NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089915

Metagenome / Metatranscriptome Family F089915

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089915
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 48 residues
Representative Sequence ANAFLLSKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFANPTNE
Number of Associated Samples 92
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 87.04 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.333 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(28.704 % of family members)
Environment Ontology (ENVO) Unclassified
(56.481 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(56.481 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.11%    β-sheet: 0.00%    Coil/Unstructured: 57.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF12684DUF3799 89.81
PF02511Thy1 3.70
PF00436SSB 1.85
PF12705PDDEXK_1 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 3.70
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 1.85
COG2965Primosomal replication protein NReplication, recombination and repair [L] 1.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.07 %
UnclassifiedrootN/A0.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002408|B570J29032_109350570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3706Open in IMG/M
3300002408|B570J29032_109644997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3984Open in IMG/M
3300002835|B570J40625_101515173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3550Open in IMG/M
3300003394|JGI25907J50239_1100226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3565Open in IMG/M
3300007363|Ga0075458_10113165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3844Open in IMG/M
3300007544|Ga0102861_1108495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3743Open in IMG/M
3300007639|Ga0102865_1271547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3505Open in IMG/M
3300007708|Ga0102859_1002548All Organisms → Viruses → Predicted Viral4190Open in IMG/M
3300008448|Ga0114876_1093713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31213Open in IMG/M
3300008448|Ga0114876_1205575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3659Open in IMG/M
3300009068|Ga0114973_10704251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3514Open in IMG/M
3300009081|Ga0105098_10374670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3701Open in IMG/M
3300009085|Ga0105103_10932545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3510Open in IMG/M
3300009159|Ga0114978_10183547All Organisms → Viruses → Predicted Viral1330Open in IMG/M
3300009181|Ga0114969_10490824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3689Open in IMG/M
3300009181|Ga0114969_10739153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3526Open in IMG/M
3300009183|Ga0114974_10469032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3710Open in IMG/M
3300010157|Ga0114964_10602878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3515Open in IMG/M
3300010160|Ga0114967_10370864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3720Open in IMG/M
3300010354|Ga0129333_10545270All Organisms → Viruses → Predicted Viral1012Open in IMG/M
3300011011|Ga0139556_1016153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31072Open in IMG/M
3300012752|Ga0157629_1150311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3546Open in IMG/M
3300012769|Ga0138279_1196037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3512Open in IMG/M
3300013005|Ga0164292_10836711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3580Open in IMG/M
(restricted) 3300013127|Ga0172365_10070409All Organisms → Viruses → Predicted Viral2272Open in IMG/M
(restricted) 3300013131|Ga0172373_10374136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3895Open in IMG/M
(restricted) 3300013131|Ga0172373_10902354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3512Open in IMG/M
3300013295|Ga0170791_13145827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3927Open in IMG/M
3300013372|Ga0177922_10023973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31512Open in IMG/M
3300015050|Ga0181338_1022100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3992Open in IMG/M
3300017701|Ga0181364_1074048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3520Open in IMG/M
3300017747|Ga0181352_1017473All Organisms → Viruses → Predicted Viral2246Open in IMG/M
3300017747|Ga0181352_1072039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3975Open in IMG/M
3300017747|Ga0181352_1190913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3529Open in IMG/M
3300017774|Ga0181358_1091705All Organisms → Viruses → Predicted Viral1098Open in IMG/M
3300017784|Ga0181348_1191314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3740Open in IMG/M
3300019781|Ga0181360_114426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3651Open in IMG/M
3300019783|Ga0181361_110730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3712Open in IMG/M
3300019783|Ga0181361_113316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3645Open in IMG/M
3300019783|Ga0181361_120253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3527Open in IMG/M
3300019784|Ga0181359_1049563All Organisms → Viruses → Predicted Viral1620Open in IMG/M
3300020162|Ga0211735_10194644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3550Open in IMG/M
3300020550|Ga0208600_1059366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3562Open in IMG/M
3300021093|Ga0194123_10519406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3526Open in IMG/M
3300021963|Ga0222712_10182649All Organisms → Viruses → Predicted Viral1388Open in IMG/M
3300022179|Ga0181353_1159020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3515Open in IMG/M
3300023174|Ga0214921_10323373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3841Open in IMG/M
3300024348|Ga0244776_10924817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3514Open in IMG/M
3300024502|Ga0255181_1054691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3678Open in IMG/M
3300025732|Ga0208784_1119478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3785Open in IMG/M
3300025896|Ga0208916_10250529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3769Open in IMG/M
3300027123|Ga0255090_1011025All Organisms → Viruses → Predicted Viral1765Open in IMG/M
3300027123|Ga0255090_1028169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3927Open in IMG/M
3300027127|Ga0255071_1011691All Organisms → Viruses → Predicted Viral1441Open in IMG/M
3300027128|Ga0255099_1004468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33673Open in IMG/M
3300027137|Ga0255092_1002436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar35510Open in IMG/M
3300027141|Ga0255076_1008291All Organisms → Viruses → Predicted Viral2050Open in IMG/M
3300027141|Ga0255076_1022269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31170Open in IMG/M
3300027337|Ga0255087_1010042All Organisms → Viruses → Predicted Viral2308Open in IMG/M
3300027487|Ga0255091_1033185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3868Open in IMG/M
3300027491|Ga0255097_1044082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3852Open in IMG/M
3300027494|Ga0255094_1012390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32020Open in IMG/M
3300027529|Ga0255077_1022453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31144Open in IMG/M
3300027538|Ga0255085_1002830Not Available4558Open in IMG/M
3300027588|Ga0255101_1023540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3897Open in IMG/M
3300027597|Ga0255088_1002014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar37309Open in IMG/M
3300027675|Ga0209077_1072753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3945Open in IMG/M
3300027693|Ga0209704_1091085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3862Open in IMG/M
3300027743|Ga0209593_10283678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3571Open in IMG/M
3300027756|Ga0209444_10055585All Organisms → Viruses → Predicted Viral1765Open in IMG/M
(restricted) 3300028569|Ga0247843_1194791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3779Open in IMG/M
(restricted) 3300028569|Ga0247843_1194793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3779Open in IMG/M
(restricted) 3300029286|Ga0247841_10008034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar315364Open in IMG/M
(restricted) 3300029286|Ga0247841_10566949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3709Open in IMG/M
3300029349|Ga0238435_100897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar36228Open in IMG/M
3300031758|Ga0315907_10131246All Organisms → Viruses → Predicted Viral2132Open in IMG/M
3300031758|Ga0315907_10238054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31513Open in IMG/M
3300031784|Ga0315899_10848078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3830Open in IMG/M
3300031885|Ga0315285_10607804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3723Open in IMG/M
3300031885|Ga0315285_10863046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3559Open in IMG/M
3300031952|Ga0315294_10768909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3834Open in IMG/M
3300032093|Ga0315902_10890734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3686Open in IMG/M
3300032118|Ga0315277_10572237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31115Open in IMG/M
3300032143|Ga0315292_11050201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3675Open in IMG/M
3300032275|Ga0315270_10629140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3699Open in IMG/M
3300033233|Ga0334722_10129787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31896Open in IMG/M
3300033816|Ga0334980_0132362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31026Open in IMG/M
3300033979|Ga0334978_0048219All Organisms → Viruses → Predicted Viral2211Open in IMG/M
3300033980|Ga0334981_0070505All Organisms → Viruses → Predicted Viral1775Open in IMG/M
3300033980|Ga0334981_0344566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3649Open in IMG/M
3300033981|Ga0334982_0344371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3690Open in IMG/M
3300033994|Ga0334996_0153869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31276Open in IMG/M
3300034012|Ga0334986_0240333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3990Open in IMG/M
3300034018|Ga0334985_0606865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3609Open in IMG/M
3300034019|Ga0334998_0239217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31106Open in IMG/M
3300034061|Ga0334987_0243871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31229Open in IMG/M
3300034061|Ga0334987_0275786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31129Open in IMG/M
3300034062|Ga0334995_0137312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31785Open in IMG/M
3300034092|Ga0335010_0121302All Organisms → Viruses → Predicted Viral1703Open in IMG/M
3300034103|Ga0335030_0877343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3518Open in IMG/M
3300034105|Ga0335035_0687498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3527Open in IMG/M
3300034109|Ga0335051_0598950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3504Open in IMG/M
3300034117|Ga0335033_0322532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3785Open in IMG/M
3300034121|Ga0335058_0302842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3927Open in IMG/M
3300034166|Ga0335016_0175511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31428Open in IMG/M
3300034279|Ga0335052_0486158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3641Open in IMG/M
3300034283|Ga0335007_0804402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3510Open in IMG/M
3300034284|Ga0335013_0794364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3530Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater28.70%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater14.81%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake13.89%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake7.41%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment7.41%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.63%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.63%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.70%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.70%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.78%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.85%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.93%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007639Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02EnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300011011Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012752Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES162 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012769Freshwater microbial communities from Lake Montjoie, Canada - M_140205_X_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300019781Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.DEnvironmentalOpen in IMG/M
3300019783Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020550Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021093Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surfaceEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024502Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8dEnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027123Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8dEnvironmentalOpen in IMG/M
3300027127Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8hEnvironmentalOpen in IMG/M
3300027128Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8dEnvironmentalOpen in IMG/M
3300027137Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8dEnvironmentalOpen in IMG/M
3300027141Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8hEnvironmentalOpen in IMG/M
3300027337Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8dEnvironmentalOpen in IMG/M
3300027487Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8dEnvironmentalOpen in IMG/M
3300027491Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8dEnvironmentalOpen in IMG/M
3300027494Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8dEnvironmentalOpen in IMG/M
3300027529Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8hEnvironmentalOpen in IMG/M
3300027538Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8dEnvironmentalOpen in IMG/M
3300027588Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8dEnvironmentalOpen in IMG/M
3300027597Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8dEnvironmentalOpen in IMG/M
3300027675Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300029286 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18mEnvironmentalOpen in IMG/M
3300029349Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033979Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003EnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034109Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158EnvironmentalOpen in IMG/M
3300034117Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034166Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079EnvironmentalOpen in IMG/M
3300034279Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J29032_10935057023300002408FreshwaterIANAFLISKNLIKEGQNFRDVSTKVANMIVSDPDSFLIKAKAFSSPTLE*
B570J29032_10964499713300002408FreshwaterIANAFLLSKNLIKEGQNFRDVSTKVANMIVSDPDGFISKAKAFSAPTLE*
B570J40625_10151517323300002835FreshwaterLEPHSDIANAFLISKNLIKEGQNFRDVSTKVANMIIADADGFISKAKAFSSPTNE*
JGI25907J50239_110022623300003394Freshwater LakeAFLISKNLIKEGQNFRDVSTKVANMIVADPDSFISKAKAFANPPTE*
Ga0075458_1011316523300007363AqueousKNLIKEGQNFRDVSTKVANMIISDADGFLAKAKAFSSPTIE*
Ga0102861_110849513300007544EstuarineIANAFLVSKNLIKADQNFRDVSTKVANMILADSEGFISKAKAFANPPTE*
Ga0102865_127154723300007639EstuarineIKEGQNFRDVSTKVANMILADATGFITKATAFANPPTE*
Ga0102859_100254813300007708EstuarineKNLIKADQNFRDVSTKVANMILADSEGFISKAKAFANPPTE*
Ga0114876_109371313300008448Freshwater LakeQILEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIIADSDSFLIKAKAFSNPVTE*
Ga0114876_120557523300008448Freshwater LakeIKEGQNFRDVSTKVANMIISDSDSFLIKAKAYSNPTIE*
Ga0114973_1070425113300009068Freshwater LakeQNFRDVSTKVANMILADSEGFISKAKAFANPPTE*
Ga0105098_1037467013300009081Freshwater SedimentAFLLSKNLIKEGQNFRDVSTKVANMIVSDPDSFIIKAKAFSAPTLE*
Ga0105103_1093254513300009085Freshwater SedimentISKNLIKEGQNFRDVSTKVANMIVSDPDGFISKAKAFSAPTLE*
Ga0114978_1018354713300009159Freshwater LakeKLEQILEPHSDIANAFLVSKNLIKEGQNFRDVSTKVANMIVADADGFISKAKAFANPPTE
Ga0114969_1049082413300009181Freshwater LakeKNLIKESQNFRDVSTKVANMILADSEGFISKAKAFANPPTE*
Ga0114969_1073915313300009181Freshwater LakeDIANAFLLSKNLIKEGQNFRDVSTKVANMILADSEGFISKAKAFANPPTE*
Ga0114974_1046903223300009183Freshwater LakeEPHSDIANAFLVSKNLIKEGQNFRDVSTKVANMILADSEGFISKAKAFANPPTE*
Ga0114964_1060287823300010157Freshwater LakeLIKEGQNFRDVSTKVANMILADSEGFISKAKAFANPPTE*
Ga0114967_1037086413300010160Freshwater LakeLIKEGQNFRDVSTKVANMIVADPDSFISKAKAFSNPPTE*
Ga0129333_1054527023300010354Freshwater To Marine Saline GradientSKNLIKEGQNFRDVSTKVANMIVSDPDGFIAKAKAFSSPTIE*
Ga0139556_101615313300011011FreshwaterGQNFRDVSTKVANMILADSEGFISKAKAFANPPTE*
Ga0157629_115031113300012752FreshwaterNLIKEGQNFRDVSTKVANMIVSDPDSFLIKAKAFSAPTLE*
Ga0138279_119603723300012769Freshwater LakeKNLIKAEQNFRDVSTKVANMIVADPDSFISKAKAFANPPTE*
Ga0164292_1083671123300013005FreshwaterFLLSKNLIKEGQNFRDVSTKVANMIIADSDSFLIKAKAFSEPTIE*
(restricted) Ga0172365_1007040963300013127SedimentEQALEPHSEIANAFLFSKKLIAEDQNFRDVSTKVANMILADVDGFVAKAKAFKPNPVAE*
(restricted) Ga0172373_1037413633300013131FreshwaterSKKLIAEDQNFRDVSTKVANMILADVDGFVAKAKAFQPNPVAE*
(restricted) Ga0172373_1090235423300013131FreshwaterLEQALEPHSEIANAFLMSKKLIAEDQNFRDVSTKVANMILADVDGFVAKAKAFQPNPVAE
Ga0170791_1314582723300013295FreshwaterSKSLIKEGQNFRDVSTKVANMILADANGFITKATAFANPPTE*
Ga0177922_1002397313300013372FreshwaterLEQILEPHSETANAFLISKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFANPTNE*
Ga0181338_102210013300015050Freshwater LakeSKNLIKEGQNFRDVSTKVANMIVADADGFISKAKAFANPPTE*
Ga0181364_107404823300017701Freshwater LakeKAEQNFRDVSTKVANMIVADPDSFISKAKVFANPPTE
Ga0181352_101747353300017747Freshwater LakeISKNLIKEGQNFRDVSTKVANMIVSDPDSFLIKAKAFSAPTIE
Ga0181352_107203913300017747Freshwater LakeANAFLLSKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFANPTNE
Ga0181352_119091323300017747Freshwater LakeNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFSSPTLE
Ga0181358_109170513300017774Freshwater LakeSKNLIKEGQNFRDVSTKVANMIVADADGFISKAKAFANPPTE
Ga0181348_119131413300017784Freshwater LakeEGQNFRDVSTKVANMILADSEGFISKAKAFANPSNE
Ga0181360_11442623300019781Freshwater LakeKAEQNFRDVSTKVANMILADADGFISKAKAFANPPTE
Ga0181361_11073023300019783Freshwater LakeEAANAFLISKNLIKEGQNFRDVSTKVANMIVSDPDGFISKAKAFANPPTE
Ga0181361_11331613300019783Freshwater LakeDIANAFLVSKNLIKEGQNFRDVSTKVANMILADSEGFISKAKAFANPPTE
Ga0181361_12025313300019783Freshwater LakeFLVSKNLIKESQNFRDVSTKVANMIFADSEGFISKAKAFANPPTE
Ga0181359_104956313300019784Freshwater LakeEAANAFLISKNLIKAEQNFRDVSTKVANMILADADGFISKAKAFANPPTE
Ga0211735_1019464423300020162FreshwaterILEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMILADSEGFISKAKAFSNPPTE
Ga0208600_105936623300020550FreshwaterHSEIANAFLISKNLIKEGQNFRDVSTKVANMIVSDPDSFLIKAKAFSSPTLE
Ga0194123_1051940623300021093Freshwater LakeIANAFLLSKNLIKPDQNFRDVSTKVANMILNDVDGFVAKAKAFQPPPVAE
Ga0222712_1018264933300021963Estuarine WaterAFLVSKSLIKEGQNFRDVSTKVANMIIADSEGFISKAKAFVNIPTE
Ga0181353_115902023300022179Freshwater LakeIKEGQNFRDVSTKVANMIIADADGFISKAKAFSAPTLE
Ga0214921_1032337313300023174FreshwaterANAFLVSKNLIKEGQNFRDVSTKVANMIIADSDGFISKAKTFANPPTE
Ga0244776_1092481723300024348EstuarineNAFLVSKNLIKADQNFRDVSTKVANMILADSEGFISKAKAFANPPTE
Ga0255181_105469113300024502FreshwaterQILEPYSEMANAFLVSKNLIKPDQNFRDVSTKVANMILADADGFIAKAKAFANPTTE
Ga0208784_111947823300025732AqueousAQRLEDALEDHAEKANAFLLSKNLIKEGQNFRDVSAKVANMILSDVEAFIAKIQ
Ga0208916_1025052923300025896AqueousEQILEPHSEAANAFLLSKNLIKAEQNFRDVSTKVANMILADASGFITKATAFANPPTE
Ga0255090_101102513300027123FreshwaterSEQNFRDVSTKVANMIIADADGFISKAKAFSAPTLE
Ga0255090_102816923300027123FreshwaterSEQNFRDVSTKVANMIIADADGFISKAKAFANPVTE
Ga0255071_101169113300027127FreshwaterANAFLISKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFSAPTLE
Ga0255099_100446893300027128FreshwaterHSEAANAFLISKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFANPVTE
Ga0255092_1002436173300027137FreshwaterIANAFLLSKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFSAPTLE
Ga0255076_100829143300027141FreshwaterFLLSKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFSAPTLE
Ga0255076_102226913300027141FreshwaterPHSETANAFLISKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFSAPTIQ
Ga0255087_101004213300027337FreshwaterLIKSEQNFRDVSTKVANMIIADADGFISKAKAFANPVTE
Ga0255091_103318523300027487FreshwaterSKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFANPVTE
Ga0255097_104408223300027491FreshwaterILEPHSEAANAFLISKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFANPVTE
Ga0255094_101239043300027494FreshwaterNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFANPVTE
Ga0255077_102245313300027529FreshwaterSEAANAFLISKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFANPVTE
Ga0255085_100283013300027538FreshwaterIKSEQNFRDVSTKVANMIIADADGFISKAKAFSAPTLE
Ga0255101_102354023300027588FreshwaterLEQILEPHSEAANAFLISKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFANPVTE
Ga0255088_1002014233300027597FreshwaterEKLEQILEPHSEIANAFLLSKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFSAPTL
Ga0209077_107275313300027675Freshwater SedimentFLLSKNLIKEGQNFRDVSTKVANMIVSDPDSFIIKAKAFSAPTLE
Ga0209704_109108523300027693Freshwater SedimentQILEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIVSDPDGFISKAKAFSAPTLE
Ga0209593_1028367813300027743Freshwater SedimentNLIKEGQNFRDVSTKVANMIVSDPDGFISKAKAFSAPTIE
Ga0209444_1005558513300027756Freshwater LakeNAFLVSKNLIKAEQNFRDVSTKVANMIVADPDSFISKAKVFANPPTE
(restricted) Ga0247843_119479113300028569FreshwaterNLEKILEPHSEAANAFLLSKNLIKEGQNFRDVSTKVANMIIADANGFITKATAFSNPPTE
(restricted) Ga0247843_119479323300028569FreshwaterNLEKILEPHSEAANAFLLSKNLIKEGQNFRDVSTKVANMIIADADGFISKAKAFANPVTE
(restricted) Ga0247841_1000803413300029286FreshwaterANAFLLSKNLIKEGQNFRDVSTKVANMIIADANGFITKATAFSNPPTE
(restricted) Ga0247841_1056694923300029286FreshwaterKEGQNFRDVSTKVANMIIADADGFISKAKAFANPVTE
Ga0238435_10089713300029349FreshwaterIKEGQNFRDVSTKVANMIVSDPDSFLIKAKAFSEPTIE
Ga0315907_1013124663300031758FreshwaterLEAHAEKANAFLLSKNLIKEGQNFRDVSTKVANMILSDIPAFIAKIQ
Ga0315907_1023805413300031758FreshwaterANAFLISKNLIKEGQNFRDVSTKVANMIISDADGFIAKAKAFSSPTIE
Ga0315899_1084807813300031784FreshwaterNAFLLSKNLIKEGQNFRDVSTKVANMIIADSDSFLIKAKAFSNPVTE
Ga0315285_1060780413300031885SedimentPHSDIANAFLASKNLIKADQNFRDVSTKVANMILADSEGFISKAKAFANPPTE
Ga0315285_1086304613300031885SedimentPHSDIANAFLASKNLIKADQNFRDVSTKVANMILADAEGFISKAKTFANPSNE
Ga0315294_1076890923300031952SedimentIKADQNFRDVSTKVANMILADSEGFISKAKAFANPPTE
Ga0315902_1089073433300032093FreshwaterNAFLISKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFSAPTLE
Ga0315277_1057223713300032118SedimentLEQILEPHSDIANAFLLSKNLIKADQNFRDVSTKVANMILADSEGFISKAKAFSNPPTE
Ga0315292_1105020133300032143SedimentLEPHSDIANAFLVSKNLIKADQNFRDVSTKVANMILADAEGFISKAKAFANPSNE
Ga0315270_1062914023300032275SedimentPEISIIEKLEKVLEPISEIANAFLVHKNLIKEGQNFRDVSGKVAKIILADVEDFVTKAKAFSNPITE
Ga0334722_1012978713300033233SedimentEKVLEPISEIANAFLVHKNLIKEGQNFRDVSGKVAKIILADVEDFVTKAKAFSNPITE
Ga0334980_0132362_865_10263300033816FreshwaterPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFSAPTLE
Ga0334978_0048219_3_1913300033979FreshwaterVEKLEQILEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIIADSDSFLIKAKAFSEPTIE
Ga0334981_0070505_1654_17733300033980FreshwaterLIKEGQNFRDVSTKVANMIIADADGFISKAKAFVIPPTE
Ga0334981_0344566_2_1813300033980FreshwaterLEQILEPHSEAANAFLLSKNLIKAEQNFRDVSTKVANMILADASGFIAKATAFANPPTE
Ga0334982_0344371_1_1743300033981FreshwaterQILEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIVSDPDSFISKAKAFSAPTLE
Ga0334996_0153869_1128_12743300033994FreshwaterANAFLLSKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFSAPTLE
Ga0334986_0240333_859_9903300034012FreshwaterLSKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFSSPTIE
Ga0334985_0606865_423_6083300034018FreshwaterEKLEQILEPHSDIANAFLVSKNLIKAEQNFRDVSTKVANMILADASGFITKATAFANPPT
Ga0334998_0239217_971_11053300034019FreshwaterLLSKNLIKEGQNFRDVSTKVANMIIADADGFISKANAFANPPTE
Ga0334987_0243871_1053_12293300034061FreshwaterEQILEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIISDADGFLAKAKAFSAPTLE
Ga0334987_0275786_960_11273300034061FreshwaterLEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIIADADGFISKAKAFSAPTIE
Ga0334995_0137312_1659_17843300034062FreshwaterKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFANPTNE
Ga0335010_0121302_1557_17033300034092FreshwaterANAFLVSKNLIKEGQNFRDVSTKVANMIVADPDSFISKAKAFANPPTE
Ga0335030_0877343_371_5173300034103FreshwaterANAFLVSKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFSAPTLE
Ga0335035_0687498_2_1663300034105FreshwaterEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIISDSDSFLIKAKAYSNPTIE
Ga0335051_0598950_2_1663300034109FreshwaterEPHSEAANAFLVSKNLIKEAQNFRDVSTKVANMILADADGFISKAKTFANPPTE
Ga0335033_0322532_638_7843300034117FreshwaterANAFLISKNLIKEGQNFRDVSTKVANMIVSDPDSFIIKAKAFSSPTIE
Ga0335058_0302842_815_9253300034121FreshwaterEGQNFRDVSTKVANMILADAEGFISKAKAFANPPTE
Ga0335016_0175511_1248_14273300034166FreshwaterLEQILEPHSDIANAFLISKNLIKEGQNFRDVSTKVANMIIADADGFISKAKAFSSPTNE
Ga0335052_0486158_459_6413300034279FreshwaterKLEQILEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFSAPTLE
Ga0335007_0804402_3_1163300034283FreshwaterKEGQNFRDVSTKVANMILADSEGFISKAKTFANPPTE
Ga0335013_0794364_2_1333300034284FreshwaterLSKNLIKEGQNFRDVSTKVANMIVSDPDGFISKAKAFSAPTLE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.