Basic Information | |
---|---|
Family ID | F090053 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 108 |
Average Sequence Length | 40 residues |
Representative Sequence | MMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVAALGIAT |
Number of Associated Samples | 88 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 75.70 % |
% of genes near scaffold ends (potentially truncated) | 22.22 % |
% of genes from short scaffolds (< 2000 bps) | 89.81 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.296 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.704 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.259 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (47.222 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF13193 | AMP-binding_C | 45.37 |
PF00378 | ECH_1 | 45.37 |
PF16113 | ECH_2 | 3.70 |
PF01476 | LysM | 0.93 |
PF02979 | NHase_alpha | 0.93 |
PF06267 | DUF1028 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG3342 | Uncharacterized conserved protein, Ntn-hydrolase superfamily | General function prediction only [R] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.22 % |
Unclassified | root | N/A | 2.78 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004629|Ga0008092_11299573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 542 | Open in IMG/M |
3300005179|Ga0066684_10534133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 787 | Open in IMG/M |
3300005439|Ga0070711_101447946 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300005471|Ga0070698_100875596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 843 | Open in IMG/M |
3300005566|Ga0066693_10118481 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300005764|Ga0066903_101848717 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300005983|Ga0081540_1045307 | All Organisms → cellular organisms → Bacteria | 2236 | Open in IMG/M |
3300006806|Ga0079220_11089055 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300009093|Ga0105240_11593481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 683 | Open in IMG/M |
3300009792|Ga0126374_10174932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 1330 | Open in IMG/M |
3300010043|Ga0126380_10542468 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300010043|Ga0126380_11739953 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300010046|Ga0126384_10105226 | All Organisms → cellular organisms → Bacteria | 2091 | Open in IMG/M |
3300010048|Ga0126373_12670338 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300010320|Ga0134109_10497206 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300010361|Ga0126378_12384819 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300010362|Ga0126377_10251547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1720 | Open in IMG/M |
3300010366|Ga0126379_10234436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1794 | Open in IMG/M |
3300010366|Ga0126379_11299788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 834 | Open in IMG/M |
3300010398|Ga0126383_10177330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2021 | Open in IMG/M |
3300012198|Ga0137364_10416266 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300012481|Ga0157320_1005928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 830 | Open in IMG/M |
3300012960|Ga0164301_10631280 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300012971|Ga0126369_11832877 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300012987|Ga0164307_10285745 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 1169 | Open in IMG/M |
3300014325|Ga0163163_10325263 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
3300014497|Ga0182008_10499560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 669 | Open in IMG/M |
3300015265|Ga0182005_1195206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 606 | Open in IMG/M |
3300015372|Ga0132256_101827470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 715 | Open in IMG/M |
3300015374|Ga0132255_100428691 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
3300016319|Ga0182033_10843608 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300016371|Ga0182034_11587186 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300016404|Ga0182037_10532546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 989 | Open in IMG/M |
3300016422|Ga0182039_11997832 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300017944|Ga0187786_10424280 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300017959|Ga0187779_10037584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 2801 | Open in IMG/M |
3300018058|Ga0187766_10046444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 2543 | Open in IMG/M |
3300018060|Ga0187765_10266640 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300018064|Ga0187773_10385106 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300018433|Ga0066667_10391007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 1120 | Open in IMG/M |
3300018482|Ga0066669_10358932 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300020581|Ga0210399_10561361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 946 | Open in IMG/M |
3300020582|Ga0210395_10850912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 679 | Open in IMG/M |
3300021374|Ga0213881_10086256 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
3300021445|Ga0182009_10021342 | All Organisms → cellular organisms → Bacteria | 2459 | Open in IMG/M |
3300021560|Ga0126371_11874558 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300021560|Ga0126371_13052611 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300025916|Ga0207663_11636389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 518 | Open in IMG/M |
3300026116|Ga0207674_10470869 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300027750|Ga0209461_10085387 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300027765|Ga0209073_10189267 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300028884|Ga0307308_10214803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 922 | Open in IMG/M |
3300031543|Ga0318516_10339357 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300031543|Ga0318516_10603737 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300031544|Ga0318534_10428685 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300031546|Ga0318538_10385938 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300031572|Ga0318515_10345829 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300031572|Ga0318515_10360306 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300031573|Ga0310915_10080168 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
3300031640|Ga0318555_10243069 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
3300031640|Ga0318555_10251808 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300031680|Ga0318574_10922847 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300031681|Ga0318572_10967631 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300031718|Ga0307474_11592989 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300031719|Ga0306917_10463720 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300031719|Ga0306917_11526861 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300031723|Ga0318493_10473678 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300031723|Ga0318493_10630721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 598 | Open in IMG/M |
3300031723|Ga0318493_10750755 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300031744|Ga0306918_10450430 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300031747|Ga0318502_10527761 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300031764|Ga0318535_10118435 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
3300031765|Ga0318554_10527300 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300031796|Ga0318576_10286029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 778 | Open in IMG/M |
3300031832|Ga0318499_10115569 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300031845|Ga0318511_10458767 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300031846|Ga0318512_10347491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 741 | Open in IMG/M |
3300031939|Ga0308174_10135548 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
3300031946|Ga0310910_11234124 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300031946|Ga0310910_11434458 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300031981|Ga0318531_10320325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 701 | Open in IMG/M |
3300032054|Ga0318570_10091493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 1320 | Open in IMG/M |
3300032054|Ga0318570_10167971 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300032060|Ga0318505_10432295 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300032060|Ga0318505_10561224 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300032067|Ga0318524_10202624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 1014 | Open in IMG/M |
3300032076|Ga0306924_11019605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 907 | Open in IMG/M |
3300032770|Ga0335085_10036995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6733 | Open in IMG/M |
3300032770|Ga0335085_10038393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6593 | Open in IMG/M |
3300032770|Ga0335085_12556537 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300032782|Ga0335082_10406064 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300032783|Ga0335079_10556615 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300032783|Ga0335079_11937152 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300032805|Ga0335078_10008896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 14921 | Open in IMG/M |
3300032805|Ga0335078_11189950 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300032805|Ga0335078_12281127 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300032829|Ga0335070_10360574 | Not Available | 1397 | Open in IMG/M |
3300032893|Ga0335069_10401380 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
3300032893|Ga0335069_10597574 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
3300032893|Ga0335069_10941873 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300032897|Ga0335071_10455767 | Not Available | 1231 | Open in IMG/M |
3300032898|Ga0335072_10710164 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300032954|Ga0335083_10317954 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
3300032955|Ga0335076_10296035 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
3300033004|Ga0335084_10545724 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
3300033134|Ga0335073_10806415 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300033158|Ga0335077_10896895 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.70% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 18.52% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.41% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.85% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.93% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0008092_112995732 | 3300004629 | Tropical Rainforest Soil | MVEAHSSKSEYRHLIASIKLLTAAAPLGFAYVAALGIAT* |
Ga0066684_105341332 | 3300005179 | Soil | MMVEAHISKPRYRHVIASIKLLTAAAPLGFAHVAALGIAT* |
Ga0070711_1014479462 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MVEARIFKSKYRHIIASVKLLTAAAPLGLAYVAALGIVT* |
Ga0070698_1008755961 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GMMVEAHISKSKYRHVIASIKLLTAAAPLGSAYVAALGIAT* |
Ga0066693_101184812 | 3300005566 | Soil | MMAEAHISRSKYRHVIASIKLLTAAAPLGFAHVAALGIAT* |
Ga0066903_1018487172 | 3300005764 | Tropical Forest Soil | MMVEAHISKSKYRHLIASIKLLTAAAPLGFAYVAARGIAA* |
Ga0081540_10453073 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MMAEAHISKPRYRHVIAPVKLLTAAAPPGFAYVAARGTTT* |
Ga0079220_110890551 | 3300006806 | Agricultural Soil | MVEAHISKSKYRHVIASIKLLTAAAPLGFAYVAALGIAT* |
Ga0105240_115934811 | 3300009093 | Corn Rhizosphere | EAHISKSKYRYVIASIKLLTAAAPLGFAYVAALGITT* |
Ga0126374_101749322 | 3300009792 | Tropical Forest Soil | MVEAHISKSRYRHVIASIKLLTAAAPLGFAYVAALGIAT* |
Ga0126380_105424682 | 3300010043 | Tropical Forest Soil | MAGARISRSGYRHVIASIKLLTAAAPPGFAYVAALGIAT* |
Ga0126380_117399531 | 3300010043 | Tropical Forest Soil | NQVLTGMMVQARISTSGYRHVIASVKLLTAAAPPGFAYAAALGIAT* |
Ga0126384_101052262 | 3300010046 | Tropical Forest Soil | MVEAHISKSKYRHVIASIKLLTAAAPLGSAYVAALGIAT* |
Ga0126373_126703382 | 3300010048 | Tropical Forest Soil | MMVEAHISKFKYRHVIASIKLLTAAAPLGFAYVAALGIAT* |
Ga0134109_104972062 | 3300010320 | Grasslands Soil | MMVEAHISKSRYRHVIASIKLLTAAAPLGFAHVAALGIAT* |
Ga0126378_123848192 | 3300010361 | Tropical Forest Soil | MMVEAHISKSRYRHVIASIKLLTAAAPLGFAYVAALGIAT* |
Ga0126377_102515472 | 3300010362 | Tropical Forest Soil | MMAGAHISKSGYRHVIASVKLLTAAAPLGFAYVAALGIAT* |
Ga0126379_102344362 | 3300010366 | Tropical Forest Soil | MVEAHISKSKYRHVIASIKLLTAATLGSASVAAPGIAT* |
Ga0126379_112997881 | 3300010366 | Tropical Forest Soil | MAEAHISKSRYRHVIASIKLLTAAAPLGFAYVAARGTAT* |
Ga0126383_101773302 | 3300010398 | Tropical Forest Soil | MMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVAARGIAT* |
Ga0137364_104162662 | 3300012198 | Vadose Zone Soil | MVEAHISKSRYRHVIASIKLLTAAAPLGFAYVAALGIVT* |
Ga0157320_10059281 | 3300012481 | Arabidopsis Rhizosphere | MVEARVSKSKYRHVIASIKLLTAAAPPGSGYVAAHGIAR* |
Ga0164301_106312802 | 3300012960 | Soil | MVEAHISKSKYRHVISSIKLLTAAAPLGFAYVAALGITT* |
Ga0126369_110203401 | 3300012971 | Tropical Forest Soil | PRNQVLIGMMVEAHIAKPRYRHVIASIKLLTAAAPLGFAYVAALGIAT* |
Ga0126369_118328772 | 3300012971 | Tropical Forest Soil | MMIEAHISKSKYRHVIASIKLLTAAAPLGSASVAAPG |
Ga0164307_102857452 | 3300012987 | Soil | MVEAHISKSKYRHVISSIKLLTAAAPLGFAYVAALGIAT* |
Ga0163163_103252632 | 3300014325 | Switchgrass Rhizosphere | MVEAHISKSRYRHVIASIKLLTAAAPLGFAYVAALGIAI* |
Ga0182008_104995601 | 3300014497 | Rhizosphere | RNQVLIGMMVEAHIYKSRYRHVIASIKLLTAAAPLGFAYVAARGMAT* |
Ga0182005_11952062 | 3300015265 | Rhizosphere | VEAHISKSRYRHVIASIKLLTAAAPLGFAYVAALGIVT* |
Ga0132256_1018274702 | 3300015372 | Arabidopsis Rhizosphere | MIGMMVEAHISKSTYRHVIASSRLLTAAAPPGSGYVAAHGIAR* |
Ga0132255_1004286913 | 3300015374 | Arabidopsis Rhizosphere | MIGMMVDAHISKSTYRHVIASSRLLTAAAPPGSGYVAAHGIAR* |
Ga0182033_108436082 | 3300016319 | Soil | MVEAHISKSKYRHVIASIKLLTAAAPLGFAYMAALGIAT |
Ga0182034_115871862 | 3300016371 | Soil | MMVEVRISKSRYRHVIASIKLLTAAAPLGFAYVAAVGIVT |
Ga0182037_105325462 | 3300016404 | Soil | IVEAHISKSRYRHVIASIKLLAAAAPLGFAYVAARGIAT |
Ga0182039_119978322 | 3300016422 | Soil | VQAHISKSRYRHIIASIKLLTAAAPLGFARVAARGIAT |
Ga0187786_104242802 | 3300017944 | Tropical Peatland | MMAGAHISKPRYRHVIASIKLLTAAAPLGFAYVAARGIAA |
Ga0187779_100375843 | 3300017959 | Tropical Peatland | MMVEAHISKPKYRHVIASIKLLTAAAPLGFAYMAARGIAT |
Ga0187766_100464443 | 3300018058 | Tropical Peatland | MAGAHISKPRYRHVIASIKLLTAAAPLGFAYVAALGIAR |
Ga0187765_102666402 | 3300018060 | Tropical Peatland | MMVAAHISKSRYRHVIASITLLTAAAPLGFAYVAAHGIAT |
Ga0187773_103851062 | 3300018064 | Tropical Peatland | MMVEAHISKSKYRHLIASVKLLTAAAPLGFAYVADLGIAT |
Ga0066667_103910071 | 3300018433 | Grasslands Soil | LIGMMVEAHISKSKYRHVIASIKLLTAAAPLGSAYVAALGIAT |
Ga0066669_103589322 | 3300018482 | Grasslands Soil | MMVEAHISKPRYRHVIASIKLLTAAAPLGSAYVAALGIAT |
Ga0210399_105613611 | 3300020581 | Soil | QVLIGMMVEAHISKSKYRHVIASIKLLTAVAPLGSAYVAALGIAT |
Ga0210395_108509121 | 3300020582 | Soil | QLLIGMMVEAHISKSKYRHVIASIKLLTAAAPLGSAYVAALGTAT |
Ga0213881_100862562 | 3300021374 | Exposed Rock | MMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVAALGIAT |
Ga0182009_100213422 | 3300021445 | Soil | MMVEAHISKSRYRHVIASIKLLTAAAPLGFAYAAARGIAT |
Ga0126371_118745582 | 3300021560 | Tropical Forest Soil | MMVEAHISKFKYRHVIASIKLLTAAAPLGFAYVAALGIAT |
Ga0126371_130526112 | 3300021560 | Tropical Forest Soil | MMVEAHISKPRYRHVIASIKLLRAAAPPGFAYVAVLGIAT |
Ga0207663_116363892 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MMVEARIFKSKYRHIIASVKLLTAAAPLGLAYVAALGIVT |
Ga0207674_104708692 | 3300026116 | Corn Rhizosphere | MMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVAAFGIAI |
Ga0209461_100853872 | 3300027750 | Agave | MMVEAHIAKSKYRHVIASIKLLTAAAPLGFAYAAARGIAT |
Ga0209073_101892672 | 3300027765 | Agricultural Soil | MVEAHISKSKYRHVIASIKLLTAAAPLGFAYVAALGIAT |
Ga0307308_102148032 | 3300028884 | Soil | VKAHISKSRYRHVIASIKLLTAAAPLGFAYVAALGIAT |
Ga0318516_103393572 | 3300031543 | Soil | MVEAHISKSKYRHVIASIKLLTAAAPLGFAYVTAFGIAT |
Ga0318516_106037372 | 3300031543 | Soil | MVQAHISKSRYRHIIASIKLLTAAAPLGFACVAARGIAT |
Ga0318534_104286852 | 3300031544 | Soil | MVEVHISKSKYRHVIASIKLLPAAAPLGFAYVAALGIAT |
Ga0318538_103859382 | 3300031546 | Soil | MMAEAHICRSRYRHVIASIKLLTAAAPLGFAYVAAVGIVT |
Ga0318515_103458292 | 3300031572 | Soil | MMVQAHISKSRYRHIIASIKLLTAAAPLGFACVAARGIAT |
Ga0318515_103603062 | 3300031572 | Soil | MMAEAHICKSKFRHVIASIKLLTAAAPLGFAYAAVGIAT |
Ga0310915_100801683 | 3300031573 | Soil | MMVEAHISKSKYRHVIASIKLLPAAAPLGFAYVAALGIAT |
Ga0318555_102430692 | 3300031640 | Soil | MMVEVHISKSKYRHVIASIKLLPAAAPLGFAYVAALGIAT |
Ga0318555_102518082 | 3300031640 | Soil | MAEAHICRSRYRHVIASIKLLTAAAPLGFAYVAAVGIVT |
Ga0318574_109228472 | 3300031680 | Soil | HICRSRYRHVIASIKLLTAAAPLGFAYVAAVGIVT |
Ga0318572_109676312 | 3300031681 | Soil | MMAGAHISRPRYRHLIASIKLLRAAAPLGFADVAARGIAT |
Ga0307474_115929891 | 3300031718 | Hardwood Forest Soil | MMVEPHISKSKYRHVIASITLLTAAAPLGSAHVAAPGIAT |
Ga0306917_104637202 | 3300031719 | Soil | MAEAHICRSRYRHVIASIKLLRAAAPLGFADVAARGIAT |
Ga0306917_115268611 | 3300031719 | Soil | DRKMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVTAFGIAT |
Ga0318493_104736782 | 3300031723 | Soil | MMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVAALRIAT |
Ga0318493_106307212 | 3300031723 | Soil | AHICRSRYRHVIASIKLLTAAAPLGFAYVAAVGIVT |
Ga0318493_107507552 | 3300031723 | Soil | MMIKAHISRSTYRHVIASITLLTAAAPLGSASVAALGIAT |
Ga0306918_104504302 | 3300031744 | Soil | MMAEAHICRSRYRHVIASIKLLTAAAPLGFAYAAVGIAT |
Ga0318502_105277612 | 3300031747 | Soil | MMVEVRISKSRYRHVIASIKLLTAAAPLGFAYVAARGIAI |
Ga0318535_101184352 | 3300031764 | Soil | MMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVTAFGIAT |
Ga0318554_105273001 | 3300031765 | Soil | MAGAHISRPRYRHLIASIKLLRAAAPLGFADVAARGIAT |
Ga0318576_102860291 | 3300031796 | Soil | IGMMVQAHISKSRYRHIIASIKLLTAAAPLGFACVAARGIAT |
Ga0318499_101155692 | 3300031832 | Soil | MMVEAHISKSKYRHVIASIRRLTAAAPLGFAYVAARGIAT |
Ga0318511_104587672 | 3300031845 | Soil | MMAEAHICRSRYRHVIASIKLLTAAAPLGFAYVAAVG |
Ga0318512_103474911 | 3300031846 | Soil | KMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVTAFGIAT |
Ga0308174_101355482 | 3300031939 | Soil | MMAEAHISKSRYRHVIASIKLLTAAAPLGFAYVAARGIAT |
Ga0310910_112341242 | 3300031946 | Soil | MMVEARISKSKYRHVIASIKLLTAAAPLGFAYMAALGIAT |
Ga0310910_114344582 | 3300031946 | Soil | MVEAHISKSKYRHVIASIKLLTAAAPHGFAYVAALGMAT |
Ga0318531_103203251 | 3300031981 | Soil | MVEAHISKSKYRHVIASIKLLPAAAPLGFAYVAALGIAT |
Ga0318570_100914931 | 3300032054 | Soil | TSQPGFDRKMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVTAFGIAT |
Ga0318570_101679711 | 3300032054 | Soil | MMVQAHISKSRYRHIIASIKLLTAAAPLGFARVAARGIAT |
Ga0318505_104322951 | 3300032060 | Soil | MVEAHISKSKYRHVIASIKLLTAAAPLGFAYVAAVGIVT |
Ga0318505_105612241 | 3300032060 | Soil | VQAHISKSRYRHIIASIKLLTAAAPLGFACVAARGIAT |
Ga0318524_102026242 | 3300032067 | Soil | SQPGFDRKMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVTAFGIAT |
Ga0306924_110196051 | 3300032076 | Soil | VEAHISKPRYRHVIASIKLLRAAAPPGFAYVAVLGIAT |
Ga0335085_100369952 | 3300032770 | Soil | MVGAHISKSKYRHVIASIKLLTAAAPPGFAYVAARGIAT |
Ga0335085_100383932 | 3300032770 | Soil | MGMMAAAHISKSGYRHVSASIKLLTAAAPLGFAYVAAPGIAT |
Ga0335085_125565372 | 3300032770 | Soil | MMAEAHISKSKYRHVIASIKLLTAAAPLGSASVTAPGIAT |
Ga0335082_104060642 | 3300032782 | Soil | MMVEAHISKSKYRHVIASIKLLTAAAPPGSAYLAALGIAT |
Ga0335079_105566152 | 3300032783 | Soil | MMVEAHISKSKYRHLIASIKLLTAAAPLGFAYVAAPGIAT |
Ga0335079_119371522 | 3300032783 | Soil | MMAEAHISKPRYRHVIASIKLLTAAAPLGFAYMAARGIAT |
Ga0335078_1000889613 | 3300032805 | Soil | MMVEAHISKPRYRHVIASIKLLTAAAPLGFAYMAARGIAT |
Ga0335078_111899502 | 3300032805 | Soil | MMVEAHISKSKYRHLIASIKLLTAAAPLGFAYVAARGIGT |
Ga0335078_122811272 | 3300032805 | Soil | MMVEAHISKSKYRHVIASIKLLTAAAPLGVAYVTALGIAT |
Ga0335070_103605742 | 3300032829 | Soil | MMAEAHISKSKYRHVIASIKLLTAAAPLGSAYVAAFGVAT |
Ga0335069_104013802 | 3300032893 | Soil | MMVEAHVSTSKYRHGIVSIKPLTAATPLGSAYAAARGIAT |
Ga0335069_105975742 | 3300032893 | Soil | MVAAHIPQYRYRHVIASIKLLTAAAPLGFAYVAARGIAT |
Ga0335069_109418732 | 3300032893 | Soil | MAEARISKSRYRHLIASIKLLTAAPPGFAYAAALGIAA |
Ga0335071_104557672 | 3300032897 | Soil | MMAEAHISKSKYRHVIASIKLLTAAAPLGFAYVAARGSAT |
Ga0335072_107101642 | 3300032898 | Soil | MMVEAHISKSRYRHVIASIKLLTAAAPLGFAHVAARGIVI |
Ga0335083_103179542 | 3300032954 | Soil | MMVGAHISKSKYRHVIASIKLLTAAAPPGFAYVAARGIAT |
Ga0335076_102960352 | 3300032955 | Soil | MMVEERISKSKYRHVIAPIKLLTAPAPPGVAYVAALGIAA |
Ga0335084_105457242 | 3300033004 | Soil | MVEAHISKSKYRHVIASIKLLTAAAPPGFAYVAARGIAT |
Ga0335073_108064152 | 3300033134 | Soil | MGMMAAAHISKSGYRHVSASIKLLTAAAPLGFAYVAVPGIAT |
Ga0335077_108968952 | 3300033158 | Soil | MMVEAHISKSKYRHLIASIKLLTAAAPLGFAYVAARGIAT |
⦗Top⦘ |