93
PF13378MR_MLE_C 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 19.44
COG0247Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcFEnergy production and conversion [C] 1.85
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 1.85
COG2048Heterodisulfide reductase, subunit BEnergy production and conversion [C] 1.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.81 %
UnclassifiedrootN/A10.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009597|Ga0105259_1161289All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40546Open in IMG/M
3300009609|Ga0105347_1465595All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40548Open in IMG/M
3300009610|Ga0105340_1118513All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401074Open in IMG/M
3300009678|Ga0105252_10024515All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2179Open in IMG/M
3300009678|Ga0105252_10092948All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401201Open in IMG/M
3300011391|Ga0137331_1013265All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40780Open in IMG/M
3300011397|Ga0137444_1002706All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_402062Open in IMG/M
3300011399|Ga0137466_1000681All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2766Open in IMG/M
3300011402|Ga0137356_1078844All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium627Open in IMG/M
3300011403|Ga0137313_1003075All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_403371Open in IMG/M
3300011405|Ga0137340_1018044All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401287Open in IMG/M
3300011405|Ga0137340_1034663All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40946Open in IMG/M
3300011406|Ga0137454_1022285Not Available864Open in IMG/M
3300011409|Ga0137323_1001421All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria6424Open in IMG/M
3300011413|Ga0137333_1012407All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1851Open in IMG/M
3300011413|Ga0137333_1049461All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria953Open in IMG/M
3300011413|Ga0137333_1072732All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40789Open in IMG/M
3300011416|Ga0137422_1002336All Organisms → cellular organisms → Bacteria → Proteobacteria4123Open in IMG/M
3300011416|Ga0137422_1022762All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401478Open in IMG/M
3300011419|Ga0137446_1001777All Organisms → cellular organisms → Bacteria → Proteobacteria3225Open in IMG/M
3300011419|Ga0137446_1052578All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria913Open in IMG/M
3300011420|Ga0137314_1037242All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401182Open in IMG/M
3300011421|Ga0137462_1001570All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3653Open in IMG/M
3300011422|Ga0137425_1074606All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium798Open in IMG/M
3300011423|Ga0137436_1035008All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1265Open in IMG/M
3300011424|Ga0137439_1080720All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40684Open in IMG/M
3300011425|Ga0137441_1018011All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401442Open in IMG/M
3300011425|Ga0137441_1091448All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria729Open in IMG/M
3300011427|Ga0137448_1004694All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium2601Open in IMG/M
3300011427|Ga0137448_1023660All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1436Open in IMG/M
3300011428|Ga0137456_1119994All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium692Open in IMG/M
3300011432|Ga0137428_1073303All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40939Open in IMG/M
3300011433|Ga0137443_1031094All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1402Open in IMG/M
3300011434|Ga0137464_1220395All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40576Open in IMG/M
3300011435|Ga0137426_1008185All Organisms → cellular organisms → Bacteria → Proteobacteria2375Open in IMG/M
3300011435|Ga0137426_1062710All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40995Open in IMG/M
3300011436|Ga0137458_1286005Not Available503Open in IMG/M
3300011441|Ga0137452_1005228All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3928Open in IMG/M
3300011441|Ga0137452_1219212Not Available646Open in IMG/M
3300011441|Ga0137452_1306468Not Available530Open in IMG/M
3300011442|Ga0137437_1012362All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium2940Open in IMG/M
3300011443|Ga0137457_1335136All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium516Open in IMG/M
3300011444|Ga0137463_1140795All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria908Open in IMG/M
3300011445|Ga0137427_10102763All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1155Open in IMG/M
3300011445|Ga0137427_10155788All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria941Open in IMG/M
3300012035|Ga0137445_1098324All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium593Open in IMG/M
3300012038|Ga0137431_1060918All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401037Open in IMG/M
3300012039|Ga0137421_1022824All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1550Open in IMG/M
3300012129|Ga0137345_1002182All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401742Open in IMG/M
3300012129|Ga0137345_1036167All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium628Open in IMG/M
3300012133|Ga0137329_1002610All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401658Open in IMG/M
3300012134|Ga0137330_1002511All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1720Open in IMG/M
3300012134|Ga0137330_1003743All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1501Open in IMG/M
3300012134|Ga0137330_1031819Not Available676Open in IMG/M
3300012137|Ga0137346_1007884All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1099Open in IMG/M
3300012143|Ga0137354_1045921Not Available692Open in IMG/M
3300012146|Ga0137322_1007146All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1372Open in IMG/M
3300012168|Ga0137357_1019172All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401341Open in IMG/M
3300012171|Ga0137342_1000330All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria5048Open in IMG/M
3300012173|Ga0137327_1011153All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401746Open in IMG/M
3300012228|Ga0137459_1006433All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3281Open in IMG/M
3300012228|Ga0137459_1032130All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1480Open in IMG/M
3300012228|Ga0137459_1135574All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria721Open in IMG/M
3300012228|Ga0137459_1258337All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40503Open in IMG/M
3300012232|Ga0137435_1247556Not Available542Open in IMG/M
3300012670|Ga0137335_1006071All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300014864|Ga0180068_1088677Not Available519Open in IMG/M
3300014870|Ga0180080_1056057All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40661Open in IMG/M
3300014871|Ga0180095_1018790All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1095Open in IMG/M
3300014872|Ga0180087_1005068All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_402171Open in IMG/M
3300014872|Ga0180087_1024930All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1076Open in IMG/M
3300014873|Ga0180066_1000145All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria5551Open in IMG/M
3300014875|Ga0180083_1083586All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium689Open in IMG/M
3300014876|Ga0180064_1033223All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401008Open in IMG/M
3300014880|Ga0180082_1011222All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401788Open in IMG/M
3300014883|Ga0180086_1113931All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria694Open in IMG/M
3300015248|Ga0180079_1003700All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1362Open in IMG/M
3300015251|Ga0180070_1000865All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_402129Open in IMG/M
3300015253|Ga0180081_1005317All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1616Open in IMG/M
3300015253|Ga0180081_1040420Not Available774Open in IMG/M
3300015254|Ga0180089_1122629All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40541Open in IMG/M
3300015256|Ga0180073_1078310All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium700Open in IMG/M
3300015257|Ga0180067_1029838All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1089Open in IMG/M
3300018059|Ga0184615_10712707Not Available509Open in IMG/M
3300018063|Ga0184637_10089064All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1896Open in IMG/M
3300018079|Ga0184627_10000777All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria12421Open in IMG/M
3300018083|Ga0184628_10005486All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales6052Open in IMG/M
3300018083|Ga0184628_10071369All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401766Open in IMG/M
3300018084|Ga0184629_10002618All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria6850Open in IMG/M
3300018084|Ga0184629_10177714All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1092Open in IMG/M
3300018084|Ga0184629_10268455All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria895Open in IMG/M
3300019228|Ga0180119_1059756All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1047Open in IMG/M
3300020060|Ga0193717_1111548All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40851Open in IMG/M
3300021081|Ga0210379_10000658All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria11536Open in IMG/M
3300027362|Ga0208320_1000169All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria8964Open in IMG/M
3300027513|Ga0208685_1007727All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2737Open in IMG/M
3300027513|Ga0208685_1101288All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40619Open in IMG/M
3300027533|Ga0208185_1010496All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2316Open in IMG/M
3300027533|Ga0208185_1026444All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401431Open in IMG/M
3300028803|Ga0307281_10184781All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria744Open in IMG/M
3300033233|Ga0334722_10433815All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium947Open in IMG/M
3300034147|Ga0364925_0007712All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3194Open in IMG/M
3300034149|Ga0364929_0099730All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_40914Open in IMG/M
3300034151|Ga0364935_0023281All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1691Open in IMG/M
3300034354|Ga0364943_0010933All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_402708Open in IMG/M
3300034354|Ga0364943_0023557All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401922Open in IMG/M
3300034354|Ga0364943_0097862All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_401021Open in IMG/M
3300034354|Ga0364943_0334986Not Available577Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil81.48%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment7.41%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment6.48%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.85%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009597Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300011391Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT163_2EnvironmentalOpen in IMG/M
3300011397Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2EnvironmentalOpen in IMG/M
3300011399Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT842_2EnvironmentalOpen in IMG/M
3300011402Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2EnvironmentalOpen in IMG/M
3300011403Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2EnvironmentalOpen in IMG/M
3300011405Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2EnvironmentalOpen in IMG/M
3300011406Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2EnvironmentalOpen in IMG/M
3300011409Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2EnvironmentalOpen in IMG/M
3300011413Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2EnvironmentalOpen in IMG/M
3300011416Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2EnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300011420Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2EnvironmentalOpen in IMG/M
3300011421Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011424Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2EnvironmentalOpen in IMG/M
3300011425Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT244_2EnvironmentalOpen in IMG/M
3300011427Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2EnvironmentalOpen in IMG/M
3300011428Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011433Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2EnvironmentalOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012035Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012129Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2EnvironmentalOpen in IMG/M
3300012133Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2EnvironmentalOpen in IMG/M
3300012134Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2EnvironmentalOpen in IMG/M
3300012137Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT560_2EnvironmentalOpen in IMG/M
3300012143Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2EnvironmentalOpen in IMG/M
3300012146Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2EnvironmentalOpen in IMG/M
3300012168Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2EnvironmentalOpen in IMG/M
3300012171Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2EnvironmentalOpen in IMG/M
3300012173Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2EnvironmentalOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012670Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT293_2EnvironmentalOpen in IMG/M
3300014864Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10DEnvironmentalOpen in IMG/M
3300014870Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10DEnvironmentalOpen in IMG/M
3300014871Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1DaEnvironmentalOpen in IMG/M
3300014872Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10DEnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300014875Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10DEnvironmentalOpen in IMG/M
3300014876Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10DEnvironmentalOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015248Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT530_16_10DEnvironmentalOpen in IMG/M
3300015251Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10DEnvironmentalOpen in IMG/M
3300015253Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10DEnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015256Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10DEnvironmentalOpen in IMG/M
3300015257Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10DEnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300019228Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300027362Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 (SPAdes)EnvironmentalOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027533Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes)EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0105259_116128913300009597SoilMRMTDMNVPARSNYQIRIVYQQPSSTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLD
Ga0105347_146559523300009609SoilMTDMDVPARNNYQIKIVYQHPSSTDSSGKVVLATDIVTTRTAVVDIAARLQKIFPKPEHLVFVHVLERPGQPLQVAWETLDEPGNGPV*
Ga0105340_111851333300009610SoilMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV*
Ga0105252_1002451543300009678SoilLNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHVLERPGQPLQVAWETLDEPGNGPV*
Ga0105252_1009294813300009678SoilMTDMNVPARSNYQIRIVYQQPSSTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLP
Ga0137331_101326523300011391SoilMTDMDVPARNNYQIKIVYQHPSPTVSSGKVVLATDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPRQVAWETLDEPGNGPV*
Ga0137444_100270633300011397SoilMNVPALNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPRQVAWEALDEPGNGPV*
Ga0137466_100068133300011399SoilMSDMNVPALNNYQIKIVYQQLSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLECPGQPLQVAWETLDEAGNGPV*
Ga0137356_107884423300011402SoilDMNAPARNNYQIKIVYQHPSPTVSSGKVVLATDIVTTRTAVVDIAARLQKIFPKPEHRVFVHLLERSGQPCPVAWETLDEPGNGPV*
Ga0137313_100307513300011403SoilMRMTDMNVPARSNYQIRIVYQQPSSTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLP
Ga0137340_101804433300011405SoilMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPL
Ga0137340_103466333300011405SoilMRMTDMNVPARSNYQIRIVYQQPSSTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSAQPRQVAWEALDEPGNGPV*
Ga0137454_102228523300011406SoilMSDMNAPARNNYQIKIVYQHPSPTVSSGKVVLATDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPLPVAWETLDEPGNGPV*
Ga0137323_100142123300011409SoilMTDMNVPARNKYQITIVCQQSSQTESSWKDVLTTDIVTTRSDVVDIAARLQRIFPKPEYLVSVHLLERSGQPLPVAWETREEPGSGPV*
Ga0137333_101240743300011413SoilMSDMNVPALNNYQIKIVYQQLSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPRQVAWEALDEPGNGPV*
Ga0137333_104946113300011413SoilPPPIKRMTDMNVPARNKYQITIVCQQSSQTESSWKDVLTTDIVTTRSDVVDIAARLQRIFPKPEYLVSVHLLERSGQPLQVAWETPDEPGNGPV*
Ga0137333_107273223300011413SoilMTDMNVPALNNYQIKIVHKQPSPTDSSGKVVLTTDIVTTRTAIVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV*
Ga0137422_100233633300011416SoilMRMTDMNVPARSNYQIRIVYQQPSSTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV*
Ga0137422_102276233300011416SoilMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAW
Ga0137446_100177753300011419SoilMNIPARNKYQIKVVCQQSSPAESSWKDVLTTDIVTTRTSVVDIAARLQGIYPKPEHLVFVHLLERSDQPLQVAWETPDEPGNGPV*
Ga0137446_105257823300011419SoilMNIRARNKYQIKVVCQQSSPAESSWKDVLTTDIVTTRTAVVDIAERLQRIFPKPEHLVFVRLLEHSGQPLQVAWETPEEPGNGPV*
Ga0137314_103724233300011420SoilMTDMNVPARNKYQITIVCQQSSQTESSWKDVLTTDIVTTRTDVVDIAARLQRIFPKPEYLVSVHLLERSGQPLPGAWETREDPGSGPV*
Ga0137462_100157033300011421SoilMTDKNFPARNKYQIRVVCMQSAPADSSWKDVLTTEIVSTRTSVVDIAARLQGIYPKPEHLVFVHLLARPGEPLRVAWETPDEPGNGTV*
Ga0137425_107460623300011422SoilMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPIAWETLDEPGNGPV*
Ga0137436_103500823300011423SoilMADMNIPARNKYQIKIVCQQSSPTESSWKDVLTTDIVTTRTDVVDIAARLQRIFPKPEHLVSVHLLERSGQPLPVAWETPDEPGNGPV*
Ga0137439_108072023300011424SoilMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHRVFVHLLERPGQPLQVAWETLDEAGNGPV*
Ga0137441_101801123300011425SoilMSDMNVPALNNYQIKIVYQQLSPTDSSGKVVLATDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERPGQPLQVAWETLDETGNGPV*
Ga0137441_109144823300011425SoilMTDKNFPARNKYQIRVVCMQSAPADSSWKDVLTTEIVSTRTSVVDIAARLQGIYPKPEHLVFVHLLARSGEPLRVAWETPDEPDNGTV*
Ga0137448_100469413300011427SoilKRKTDMNVPALNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPRQVAWEALDEPGNGPV*
Ga0137448_102366023300011427SoilMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHVLERPGQPLQVAWETLDEPGNGPV*
Ga0137456_111999413300011428SoilIPALPPTMRMTDMNVPARSNYQIRIVYQQPSSTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV*
Ga0137428_107330313300011432SoilMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQP
Ga0137443_103109413300011433SoilKIVYQHPSPTVSSGKVVLATDIVTTRTAVVDIAARLQKSFPKPEHLVFVHLLECPGQPLQVAWETLDEAGNGPV*
Ga0137464_122039523300011434SoilMSDMNVPALNNYQIKIVYQQLSPTDSSGKVVLTTDIVTTRTAVVDIAARLQRIFPKPEHLVFVHLLERPGQPLQVAWETLDEAGNGPV*
Ga0137426_100818533300011435SoilGRMPAPPPIKRMTDMNVPALNNYQIKIVYQHPSSTDSSGKVVLATDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV*
Ga0137426_106271033300011435SoilMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPRQVAWEALDEPGNG
Ga0137458_128600513300011436SoilMSDMNVPALNNYQIKIVYQQLSPTDSSGKVVLTTDIVTTRTAVVDIAARLQRIFPKPEHRVFVHLLERPGQPLQVAWETLDEAGNGPV*
Ga0137452_100522863300011441SoilMNIPARNKYQIKVVCQQSSPAESSWKDVLTTDIVTTRTAVVDIAERLQRIFPKPEHLVFVRLLEHSGQPLQVAWETPEEPGNGPV*
Ga0137452_121921233300011441SoilMADMNIPARNKYQIKIVCQQSSPTESSWKDVLTTDIVTTRTDVVDIAARLQRIFPKPEHLVSVHLLERSGQPLPVAWESPDEPGNGPV*
Ga0137452_130646813300011441SoilMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV*
Ga0137437_101236213300011442SoilPPPIKRMTDMNVTALNNYQIKIIHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPRQVAWEALDEPGNGPV*
Ga0137457_133513623300011443SoilGRMPAPPPIKRMTDMNVTALNNYQIKIIHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERPGQPLQVAWETLDETGNGPV*
Ga0137463_114079513300011444SoilPIKRMTDMNVPARNKYQIKIVCQQSSPTESSWKDVLTTDIVTTRTAVVDIAERLQRIFPKPEHLVFVHLLERSGQPLQITWETPEEPGNGPV*
Ga0137427_1010276323300011445SoilMTDKNNPARNKYQIRVVCMQSAPADSSWKDVLTTEIVSTRTSVVDIAARLQRIYPKPEHLVFVHLLARPGEPLRVAWETPDEPGNGTV*
Ga0137427_1015578833300011445SoilMTDMNVPARNNYQIKIVYQQPSPTDSSGKVVLSTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSEQPLQVAWEALDEPGNGPV*
Ga0137445_109832413300012035SoilKTDMNVPALNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPRQVAWEALDEPGNGPV*
Ga0137431_106091813300012038SoilMRMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV*
Ga0137421_102282423300012039SoilMPAPPPKKRKTDMNVPALNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPRQVAWEALDEPGNGPV*
Ga0137345_100218233300012129SoilMTDMNVTARNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLVEPGNGPV*
Ga0137345_103616723300012129SoilMSDMNVPARNNYQIKIVYQHPSPTVSSGKVVLATDIVTTRTVVVDIAARLQKIFPKPEHRVFVHLLERSGQPCPVAWETLDEPGNGPV*
Ga0137329_100261033300012133SoilMRMTDMNVPARSNYQIRIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV*
Ga0137330_100251123300012134SoilMTDMNVPALNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLEHSGQPRHVAWEALDEPGNGPV*
Ga0137330_100374323300012134SoilMTDMNVPARNKYQITIVCQQSSQTESSWKNVLTTDIITTRSDVVDIAARLQRIFPKPEYLVSVHLLERSGQPLPVAWETREEPGSGPV*
Ga0137330_103181913300012134SoilMRMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLATDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV*
Ga0137346_100788423300012137SoilMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTVVVDIAARLQKIFPKPEHLVFVHLLERSGQPRQVAWEALDEPGNGPV*
Ga0137354_104592123300012143SoilMTDKNFPARNKYQIRVVCMQSAPADSSWKDVLTTEIVSTRTSVVDIAARLQGIYPKPEHLVFVHLLARSGEPLRVAWETPDEPDNG
Ga0137322_100714633300012146SoilMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTVVVDIAARLQKIFPKPEHRVFVHLLERSGQPCPVAWETLDEPGNGPV*
Ga0137357_101917233300012168SoilMSDMNAPARNNYQIKIVYQHPSPTVSSGKVVLATDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPLQVAWETLDEAGNGPV*
Ga0137342_100033053300012171SoilMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDETGNGPV*
Ga0137327_101115313300012173SoilMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWE
Ga0137459_100643333300012228SoilMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPRQVAWEALDEPGNGPV*
Ga0137459_103213023300012228SoilMSDMNVPALNNYQIKIVYQQLSPTDSSGKVVLTTDIVTTRTAVVDIAARLQRIFPKPEHLVFVHLLERSGQPLQVAWETLDEAGNGPV*
Ga0137459_113557423300012228SoilMTDKNNPARNKYQIRVVCMQSAPADSSWKDVLTTEIVSTRTSVVDIAARLQRIYPKPEHLVFVHLLARSGEPLRVAWETPDEPDNGTV*
Ga0137459_125833713300012228SoilMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVYIAARLQRIFPKPEHLVFVHLLERPGQPLQVAWETLDEAGNGPV*
Ga0137435_124755623300012232SoilMNIRARNKYQIKVVCQQSSPAESSWKDVLTTDIVTTRTSVVDIAARLQGIYPKPEHLVFVHLLERSDQPLQVAWE
Ga0137335_100607133300012670SoilMTDMNVPARNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV*
Ga0180068_108867723300014864SoilMTDMNVPALNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV*
Ga0180080_105605723300014870SoilMSDMNAPARNNYQIKIVYQHPSPTVSSGKVVLATDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV*
Ga0180095_101879023300014871SoilMSDMNVPARNNYQIKIVYQHPSSTDSSGKVVLATDIVTTRTAVVDIAARLQKIFPKPEHLVFVHVLERPGQPLQVAWETLDEPGNGPV*
Ga0180087_100506833300014872SoilMTDMNVPARNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPRQVAWEALDEPGNGPV*
Ga0180087_102493013300014872SoilRMTDMNVPARNKYQITIVCQQSSQTESSWKDVLTTDIVTTRSDVVDIAARLQRIFPKPEYLVSVHLLERSGQPLPVAWETREEPGSGPV*
Ga0180066_100014543300014873SoilMTDMNVPARNKYPITIVCQQSSQTESSWKDVLTTDIVTTRSDVVDIAARLQRIFPKPEYLVSVHLLERSGQPLPVAWETREEPGSGPV*
Ga0180083_108358623300014875SoilMNVPALNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPHQVAWEALDEPGNGPV*
Ga0180064_103322313300014876SoilMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERPGQPLPVAWETPEEPGSGPV*
Ga0180082_101122223300014880SoilMTDKNNPARNKYQIRVVCMQSAPADSSWKDVLTTEIVSTRTSVVDIAARLQGIYPKPEHLVFVHLLARPGEPLRVAWETPDEPGNGTV*
Ga0180086_111393113300014883SoilNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPHQVAWEALDEPGNGPV*
Ga0180079_100370023300015248SoilMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHRVFVHLLERSGQPCPVAWETLDEPGNGPV*
Ga0180070_100086523300015251SoilMTDMNVPALNNYQIKIVYQQLSPTDSSGKVVLTTDIVTTRTAVVDIAARLQRIFPKPEHRVFVHLLERPGQPLQVAWETLDEAGNGPV*
Ga0180081_100531713300015253SoilMNVPALNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERPGQPLQVAWETLDEAGNGPV*
Ga0180081_104042023300015253SoilMSDMNAPARNNYQIKIVYQHPSPTVSSGKVVLATDIVTTRTAVVDIAARLQKIFPKPEHRVFVHLLERSGQPCPVAWETLDEAGNGPV*
Ga0180089_112262913300015254SoilMTDMNVPALNNYQIKIVYQHPSPTVSSGKVVLATDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGP
Ga0180073_107831023300015256SoilMRMTDMNVPARSNYQIRIVYQQPSSTDSSGKVVLATDIVTTRTAVVDIAARLQKIFPKPEHRVFVHLLERSGQPLPVAWETLDEPGNGPV*
Ga0180067_102983833300015257SoilMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHRVFVHLLERSGQPCPVAWETLDEAGNGPV*
Ga0184615_1071270723300018059Groundwater SedimentMTDLDISARNKHQIKIVCQQLSPTEPSWKDVLTTEMVTTRTAFVDTAARLQRIFPKPEHRVTVHLLERPGQPRQVAWETPDEPGNSPM
Ga0184637_1008906433300018063Groundwater SedimentMNTPARNKYQIKIVCQQSSPTDSLWQDVLTTDIVATRTAVVDIAARLQSVFPKPEHLVIVHLLEPSGQLLPVAWETPEKPGNDPV
Ga0184627_1000077753300018079Groundwater SedimentMADMNTPARNKYQIKIVCQQSSPTDSLWQDVLTTDIVATRTAVVDIAARLQSVFPKPEHLVIVHLLEPSGQLLPVAWETPEKPGNDPV
Ga0184628_1000548673300018083Groundwater SedimentMPAPPPKKRKTDMNVPALNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPHQVAWEALDEPGNGPV
Ga0184628_1007136923300018083Groundwater SedimentMTDKNFPARNKYQIRVVCMQSAPADSSWKDVLTTEIVSTRTSVVDIAARLQGIYPKPEHLVFVHLLARSGEPLRVAWETPDEPDNGTV
Ga0184629_1000261833300018084Groundwater SedimentMPAPPPKKRKTDMNVPALNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLEHSGQPRQVAWEALDEPGNGPV
Ga0184629_1017771423300018084Groundwater SedimentMNIPARNKYQIKVVCQQSSPAESSWKDVLTTDIVTTRTSVVDIAARLQGIYPKPEHLVFVHLLERSDQPLQVAWETPEEPGNGPV
Ga0184629_1026845523300018084Groundwater SedimentMNIRARNKYQIKVVCQQSSPAESSWKDVLTTDIVTTRTAVVDIAERLQRIFPKPEHLVFVRLLEHSGQPLQVAWETPEEPGNGPV
Ga0180119_105975623300019228Groundwater SedimentPALPPTMRMTDMNVPARSNYHIRIVYQQPSSTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV
Ga0193717_111154833300020060SoilMRMTDMNVPARSNYQIRIVYQQPSSTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDDP
Ga0210379_1000065863300021081Groundwater SedimentMPAPPPKKRKTDMNVPALNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPRQVAWEALDEPGNGPV
Ga0208320_100016943300027362SoilMPAPPPIKRMTDMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV
Ga0208685_100772713300027513SoilMRMTDMNVPARSNYQIRIVYQQPSSTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETL
Ga0208685_110128823300027513SoilMPAPPPKKRMTDMDVPARNNYQIKIVYQHPSSTDSSGKVVLATDIVTTRTAVVDIAARLQKIFPKPEHLVFVHVLERPGQPLQVAWETLDEPGNGPV
Ga0208185_101049633300027533SoilMRMTDMNVPARSNYQIRIVYQQPSSTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV
Ga0208185_102644413300027533SoilMTDMDVPARNNYQIKIVYQHPSSTDSSGKVVLATDIVTTRTAVVDIAARLQKIFPKPEHLVFVHVLERPGQPLQVAWETLDEPGNGPV
Ga0307281_1018478123300028803SoilMTDMNVPARNKYQIKIVCQQSSPTESSWKDVLTTDIVTTRTAVVDIAERLQRIFPKPEHLVFVHLLERAGQPLQVAWETPEEPANGPV
Ga0334722_1043381523300033233SedimentMKRMTDKNIQARNKYEIKVVCQQSSPAESSWKDVLTTEIDATRTSVVDIAARLQRVYPKPEHLVFVHLLDRSGQPREVAWETPEEPGNDPE
Ga0364925_0007712_2064_23213300034147SedimentMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHVVFVHLLERSGQPLPVAWETLDEPGNGPV
Ga0364929_0099730_2_2413300034149SedimentMPAPPPKKRKTDMNVPALNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQ
Ga0364935_0023281_413_6703300034151SedimentMNVPALNNYQIKIVHQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHVLERPGQPLQVAWETLDEPGNGPV
Ga0364943_0010933_1366_16233300034354SedimentMNVPALNNYQIKIVYQQPSPTDSSGKVVLTTDIVTTRTAVVDIAARLQKIFPKPEHLVFVHLLERSGQPRQVAWEALDEPGNGPV
Ga0364943_0023557_312_5693300034354SedimentMNIRARNKYQIKVVCQQSSPAESSWKDVLTTDIVTTRTSVVDIAARLQGIYPKPEHLVFVHLLERSDQPLQVAWETPEEPGNGPV
Ga0364943_0097862_642_9083300034354SedimentMTDMNVPARNKYQIKIVCQQSSPTESSWKDVLTTDIVTTRTAVVDIAERLQRIFPKPEHLVFVHLLEHSGQPLQVAWETPEEPGNGPV
Ga0364943_0334986_12_2783300034354SedimentMADMNIPARNKYQIKIVCQQSSPTESSWKDVLTTDIVTTRTDVVDIAARLQRIFPKPEHLVSVHLLERSGQPLPVAWETPDEPGNGPV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.