NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090053

Metagenome / Metatranscriptome Family F090053

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090053
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 40 residues
Representative Sequence MMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVAALGIAT
Number of Associated Samples 88
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 75.70 %
% of genes near scaffold ends (potentially truncated) 22.22 %
% of genes from short scaffolds (< 2000 bps) 89.81 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.296 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.704 % of family members)
Environment Ontology (ENVO) Unclassified
(34.259 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(47.222 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF13193AMP-binding_C 45.37
PF00378ECH_1 45.37
PF16113ECH_2 3.70
PF01476LysM 0.93
PF02979NHase_alpha 0.93
PF06267DUF1028 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG3342Uncharacterized conserved protein, Ntn-hydrolase superfamilyGeneral function prediction only [R] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.22 %
UnclassifiedrootN/A2.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004629|Ga0008092_11299573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales542Open in IMG/M
3300005179|Ga0066684_10534133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium787Open in IMG/M
3300005439|Ga0070711_101447946All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300005471|Ga0070698_100875596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium843Open in IMG/M
3300005566|Ga0066693_10118481All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300005764|Ga0066903_101848717All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300005983|Ga0081540_1045307All Organisms → cellular organisms → Bacteria2236Open in IMG/M
3300006806|Ga0079220_11089055All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300009093|Ga0105240_11593481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium683Open in IMG/M
3300009792|Ga0126374_10174932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium1330Open in IMG/M
3300010043|Ga0126380_10542468All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300010043|Ga0126380_11739953All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300010046|Ga0126384_10105226All Organisms → cellular organisms → Bacteria2091Open in IMG/M
3300010048|Ga0126373_12670338All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300010320|Ga0134109_10497206All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300010361|Ga0126378_12384819All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300010362|Ga0126377_10251547All Organisms → cellular organisms → Bacteria → Proteobacteria1720Open in IMG/M
3300010366|Ga0126379_10234436All Organisms → cellular organisms → Bacteria → Proteobacteria1794Open in IMG/M
3300010366|Ga0126379_11299788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium834Open in IMG/M
3300010398|Ga0126383_10177330All Organisms → cellular organisms → Bacteria → Proteobacteria2021Open in IMG/M
3300012198|Ga0137364_10416266All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300012481|Ga0157320_1005928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium830Open in IMG/M
3300012960|Ga0164301_10631280All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300012971|Ga0126369_11832877All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300012987|Ga0164307_10285745All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri1169Open in IMG/M
3300014325|Ga0163163_10325263All Organisms → cellular organisms → Bacteria1591Open in IMG/M
3300014497|Ga0182008_10499560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium669Open in IMG/M
3300015265|Ga0182005_1195206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium606Open in IMG/M
3300015372|Ga0132256_101827470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria715Open in IMG/M
3300015374|Ga0132255_100428691All Organisms → cellular organisms → Bacteria1931Open in IMG/M
3300016319|Ga0182033_10843608All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300016371|Ga0182034_11587186All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300016404|Ga0182037_10532546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium989Open in IMG/M
3300016422|Ga0182039_11997832All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300017944|Ga0187786_10424280All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300017959|Ga0187779_10037584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium2801Open in IMG/M
3300018058|Ga0187766_10046444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium2543Open in IMG/M
3300018060|Ga0187765_10266640All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300018064|Ga0187773_10385106All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300018433|Ga0066667_10391007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium1120Open in IMG/M
3300018482|Ga0066669_10358932All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300020581|Ga0210399_10561361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium946Open in IMG/M
3300020582|Ga0210395_10850912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium679Open in IMG/M
3300021374|Ga0213881_10086256All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300021445|Ga0182009_10021342All Organisms → cellular organisms → Bacteria2459Open in IMG/M
3300021560|Ga0126371_11874558All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300021560|Ga0126371_13052611All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300025916|Ga0207663_11636389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium518Open in IMG/M
3300026116|Ga0207674_10470869All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300027750|Ga0209461_10085387All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300027765|Ga0209073_10189267All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300028884|Ga0307308_10214803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium922Open in IMG/M
3300031543|Ga0318516_10339357All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300031543|Ga0318516_10603737All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300031544|Ga0318534_10428685All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300031546|Ga0318538_10385938All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300031572|Ga0318515_10345829All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300031572|Ga0318515_10360306All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300031573|Ga0310915_10080168All Organisms → cellular organisms → Bacteria2169Open in IMG/M
3300031640|Ga0318555_10243069All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300031640|Ga0318555_10251808All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300031680|Ga0318574_10922847All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300031681|Ga0318572_10967631All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300031718|Ga0307474_11592989All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300031719|Ga0306917_10463720All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300031719|Ga0306917_11526861All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300031723|Ga0318493_10473678All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300031723|Ga0318493_10630721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium598Open in IMG/M
3300031723|Ga0318493_10750755All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300031744|Ga0306918_10450430All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300031747|Ga0318502_10527761All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300031764|Ga0318535_10118435All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300031765|Ga0318554_10527300All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300031796|Ga0318576_10286029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium778Open in IMG/M
3300031832|Ga0318499_10115569All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300031845|Ga0318511_10458767All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300031846|Ga0318512_10347491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium741Open in IMG/M
3300031939|Ga0308174_10135548All Organisms → cellular organisms → Bacteria1815Open in IMG/M
3300031946|Ga0310910_11234124All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300031946|Ga0310910_11434458All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300031981|Ga0318531_10320325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium701Open in IMG/M
3300032054|Ga0318570_10091493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium1320Open in IMG/M
3300032054|Ga0318570_10167971All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300032060|Ga0318505_10432295All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300032060|Ga0318505_10561224All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300032067|Ga0318524_10202624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium1014Open in IMG/M
3300032076|Ga0306924_11019605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium907Open in IMG/M
3300032770|Ga0335085_10036995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6733Open in IMG/M
3300032770|Ga0335085_10038393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6593Open in IMG/M
3300032770|Ga0335085_12556537All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300032782|Ga0335082_10406064All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300032783|Ga0335079_10556615All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300032783|Ga0335079_11937152All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300032805|Ga0335078_10008896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia14921Open in IMG/M
3300032805|Ga0335078_11189950All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300032805|Ga0335078_12281127All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300032829|Ga0335070_10360574Not Available1397Open in IMG/M
3300032893|Ga0335069_10401380All Organisms → cellular organisms → Bacteria1608Open in IMG/M
3300032893|Ga0335069_10597574All Organisms → cellular organisms → Bacteria1266Open in IMG/M
3300032893|Ga0335069_10941873All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300032897|Ga0335071_10455767Not Available1231Open in IMG/M
3300032898|Ga0335072_10710164All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300032954|Ga0335083_10317954All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300032955|Ga0335076_10296035All Organisms → cellular organisms → Bacteria1508Open in IMG/M
3300033004|Ga0335084_10545724All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300033134|Ga0335073_10806415All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300033158|Ga0335077_10896895All Organisms → cellular organisms → Bacteria894Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.70%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil18.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil12.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.41%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.93%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.93%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.93%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004629Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0008092_1129957323300004629Tropical Rainforest SoilMVEAHSSKSEYRHLIASIKLLTAAAPLGFAYVAALGIAT*
Ga0066684_1053413323300005179SoilMMVEAHISKPRYRHVIASIKLLTAAAPLGFAHVAALGIAT*
Ga0070711_10144794623300005439Corn, Switchgrass And Miscanthus RhizosphereMVEARIFKSKYRHIIASVKLLTAAAPLGLAYVAALGIVT*
Ga0070698_10087559613300005471Corn, Switchgrass And Miscanthus RhizosphereGMMVEAHISKSKYRHVIASIKLLTAAAPLGSAYVAALGIAT*
Ga0066693_1011848123300005566SoilMMAEAHISRSKYRHVIASIKLLTAAAPLGFAHVAALGIAT*
Ga0066903_10184871723300005764Tropical Forest SoilMMVEAHISKSKYRHLIASIKLLTAAAPLGFAYVAARGIAA*
Ga0081540_104530733300005983Tabebuia Heterophylla RhizosphereMMAEAHISKPRYRHVIAPVKLLTAAAPPGFAYVAARGTTT*
Ga0079220_1108905513300006806Agricultural SoilMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVAALGIAT*
Ga0105240_1159348113300009093Corn RhizosphereEAHISKSKYRYVIASIKLLTAAAPLGFAYVAALGITT*
Ga0126374_1017493223300009792Tropical Forest SoilMVEAHISKSRYRHVIASIKLLTAAAPLGFAYVAALGIAT*
Ga0126380_1054246823300010043Tropical Forest SoilMAGARISRSGYRHVIASIKLLTAAAPPGFAYVAALGIAT*
Ga0126380_1173995313300010043Tropical Forest SoilNQVLTGMMVQARISTSGYRHVIASVKLLTAAAPPGFAYAAALGIAT*
Ga0126384_1010522623300010046Tropical Forest SoilMVEAHISKSKYRHVIASIKLLTAAAPLGSAYVAALGIAT*
Ga0126373_1267033823300010048Tropical Forest SoilMMVEAHISKFKYRHVIASIKLLTAAAPLGFAYVAALGIAT*
Ga0134109_1049720623300010320Grasslands SoilMMVEAHISKSRYRHVIASIKLLTAAAPLGFAHVAALGIAT*
Ga0126378_1238481923300010361Tropical Forest SoilMMVEAHISKSRYRHVIASIKLLTAAAPLGFAYVAALGIAT*
Ga0126377_1025154723300010362Tropical Forest SoilMMAGAHISKSGYRHVIASVKLLTAAAPLGFAYVAALGIAT*
Ga0126379_1023443623300010366Tropical Forest SoilMVEAHISKSKYRHVIASIKLLTAATLGSASVAAPGIAT*
Ga0126379_1129978813300010366Tropical Forest SoilMAEAHISKSRYRHVIASIKLLTAAAPLGFAYVAARGTAT*
Ga0126383_1017733023300010398Tropical Forest SoilMMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVAARGIAT*
Ga0137364_1041626623300012198Vadose Zone SoilMVEAHISKSRYRHVIASIKLLTAAAPLGFAYVAALGIVT*
Ga0157320_100592813300012481Arabidopsis RhizosphereMVEARVSKSKYRHVIASIKLLTAAAPPGSGYVAAHGIAR*
Ga0164301_1063128023300012960SoilMVEAHISKSKYRHVISSIKLLTAAAPLGFAYVAALGITT*
Ga0126369_1102034013300012971Tropical Forest SoilPRNQVLIGMMVEAHIAKPRYRHVIASIKLLTAAAPLGFAYVAALGIAT*
Ga0126369_1183287723300012971Tropical Forest SoilMMIEAHISKSKYRHVIASIKLLTAAAPLGSASVAAPG
Ga0164307_1028574523300012987SoilMVEAHISKSKYRHVISSIKLLTAAAPLGFAYVAALGIAT*
Ga0163163_1032526323300014325Switchgrass RhizosphereMVEAHISKSRYRHVIASIKLLTAAAPLGFAYVAALGIAI*
Ga0182008_1049956013300014497RhizosphereRNQVLIGMMVEAHIYKSRYRHVIASIKLLTAAAPLGFAYVAARGMAT*
Ga0182005_119520623300015265RhizosphereVEAHISKSRYRHVIASIKLLTAAAPLGFAYVAALGIVT*
Ga0132256_10182747023300015372Arabidopsis RhizosphereMIGMMVEAHISKSTYRHVIASSRLLTAAAPPGSGYVAAHGIAR*
Ga0132255_10042869133300015374Arabidopsis RhizosphereMIGMMVDAHISKSTYRHVIASSRLLTAAAPPGSGYVAAHGIAR*
Ga0182033_1084360823300016319SoilMVEAHISKSKYRHVIASIKLLTAAAPLGFAYMAALGIAT
Ga0182034_1158718623300016371SoilMMVEVRISKSRYRHVIASIKLLTAAAPLGFAYVAAVGIVT
Ga0182037_1053254623300016404SoilIVEAHISKSRYRHVIASIKLLAAAAPLGFAYVAARGIAT
Ga0182039_1199783223300016422SoilVQAHISKSRYRHIIASIKLLTAAAPLGFARVAARGIAT
Ga0187786_1042428023300017944Tropical PeatlandMMAGAHISKPRYRHVIASIKLLTAAAPLGFAYVAARGIAA
Ga0187779_1003758433300017959Tropical PeatlandMMVEAHISKPKYRHVIASIKLLTAAAPLGFAYMAARGIAT
Ga0187766_1004644433300018058Tropical PeatlandMAGAHISKPRYRHVIASIKLLTAAAPLGFAYVAALGIAR
Ga0187765_1026664023300018060Tropical PeatlandMMVAAHISKSRYRHVIASITLLTAAAPLGFAYVAAHGIAT
Ga0187773_1038510623300018064Tropical PeatlandMMVEAHISKSKYRHLIASVKLLTAAAPLGFAYVADLGIAT
Ga0066667_1039100713300018433Grasslands SoilLIGMMVEAHISKSKYRHVIASIKLLTAAAPLGSAYVAALGIAT
Ga0066669_1035893223300018482Grasslands SoilMMVEAHISKPRYRHVIASIKLLTAAAPLGSAYVAALGIAT
Ga0210399_1056136113300020581SoilQVLIGMMVEAHISKSKYRHVIASIKLLTAVAPLGSAYVAALGIAT
Ga0210395_1085091213300020582SoilQLLIGMMVEAHISKSKYRHVIASIKLLTAAAPLGSAYVAALGTAT
Ga0213881_1008625623300021374Exposed RockMMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVAALGIAT
Ga0182009_1002134223300021445SoilMMVEAHISKSRYRHVIASIKLLTAAAPLGFAYAAARGIAT
Ga0126371_1187455823300021560Tropical Forest SoilMMVEAHISKFKYRHVIASIKLLTAAAPLGFAYVAALGIAT
Ga0126371_1305261123300021560Tropical Forest SoilMMVEAHISKPRYRHVIASIKLLRAAAPPGFAYVAVLGIAT
Ga0207663_1163638923300025916Corn, Switchgrass And Miscanthus RhizosphereMMVEARIFKSKYRHIIASVKLLTAAAPLGLAYVAALGIVT
Ga0207674_1047086923300026116Corn RhizosphereMMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVAAFGIAI
Ga0209461_1008538723300027750AgaveMMVEAHIAKSKYRHVIASIKLLTAAAPLGFAYAAARGIAT
Ga0209073_1018926723300027765Agricultural SoilMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVAALGIAT
Ga0307308_1021480323300028884SoilVKAHISKSRYRHVIASIKLLTAAAPLGFAYVAALGIAT
Ga0318516_1033935723300031543SoilMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVTAFGIAT
Ga0318516_1060373723300031543SoilMVQAHISKSRYRHIIASIKLLTAAAPLGFACVAARGIAT
Ga0318534_1042868523300031544SoilMVEVHISKSKYRHVIASIKLLPAAAPLGFAYVAALGIAT
Ga0318538_1038593823300031546SoilMMAEAHICRSRYRHVIASIKLLTAAAPLGFAYVAAVGIVT
Ga0318515_1034582923300031572SoilMMVQAHISKSRYRHIIASIKLLTAAAPLGFACVAARGIAT
Ga0318515_1036030623300031572SoilMMAEAHICKSKFRHVIASIKLLTAAAPLGFAYAAVGIAT
Ga0310915_1008016833300031573SoilMMVEAHISKSKYRHVIASIKLLPAAAPLGFAYVAALGIAT
Ga0318555_1024306923300031640SoilMMVEVHISKSKYRHVIASIKLLPAAAPLGFAYVAALGIAT
Ga0318555_1025180823300031640SoilMAEAHICRSRYRHVIASIKLLTAAAPLGFAYVAAVGIVT
Ga0318574_1092284723300031680SoilHICRSRYRHVIASIKLLTAAAPLGFAYVAAVGIVT
Ga0318572_1096763123300031681SoilMMAGAHISRPRYRHLIASIKLLRAAAPLGFADVAARGIAT
Ga0307474_1159298913300031718Hardwood Forest SoilMMVEPHISKSKYRHVIASITLLTAAAPLGSAHVAAPGIAT
Ga0306917_1046372023300031719SoilMAEAHICRSRYRHVIASIKLLRAAAPLGFADVAARGIAT
Ga0306917_1152686113300031719SoilDRKMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVTAFGIAT
Ga0318493_1047367823300031723SoilMMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVAALRIAT
Ga0318493_1063072123300031723SoilAHICRSRYRHVIASIKLLTAAAPLGFAYVAAVGIVT
Ga0318493_1075075523300031723SoilMMIKAHISRSTYRHVIASITLLTAAAPLGSASVAALGIAT
Ga0306918_1045043023300031744SoilMMAEAHICRSRYRHVIASIKLLTAAAPLGFAYAAVGIAT
Ga0318502_1052776123300031747SoilMMVEVRISKSRYRHVIASIKLLTAAAPLGFAYVAARGIAI
Ga0318535_1011843523300031764SoilMMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVTAFGIAT
Ga0318554_1052730013300031765SoilMAGAHISRPRYRHLIASIKLLRAAAPLGFADVAARGIAT
Ga0318576_1028602913300031796SoilIGMMVQAHISKSRYRHIIASIKLLTAAAPLGFACVAARGIAT
Ga0318499_1011556923300031832SoilMMVEAHISKSKYRHVIASIRRLTAAAPLGFAYVAARGIAT
Ga0318511_1045876723300031845SoilMMAEAHICRSRYRHVIASIKLLTAAAPLGFAYVAAVG
Ga0318512_1034749113300031846SoilKMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVTAFGIAT
Ga0308174_1013554823300031939SoilMMAEAHISKSRYRHVIASIKLLTAAAPLGFAYVAARGIAT
Ga0310910_1123412423300031946SoilMMVEARISKSKYRHVIASIKLLTAAAPLGFAYMAALGIAT
Ga0310910_1143445823300031946SoilMVEAHISKSKYRHVIASIKLLTAAAPHGFAYVAALGMAT
Ga0318531_1032032513300031981SoilMVEAHISKSKYRHVIASIKLLPAAAPLGFAYVAALGIAT
Ga0318570_1009149313300032054SoilTSQPGFDRKMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVTAFGIAT
Ga0318570_1016797113300032054SoilMMVQAHISKSRYRHIIASIKLLTAAAPLGFARVAARGIAT
Ga0318505_1043229513300032060SoilMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVAAVGIVT
Ga0318505_1056122413300032060SoilVQAHISKSRYRHIIASIKLLTAAAPLGFACVAARGIAT
Ga0318524_1020262423300032067SoilSQPGFDRKMVEAHISKSKYRHVIASIKLLTAAAPLGFAYVTAFGIAT
Ga0306924_1101960513300032076SoilVEAHISKPRYRHVIASIKLLRAAAPPGFAYVAVLGIAT
Ga0335085_1003699523300032770SoilMVGAHISKSKYRHVIASIKLLTAAAPPGFAYVAARGIAT
Ga0335085_1003839323300032770SoilMGMMAAAHISKSGYRHVSASIKLLTAAAPLGFAYVAAPGIAT
Ga0335085_1255653723300032770SoilMMAEAHISKSKYRHVIASIKLLTAAAPLGSASVTAPGIAT
Ga0335082_1040606423300032782SoilMMVEAHISKSKYRHVIASIKLLTAAAPPGSAYLAALGIAT
Ga0335079_1055661523300032783SoilMMVEAHISKSKYRHLIASIKLLTAAAPLGFAYVAAPGIAT
Ga0335079_1193715223300032783SoilMMAEAHISKPRYRHVIASIKLLTAAAPLGFAYMAARGIAT
Ga0335078_10008896133300032805SoilMMVEAHISKPRYRHVIASIKLLTAAAPLGFAYMAARGIAT
Ga0335078_1118995023300032805SoilMMVEAHISKSKYRHLIASIKLLTAAAPLGFAYVAARGIGT
Ga0335078_1228112723300032805SoilMMVEAHISKSKYRHVIASIKLLTAAAPLGVAYVTALGIAT
Ga0335070_1036057423300032829SoilMMAEAHISKSKYRHVIASIKLLTAAAPLGSAYVAAFGVAT
Ga0335069_1040138023300032893SoilMMVEAHVSTSKYRHGIVSIKPLTAATPLGSAYAAARGIAT
Ga0335069_1059757423300032893SoilMVAAHIPQYRYRHVIASIKLLTAAAPLGFAYVAARGIAT
Ga0335069_1094187323300032893SoilMAEARISKSRYRHLIASIKLLTAAPPGFAYAAALGIAA
Ga0335071_1045576723300032897SoilMMAEAHISKSKYRHVIASIKLLTAAAPLGFAYVAARGSAT
Ga0335072_1071016423300032898SoilMMVEAHISKSRYRHVIASIKLLTAAAPLGFAHVAARGIVI
Ga0335083_1031795423300032954SoilMMVGAHISKSKYRHVIASIKLLTAAAPPGFAYVAARGIAT
Ga0335076_1029603523300032955SoilMMVEERISKSKYRHVIAPIKLLTAPAPPGVAYVAALGIAA
Ga0335084_1054572423300033004SoilMVEAHISKSKYRHVIASIKLLTAAAPPGFAYVAARGIAT
Ga0335073_1080641523300033134SoilMGMMAAAHISKSGYRHVSASIKLLTAAAPLGFAYVAVPGIAT
Ga0335077_1089689523300033158SoilMMVEAHISKSKYRHLIASIKLLTAAAPLGFAYVAARGIAT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.