NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F089810

Metatranscriptome Family F089810

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089810
Family Type Metatranscriptome
Number of Sequences 108
Average Sequence Length 97 residues
Representative Sequence DSLEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Number of Associated Samples 85
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 3.70 %
% of genes near scaffold ends (potentially truncated) 87.04 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.148 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(97.222 % of family members)
Environment Ontology (ENVO) Unclassified
(99.074 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(100.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 45.26%    β-sheet: 0.00%    Coil/Unstructured: 54.74%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.15 %
UnclassifiedrootN/A1.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008832|Ga0103951_10513498All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota649Open in IMG/M
3300008998|Ga0103502_10382151All Organisms → cellular organisms → Eukaryota → Opisthokonta522Open in IMG/M
3300009022|Ga0103706_10112121All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota641Open in IMG/M
3300009028|Ga0103708_100257346All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota536Open in IMG/M
3300009274|Ga0103878_1031143All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota596Open in IMG/M
3300018592|Ga0193113_1023673All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota648Open in IMG/M
3300018626|Ga0192863_1038260Not Available575Open in IMG/M
3300018685|Ga0193086_1041721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota720Open in IMG/M
3300018685|Ga0193086_1063043All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota556Open in IMG/M
3300018686|Ga0192840_1040402All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota580Open in IMG/M
3300018690|Ga0192917_1037026All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota740Open in IMG/M
3300018699|Ga0193195_1040262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota560Open in IMG/M
3300018700|Ga0193403_1056241All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota573Open in IMG/M
3300018703|Ga0193274_1020858All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota661Open in IMG/M
3300018706|Ga0193539_1063870All Organisms → cellular organisms → Eukaryota → Opisthokonta579Open in IMG/M
3300018715|Ga0193537_1083764All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota613Open in IMG/M
3300018727|Ga0193115_1053384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota644Open in IMG/M
3300018731|Ga0193529_1092266All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota509Open in IMG/M
3300018752|Ga0192902_1072653All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota616Open in IMG/M
3300018752|Ga0192902_1073217All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota613Open in IMG/M
3300018756|Ga0192931_1085983All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota588Open in IMG/M
3300018769|Ga0193478_1068462All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota567Open in IMG/M
3300018769|Ga0193478_1068871All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota565Open in IMG/M
3300018783|Ga0193197_1044088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota672Open in IMG/M
3300018784|Ga0193298_1075733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota619Open in IMG/M
3300018784|Ga0193298_1075916All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota618Open in IMG/M
3300018785|Ga0193095_1082262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota590Open in IMG/M
3300018796|Ga0193117_1060600All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota626Open in IMG/M
3300018796|Ga0193117_1064225All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota603Open in IMG/M
3300018801|Ga0192824_1089914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota585Open in IMG/M
3300018819|Ga0193497_1074021All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota625Open in IMG/M
3300018847|Ga0193500_1068728All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota605Open in IMG/M
3300018854|Ga0193214_1078450All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota613Open in IMG/M
3300018856|Ga0193120_1149312All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota526Open in IMG/M
3300018859|Ga0193199_1093010All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota646Open in IMG/M
3300018865|Ga0193359_1091435All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota574Open in IMG/M
3300018873|Ga0193553_1113251All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota672Open in IMG/M
3300018873|Ga0193553_1113700All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota670Open in IMG/M
3300018887|Ga0193360_1107965All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota635Open in IMG/M
3300018897|Ga0193568_1166993All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota625Open in IMG/M
3300018897|Ga0193568_1181070All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota580Open in IMG/M
3300018902|Ga0192862_1150980All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota546Open in IMG/M
3300018912|Ga0193176_10154671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota642Open in IMG/M
3300018912|Ga0193176_10195964All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota573Open in IMG/M
3300018919|Ga0193109_10177672All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota602Open in IMG/M
3300018929|Ga0192921_10177855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota644Open in IMG/M
3300018941|Ga0193265_10205637All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota615Open in IMG/M
3300018943|Ga0193266_10138090All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota613Open in IMG/M
3300018950|Ga0192892_10255745Not Available542Open in IMG/M
3300018957|Ga0193528_10231508All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota650Open in IMG/M
3300018957|Ga0193528_10254855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota606Open in IMG/M
3300018957|Ga0193528_10274753All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota573Open in IMG/M
3300018957|Ga0193528_10282345All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota561Open in IMG/M
3300018958|Ga0193560_10204143All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota613Open in IMG/M
3300018959|Ga0193480_10196104All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota600Open in IMG/M
3300018960|Ga0192930_10306543All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota513Open in IMG/M
3300018961|Ga0193531_10312142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota537Open in IMG/M
3300018965|Ga0193562_10211337All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota536Open in IMG/M
3300018965|Ga0193562_10220630All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota521Open in IMG/M
3300018966|Ga0193293_10084806All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota598Open in IMG/M
3300018969|Ga0193143_10148524All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota691Open in IMG/M
3300018969|Ga0193143_10163704All Organisms → cellular organisms → Eukaryota → Opisthokonta653Open in IMG/M
3300018978|Ga0193487_10211074All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota634Open in IMG/M
3300018979|Ga0193540_10138422All Organisms → cellular organisms → Eukaryota → Opisthokonta682Open in IMG/M
3300018979|Ga0193540_10143045All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota670Open in IMG/M
3300018985|Ga0193136_10160444All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota669Open in IMG/M
3300018986|Ga0193554_10353801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota554Open in IMG/M
3300018989|Ga0193030_10201839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota654Open in IMG/M
3300018989|Ga0193030_10267868All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota558Open in IMG/M
3300018993|Ga0193563_10239761All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota568Open in IMG/M
3300018993|Ga0193563_10269791All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota518Open in IMG/M
3300018994|Ga0193280_10296971All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota595Open in IMG/M
3300018996|Ga0192916_10109850All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota826Open in IMG/M
3300018998|Ga0193444_10184913All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota547Open in IMG/M
3300018999|Ga0193514_10296833All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota550Open in IMG/M
3300018999|Ga0193514_10296835All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota550Open in IMG/M
3300019002|Ga0193345_10180363All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota584Open in IMG/M
3300019004|Ga0193078_10033154All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota941Open in IMG/M
3300019005|Ga0193527_10378802All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota550Open in IMG/M
3300019006|Ga0193154_10228780All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota646Open in IMG/M
3300019006|Ga0193154_10292728All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota539Open in IMG/M
3300019006|Ga0193154_10317358All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota505Open in IMG/M
3300019007|Ga0193196_10307438All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota680Open in IMG/M
3300019008|Ga0193361_10264044All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota608Open in IMG/M
3300019010|Ga0193044_10281624All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota503Open in IMG/M
3300019011|Ga0192926_10314742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota669Open in IMG/M
3300019013|Ga0193557_10271438All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota524Open in IMG/M
3300019016|Ga0193094_10189319All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota720Open in IMG/M
3300019017|Ga0193569_10367986All Organisms → cellular organisms → Eukaryota → Opisthokonta567Open in IMG/M
3300019019|Ga0193555_10193394All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota688Open in IMG/M
3300019023|Ga0193561_10301651All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota572Open in IMG/M
3300019024|Ga0193535_10236232All Organisms → cellular organisms → Eukaryota → Opisthokonta570Open in IMG/M
3300019030|Ga0192905_10170106All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota612Open in IMG/M
3300019033|Ga0193037_10277032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota586Open in IMG/M
3300019040|Ga0192857_10294097All Organisms → cellular organisms → Eukaryota → Opisthokonta553Open in IMG/M
3300019051|Ga0192826_10284710All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota605Open in IMG/M
3300019052|Ga0193455_10378286All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota586Open in IMG/M
3300019055|Ga0193208_10436187All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota686Open in IMG/M
3300019111|Ga0193541_1063695All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota650Open in IMG/M
3300019131|Ga0193249_1101887All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota659Open in IMG/M
3300019144|Ga0193246_10255942All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota536Open in IMG/M
3300019147|Ga0193453_1134935All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota650Open in IMG/M
3300019147|Ga0193453_1135261All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota649Open in IMG/M
3300019147|Ga0193453_1135262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota649Open in IMG/M
3300019151|Ga0192888_10256669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota501Open in IMG/M
3300019151|Ga0192888_10256692All Organisms → cellular organisms → Eukaryota → Opisthokonta501Open in IMG/M
3300019152|Ga0193564_10192372All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota620Open in IMG/M
3300019152|Ga0193564_10199241All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota605Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine97.22%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.85%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300018592Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782094-ERR1712047)EnvironmentalOpen in IMG/M
3300018626Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000790 (ERX1789512-ERR1719180)EnvironmentalOpen in IMG/M
3300018685Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782360-ERR1712233)EnvironmentalOpen in IMG/M
3300018686Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000593 (ERX1789430-ERR1719415)EnvironmentalOpen in IMG/M
3300018690Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782228-ERR1712109)EnvironmentalOpen in IMG/M
3300018699Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000008 (ERX1782338-ERR1712211)EnvironmentalOpen in IMG/M
3300018700Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002043 (ERX1789597-ERR1719175)EnvironmentalOpen in IMG/M
3300018703Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782405-ERR1712108)EnvironmentalOpen in IMG/M
3300018706Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789488-ERR1719151)EnvironmentalOpen in IMG/M
3300018715Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002809 (ERX1789494-ERR1719339)EnvironmentalOpen in IMG/M
3300018727Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000357 (ERX1782136-ERR1711928)EnvironmentalOpen in IMG/M
3300018731Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782345-ERR1712158)EnvironmentalOpen in IMG/M
3300018752Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000662 (ERX1789652-ERR1719340)EnvironmentalOpen in IMG/M
3300018756Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000879 (ERX1789481-ERR1719268)EnvironmentalOpen in IMG/M
3300018769Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205)EnvironmentalOpen in IMG/M
3300018783Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782442-ERR1712209)EnvironmentalOpen in IMG/M
3300018784Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001620 (ERX1789528-ERR1719403)EnvironmentalOpen in IMG/M
3300018785Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000045 (ERX1789545-ERR1719351)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018801Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000063 (ERX1789476-ERR1719434)EnvironmentalOpen in IMG/M
3300018819Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002940 (ERX1789719-ERR1719288)EnvironmentalOpen in IMG/M
3300018847Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003005 (ERX1789704-ERR1719166)EnvironmentalOpen in IMG/M
3300018854Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000076 (ERX1789602-ERR1719346)EnvironmentalOpen in IMG/M
3300018856Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001006 (ERX1782473-ERR1712200)EnvironmentalOpen in IMG/M
3300018859Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000012 (ERX1789645-ERR1719429)EnvironmentalOpen in IMG/M
3300018865Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001824 (ERX1789688-ERR1719211)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018887Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789534-ERR1719462)EnvironmentalOpen in IMG/M
3300018897Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002777EnvironmentalOpen in IMG/M
3300018902Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000790 (ERX1789490-ERR1719234)EnvironmentalOpen in IMG/M
3300018912Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000314 (ERX1782195-ERR1712243)EnvironmentalOpen in IMG/M
3300018919Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_139 - TARA_N000003043 (ERX1789401-ERR1719342)EnvironmentalOpen in IMG/M
3300018929Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782134-ERR1712223)EnvironmentalOpen in IMG/M
3300018941Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001288 (ERX1789482-ERR1719320)EnvironmentalOpen in IMG/M
3300018943Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001290 (ERX1789547-ERR1719206)EnvironmentalOpen in IMG/M
3300018950Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000711 (ERX1789413-ERR1719427)EnvironmentalOpen in IMG/M
3300018957Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)EnvironmentalOpen in IMG/M
3300018958Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003191EnvironmentalOpen in IMG/M
3300018959Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002199 (ERX1789530-ERR1719318)EnvironmentalOpen in IMG/M
3300018960Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000879 (ERX1789423-ERR1719357)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018965Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_149 - TARA_N000002141EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018969Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179)EnvironmentalOpen in IMG/M
3300018978Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789639-ERR1719422)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018993Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002703EnvironmentalOpen in IMG/M
3300018994Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001586 (ERX1789578-ERR1719368)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019002Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001764 (ERX1789384-ERR1719347)EnvironmentalOpen in IMG/M
3300019004Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782445-ERR1712173)EnvironmentalOpen in IMG/M
3300019005Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_148 - TARA_N000002119 (ERX1789730-ERR1719193)EnvironmentalOpen in IMG/M
3300019006Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000394 (ERX1782339-ERR1711936)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019008Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789684-ERR1719447)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019013Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003089EnvironmentalOpen in IMG/M
3300019016Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000045 (ERX1789509-ERR1719322)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019023Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_145 - TARA_N000003231EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019030Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000666 (ERX1789399-ERR1719153)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019052Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002402 (ERX1789503-ERR1719228)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019144Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001503 (ERX1789695-ERR1719376)EnvironmentalOpen in IMG/M
3300019147Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002400 (ERX1782434-ERR1711973)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300019152Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002717EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103951_1051349813300008832MarineHGGVSRLLHFKDSLEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSIIDAKLDYIIQQLAAEKAN*
Ga0103502_1038215113300008998MarineMGCPVGLRLAFLLLLVFALQSQALYLSSDGSPAVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA*
Ga0103706_1011212123300009022Ocean WaterPNSEGSPGGSTLQTRSLPRQVRMGSSVGFRLAFLLLLVFALQTQALYLGSDGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA*
Ga0103708_10025734613300009028Ocean WaterLEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN*
Ga0103878_103114313300009274Surface Ocean WaterKDSPEQAMAHKVGVRLAFLLLLIATLQSQALYLKGGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN*
Ga0193113_102367313300018592MarineMGVSRLLHSKDSLEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0192863_103826013300018626MarineFYCLIHFYKRTMGYPAGLRLAFLLLLVFALQSQALYLSSDGSAVHGLTKRRPEMGAQGFTGDSFNVNWLTRGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193086_104172123300018685MarineMGCPVGLRLAFILLLVFALQTQALYLGSDGSSVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193086_106304323300018685MarineQVIMGCPIGFRFAFLLLLVFASLQTQALYLSGDGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIRQLAAEKA
Ga0192840_104040223300018686MarineMACQVTLRLAFLLLLVFALQSQALYLSNDGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRAGGRSSIDAKLDYIIQQLAAEKA
Ga0192917_103702613300018690MarineTWGVSRLLHFKDSPEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193195_104026213300018699MarineLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193403_105624123300018700MarineMGCPIGFRFAFLLLLVFASLQTQALYLSGDGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIRQLAAEKA
Ga0193274_102085813300018703MarineMGCPVGLRFALLLLLVFASLQTQALYLSSDGSPMHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRSGGRSSIDAKLDYIIQQLAAEKA
Ga0193539_106387013300018706MarineMGCPVGLRLAFLLLLVFALQTQALYLSSDGSPAVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193537_108376413300018715MarinePNSEGSPGGSTLQTRSLPRQVRMGSSVGFRLAFLLLLVFALQTQALYLGSDGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193115_105338413300018727MarineMGVSRLLHFNDSLEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193529_109226613300018731MarineCQVTLRLAFLLLLVFALQSQALYLSNDGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRAGGRSSIDAKLDYIIQQLAAEKA
Ga0192902_107265313300018752MarineHFKDSIEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0192902_107321713300018752MarineSKDSLEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVQGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0192931_108598313300018756MarineEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193478_106846213300018769MarineKDSLEEAMAHKVGVRLAFLLLLVATLQCQALYLKGGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193478_106887113300018769MarineKDSPEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193197_104408813300018783MarineMGVSRLLHFKDSPEQAMAHKVGVRLAFLLLLIATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193298_107573313300018784MarineNDSLEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193298_107591613300018784MarineKDSLEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193095_108226213300018785MarineHSKDSLEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193117_106060013300018796MarineEGSPGGSTLQTHSLPRQVRMGSSVGFRLAFLLLLVFALQTQALYLGSDGSPVHGVGKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193117_106422523300018796MarineEGSPGGSTLQTRSLPRQVRMGSSVGFRLAFLLLLVFALQTQALYLGSDGSPVHGVGKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0192824_108991413300018801MarineHFKDSLEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193497_107402113300018819MarineLHSKDSLEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193500_106872813300018847MarineFNDSLEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193214_107845013300018854MarineHFNDSLEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193120_114931213300018856MarineLVFALQTQALYLGSDGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193199_109301013300018859MarineGVSRLLHFKDSPEQAMAHKVGVRLAFLLLLIATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193359_109143513300018865MarineNDSLEQAMAHKVGVRLAFLLLLVATLQQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193553_111325113300018873MarineHGGVSRLLHFNDSPEQAMAHQVGVRLAFLLLLVATLQSQALYLSGESSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193553_111370013300018873MarineMGVSRLLHFKDSIEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRDGGRSSIDAKLDYIIQQLAAEKAN
Ga0193360_110796513300018887MarineLHSKDSLEEAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193568_116699313300018897MarineNSEGSPGGSTLQTRSLPRQVRMDSSVGFRLAFLLLLVFALQTQALYLGSDGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193568_118107013300018897MarineMGCPVGLRLAFLLLLVFALQTQALYLSSDGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0192862_115098013300018902MarineFYGLIHFYKRTMGYPAGLRLAFLLLLVFALQTQALYLSSDGSPVHGLTKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193176_1015467123300018912MarineLLAFALQTQALYLGSDGSSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAGKA
Ga0193176_1019596413300018912MarineAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTIKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193109_1017767213300018919MarineLHFKDSPEQAMAHKVGVRLAFLLLLIATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0192921_1017785513300018929MarineTMGVSRLLHFKDSLEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193265_1020563713300018941MarineHFNDSPEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSNIDAKLDYIIQQLAAEKAN
Ga0193266_1013809013300018943MarineLLHFNDSPEQAMAHKVGVRLAFLLLLIATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0192892_1025574513300018950MarineSTLQTRSLPRQVRMGSSVGFRLAFLLLLVFALQTQALYLGSDGSAVHGVGKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193528_1023150813300018957MarineMGVSGLPNSEGSPGGSTLQTRSLPRQVRMGSSVGFRLAFLLLLVFALQTQALYLGSDGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193528_1025485513300018957MarineTWALQTHSLPRQVRMGSSVGFRLAFLLLLVFALQTQALYLGSDGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193528_1027475313300018957MarineRMGCPVGLRLAFLLLLVFALQTQALYLSSDGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193528_1028234513300018957MarineLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193560_1020414313300018958MarineLHFKDSIEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193480_1019610413300018959MarineFNDSPEQAMAHQVGVRLAFLLLLVATLQSQALYLSGESSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0192930_1030654313300018960MarineDSLEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193531_1031214213300018961MarineGLTRTMGCPVGLRLAFLLLLVFALQSQALYLSSDGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193562_1021133713300018965MarinePQQVTMGCPVGLRLAFLLLLVFALQTQALYLSSDGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193562_1022063013300018965MarineVGLRFALLLLLVFASLQTQALYLSSDGSPMHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRSGGRSSIDAKLDYIIQQLAAEKA
Ga0193293_1008480613300018966MarineGSRLLHFKDSLEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193143_1014852413300018969MarineMGCPVGLRLAFILLLVFALQTQALYLGSEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193143_1016370413300018969MarineMGVSGLPNSEGSPGGSTLQTHSLPRQVRMGSSVGFRLAFLLLLVFALQTQTLYLGSDGSAVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193487_1021107413300018978MarineLLHSKDSLEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193540_1013842223300018979MarineMGYPVGLRLAFLLLLVFALQTQALYLSSDGSPAVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193540_1014304513300018979MarineMGVSRLPNSEGSPGGSTLQTHSLPRQVRMGSSVGFRLAFLLLLVFALQTQALYLGSDGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193136_1016044413300018985MarineMGVSRLLHFNDSIEQAMAHKAGVRLAFLLLLVATLQSQALYLSGESSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRLSIDAKLDYIIQQLAAEKAN
Ga0193554_1035380113300018986MarineFRLAFLLLLVFALQTQALYLGSDGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193030_1020183913300018989MarineMGVSGLPNSEGSPGGSTLQTHSLPRQVRMGSSVGFRLAFLLLLVFALQTQALYLGSDGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193030_1026786813300018989MarinePLSMACQVTLRLAFLLLLVFALQSQALYLSNDGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRAGGRSSIDAKLDYIIQQLAAEKA
Ga0193563_1023976113300018993MarineRQVRMGSSVGFRLAFLLLLVFALQTQALYLGSDGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193563_1026979113300018993MarinePELSSLTSIMGCPVGLRFALLLLLVFASLQTQALYLSSDGSPMHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRSGGRSSIDAKLDYIIQQLAAEKA
Ga0193280_1029697113300018994MarineKDSPEQAMAHKVGVRLAFLLLLIATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0192916_1010985013300018996MarineMGVSRLLHFKDSIEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193444_1018491313300018998MarineSVGFRLAFLLLLVFALQTQALYLGSDGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193514_1029683313300018999MarineHGVSRLLHFKDSPEQAMAHTVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193514_1029683513300018999MarineMGVSRLLHFNDSLEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193345_1018036313300019002MarineKDSLEQAMAHKVGVRLAFLLLLIATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193078_1003315413300019004MarineMGVSRLLHSKDSLEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSNIDAKLDYIIQQLAAEKAN
Ga0193527_1037880213300019005MarineMGCPVGLRLAFLLLLVFALQSQALYLGSDGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193154_1022878013300019006MarineGVSRLLHFKDSLEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193154_1029272823300019006MarineMGCPVGLRLAFILLLVFALQTQALYLGSDGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193154_1031735813300019006MarineGSPGGSTLQTRSLPRQVRMGSSVGFRLAFLLLLVFALQTQALYLGSDGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193196_1030743813300019007MarineLQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193361_1026404413300019008MarineEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193044_1028162413300019010MarineFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0192926_1031474213300019011MarineMGRVEGGGVSRLLHFKDSPEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193557_1027143813300019013MarineHFKDSLEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193094_1018931913300019016MarineLLHFKDSPEQAMAHKVGVRLAFLLLLIATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193569_1036798613300019017MarineQVRMGCPVGLRLAFLLLLVFALQTQALYLSSDGSPAVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193555_1019339413300019019MarineGVSRLLHSKDSLEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193561_1030165123300019023MarineRTLKAHQVDQLLFHWHSKPQQVRMGCPVGLRLAFLLLLVFALQTQALYLNSDGSPAVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193535_1023623213300019024MarineGCPVGLRLAFLLLLVFALQHTQALYLSSDGSPAVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0192905_1017010613300019030MarineLHSKDSLEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193037_1027703213300019033MarineGVRLAFLLLLVATLQSQALYLSGEGSPVHSLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0192857_1029409713300019040MarinePRQVRMGSSVGFRLAFLLLLVFALQTQALYLGSDGSAVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0192826_1028471013300019051MarineLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193455_1037828613300019052MarineMAHQVGVRLAFLLLLVATLQSQALYLKGGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193208_1043618713300019055MarineTWGSYKGWRVEGGGVSRLLHSKDSLEQAMAHQVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193541_106369513300019111MarineMGVSRLPNSEGSPGGSTLQTHSLPRQVRMGSSVGFRLAFLLLLVFALQTQALYLGSEGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193249_110188723300019131MarineMGCPVGLRLAFILLLVFALQSQALYLSSDGSPVHGLSKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLVAEKA
Ga0193246_1025594213300019144MarineFYCLIHFYKRTMGYPAGLRLAFFLLLVCALQSQALYLSSDGSPAHGLTKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193453_113493513300019147MarineTWGVSRLLHSKDSLEQAMAHQVGVRLAFLLLLIATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193453_113526113300019147MarineMGVSRLLHFNDSLEQAMAHKVGVRLAFLLLLIATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0193453_113526213300019147MarineGGVSRLLHFKDSPEQAMAHKVGVRLAFLLLLIATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN
Ga0192888_1025666923300019151MarineGFRLAFLLLLVFALQTQALYLGSDGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0192888_1025669213300019151MarineMVGLRLAFLLLLVFALQSQALYLSSDGSPAVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193564_1019237213300019152MarineRPNSEGSPGGSTLQTRSLPRQVRMGSSVGFRLAFLLLLVFALQTQALYLGSDGSPVHGVAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKA
Ga0193564_1019924113300019152MarineSLEQAMAHKVGVRLAFLLLLVATLQSQALYLSGEGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRGGGRSSIDAKLDYIIQQLAAEKAN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.