NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090245

Metagenome / Metatranscriptome Family F090245

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090245
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 53 residues
Representative Sequence MSMVGTIEDMRWEIKQQKKEIDKLRKFITKHKLIREFDEEERKRAEERYRANRI
Number of Associated Samples 80
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 74.07 %
% of genes near scaffold ends (potentially truncated) 27.78 %
% of genes from short scaffolds (< 2000 bps) 68.52 %
Associated GOLD sequencing projects 73
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Predicted Viral (50.000 % of family members)
NCBI Taxonomy ID 10239 (predicted)
Taxonomy All Organisms → Viruses → Predicted Viral

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(14.815 % of family members)
Environment Ontology (ENVO) Unclassified
(63.889 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.741 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 83.33%    β-sheet: 0.00%    Coil/Unstructured: 16.67%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF02511Thy1 32.41
PF01612DNA_pol_A_exo1 8.33
PF03796DnaB_C 8.33
PF13155Toprim_2 3.70
PF027395_3_exonuc_N 3.70
PF00589Phage_integrase 2.78
PF02945Endonuclease_7 2.78
PF05367Phage_endo_I 1.85
PF13481AAA_25 0.93
PF11753DUF3310 0.93
PF03819MazG 0.93
PF12705PDDEXK_1 0.93
PF00462Glutaredoxin 0.93
PF11651P22_CoatProtein 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 32.41
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 8.33
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 8.33
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 3.70


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms61.11 %
UnclassifiedrootN/A38.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10004067Not Available8233Open in IMG/M
3300000116|DelMOSpr2010_c10064875All Organisms → Viruses → Predicted Viral1515Open in IMG/M
3300000117|DelMOWin2010_c10005185Not Available7955Open in IMG/M
3300000117|DelMOWin2010_c10007251Not Available6548Open in IMG/M
3300000117|DelMOWin2010_c10011488All Organisms → Viruses → Predicted Viral4968Open in IMG/M
3300000117|DelMOWin2010_c10011646All Organisms → Viruses → Predicted Viral4929Open in IMG/M
3300000928|OpTDRAFT_10045503All Organisms → Viruses → Predicted Viral3683Open in IMG/M
3300000947|BBAY92_10028221All Organisms → Viruses → Predicted Viral1532Open in IMG/M
3300001959|GOS2247_1054903All Organisms → Viruses → Predicted Viral1269Open in IMG/M
3300003583|JGI26253J51717_1030592All Organisms → Viruses → Predicted Viral1130Open in IMG/M
3300003583|JGI26253J51717_1049970All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes787Open in IMG/M
3300003592|JGI26246J51724_1046733Not Available883Open in IMG/M
3300003620|JGI26273J51734_10019277All Organisms → Viruses → Predicted Viral2633Open in IMG/M
3300004097|Ga0055584_100265769All Organisms → Viruses → Predicted Viral1754Open in IMG/M
3300004448|Ga0065861_1005837All Organisms → Viruses → Predicted Viral4538Open in IMG/M
3300004448|Ga0065861_1211408Not Available613Open in IMG/M
3300005821|Ga0078746_1025677All Organisms → Viruses → Predicted Viral1224Open in IMG/M
3300005837|Ga0078893_10127748Not Available27685Open in IMG/M
3300006029|Ga0075466_1034513All Organisms → Viruses → Predicted Viral1560Open in IMG/M
3300006752|Ga0098048_1006775All Organisms → Viruses → Predicted Viral4275Open in IMG/M
3300006752|Ga0098048_1047620All Organisms → Viruses → Predicted Viral1354Open in IMG/M
3300006752|Ga0098048_1085856Not Available959Open in IMG/M
3300006752|Ga0098048_1089229Not Available938Open in IMG/M
3300006789|Ga0098054_1010173All Organisms → Viruses → Predicted Viral3885Open in IMG/M
3300006789|Ga0098054_1036178All Organisms → Viruses → Predicted Viral1921Open in IMG/M
3300006793|Ga0098055_1398651All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes509Open in IMG/M
3300006802|Ga0070749_10083073All Organisms → Viruses → Predicted Viral1911Open in IMG/M
3300006867|Ga0075476_10044260All Organisms → Viruses → Predicted Viral1819Open in IMG/M
3300006868|Ga0075481_10071011All Organisms → Viruses → Predicted Viral1314Open in IMG/M
3300006916|Ga0070750_10074635All Organisms → Viruses → Predicted Viral1601Open in IMG/M
3300006920|Ga0070748_1100163Not Available1105Open in IMG/M
3300007229|Ga0075468_10007909All Organisms → Viruses → Predicted Viral4297Open in IMG/M
3300007236|Ga0075463_10033134All Organisms → Viruses → Predicted Viral1687Open in IMG/M
3300007236|Ga0075463_10288840Not Available526Open in IMG/M
3300007276|Ga0070747_1110457All Organisms → Viruses → Predicted Viral1009Open in IMG/M
3300007539|Ga0099849_1362422Not Available514Open in IMG/M
3300007558|Ga0102822_1066238Not Available853Open in IMG/M
3300008219|Ga0114905_1014482All Organisms → Viruses → Predicted Viral3222Open in IMG/M
3300008219|Ga0114905_1096971All Organisms → Viruses → Predicted Viral1026Open in IMG/M
3300009086|Ga0102812_10317428Not Available847Open in IMG/M
3300009124|Ga0118687_10119439Not Available925Open in IMG/M
3300009413|Ga0114902_1171606Not Available538Open in IMG/M
3300009433|Ga0115545_1187822Not Available708Open in IMG/M
3300009433|Ga0115545_1296090Not Available538Open in IMG/M
3300009508|Ga0115567_10895549All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes527Open in IMG/M
3300010149|Ga0098049_1005750All Organisms → Viruses → Predicted Viral4388Open in IMG/M
3300010150|Ga0098056_1044794All Organisms → Viruses → Predicted Viral1535Open in IMG/M
3300010392|Ga0118731_107122293All Organisms → Viruses → Predicted Viral1044Open in IMG/M
3300010430|Ga0118733_105020033Not Available700Open in IMG/M
3300011252|Ga0151674_1001220Not Available8706Open in IMG/M
3300017697|Ga0180120_10311525Not Available628Open in IMG/M
3300017719|Ga0181390_1000243Not Available23601Open in IMG/M
3300017719|Ga0181390_1052919All Organisms → Viruses → Predicted Viral1186Open in IMG/M
3300017751|Ga0187219_1000259Not Available24572Open in IMG/M
3300017767|Ga0181406_1004481All Organisms → Viruses → Predicted Viral4709Open in IMG/M
3300017767|Ga0181406_1216122Not Available567Open in IMG/M
3300017770|Ga0187217_1200197Not Available660Open in IMG/M
3300017776|Ga0181394_1031294All Organisms → Viruses → Predicted Viral1861Open in IMG/M
3300017779|Ga0181395_1192485All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium636Open in IMG/M
3300017781|Ga0181423_1241939Not Available676Open in IMG/M
3300017782|Ga0181380_1036276All Organisms → Viruses → Predicted Viral1795Open in IMG/M
3300017824|Ga0181552_10047983All Organisms → Viruses → Predicted Viral2522Open in IMG/M
3300018642|Ga0188867_1009348Not Available504Open in IMG/M
3300019459|Ga0181562_10000337Not Available37995Open in IMG/M
3300019765|Ga0194024_1038221All Organisms → Viruses → Predicted Viral1050Open in IMG/M
3300019937|Ga0194022_1005602All Organisms → Viruses → Predicted Viral1628Open in IMG/M
3300020347|Ga0211504_1037441All Organisms → Viruses → Predicted Viral1198Open in IMG/M
3300020385|Ga0211677_10306837Not Available633Open in IMG/M
3300020440|Ga0211518_10490231Not Available555Open in IMG/M
3300021085|Ga0206677_10116355All Organisms → Viruses → Predicted Viral1238Open in IMG/M
3300021185|Ga0206682_10370933Not Available610Open in IMG/M
3300021335|Ga0213867_1139764All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium838Open in IMG/M
3300021371|Ga0213863_10001995Not Available14605Open in IMG/M
3300021371|Ga0213863_10080589All Organisms → Viruses → Predicted Viral1598Open in IMG/M
3300021373|Ga0213865_10031297All Organisms → Viruses → Predicted Viral2985Open in IMG/M
3300021373|Ga0213865_10035190All Organisms → Viruses → Predicted Viral2802Open in IMG/M
3300021373|Ga0213865_10247174Not Available857Open in IMG/M
3300021373|Ga0213865_10275371All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium795Open in IMG/M
3300021425|Ga0213866_10578398Not Available526Open in IMG/M
3300021957|Ga0222717_10002411Not Available14511Open in IMG/M
3300021957|Ga0222717_10156870All Organisms → Viruses → Predicted Viral1381Open in IMG/M
3300021958|Ga0222718_10062758All Organisms → Viruses → Predicted Viral2304Open in IMG/M
3300021959|Ga0222716_10148432All Organisms → Viruses → Predicted Viral1533Open in IMG/M
3300021960|Ga0222715_10277332Not Available962Open in IMG/M
3300022074|Ga0224906_1001507Not Available11384Open in IMG/M
3300022074|Ga0224906_1043014All Organisms → Viruses → Predicted Viral1482Open in IMG/M
3300022074|Ga0224906_1206370All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes534Open in IMG/M
3300022178|Ga0196887_1012122All Organisms → Viruses → Predicted Viral2740Open in IMG/M
3300022223|Ga0224501_10063854All Organisms → Viruses → Predicted Viral2407Open in IMG/M
3300022307|Ga0224507_10469471All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes513Open in IMG/M
3300022308|Ga0224504_10107536All Organisms → Viruses → Predicted Viral1135Open in IMG/M
(restricted) 3300024059|Ga0255040_10047995All Organisms → Viruses → Predicted Viral1567Open in IMG/M
3300024346|Ga0244775_10027944Not Available5040Open in IMG/M
3300024346|Ga0244775_10437429All Organisms → Viruses → Predicted Viral1073Open in IMG/M
3300024346|Ga0244775_10729539All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes797Open in IMG/M
3300025070|Ga0208667_1000882Not Available11954Open in IMG/M
3300025070|Ga0208667_1003182Not Available5079Open in IMG/M
3300025070|Ga0208667_1015931All Organisms → Viruses → Predicted Viral1563Open in IMG/M
3300025668|Ga0209251_1089923All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium904Open in IMG/M
3300025759|Ga0208899_1030433All Organisms → Viruses → Predicted Viral2536Open in IMG/M
3300025828|Ga0208547_1041463All Organisms → Viruses → Predicted Viral1656Open in IMG/M
3300026453|Ga0228644_1038151Not Available936Open in IMG/M
3300027190|Ga0208674_1054937Not Available582Open in IMG/M
3300027751|Ga0208304_10288809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes575Open in IMG/M
3300029448|Ga0183755_1005318Not Available5983Open in IMG/M
3300029448|Ga0183755_1047629All Organisms → Viruses → Predicted Viral1103Open in IMG/M
3300034374|Ga0348335_007393All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-20116462Open in IMG/M
3300034374|Ga0348335_057101All Organisms → Viruses → Predicted Viral1458Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous14.81%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater12.96%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine11.11%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater8.33%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine5.56%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine5.56%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine4.63%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water4.63%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.70%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean2.78%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.78%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.78%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment2.78%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.85%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment1.85%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.85%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.85%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.85%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.93%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.93%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.93%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.93%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.93%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.93%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.93%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.93%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300001959Mangrove swamp microbial communities from Isabella Island, Equador - GS032EnvironmentalOpen in IMG/M
3300003583Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNAEnvironmentalOpen in IMG/M
3300003592Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNAEnvironmentalOpen in IMG/M
3300003620Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005821Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1EnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300008219Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009413Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011252Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeateEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018642Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p1EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300019937Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MGEnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020385Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965)EnvironmentalOpen in IMG/M
3300020440Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022223Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1EnvironmentalOpen in IMG/M
3300022307Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_13EnvironmentalOpen in IMG/M
3300022308Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24EnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025668Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026453Seawater microbial communities from Monterey Bay, California, United States - 56DEnvironmentalOpen in IMG/M
3300027190Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 (SPAdes)EnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1000406723300000116MarineMSMAGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDEERKRALERARINK*
DelMOSpr2010_1006487523300000116MarineMSMAGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDSERKRAMERYKANGISTD*
DelMOWin2010_1000518543300000117MarineMSMVGTIEDMRWEIKQKQKEIDTLRRFLTKNKLIREFDEEERKRALERYEANKI*
DelMOWin2010_1000725163300000117MarineMSMVGTIEDMRWEIKLLKDENSRLRRFIKDKKLIREFDDSERKRAMERTRANSDSREY*
DelMOWin2010_1001148853300000117MarineMSMVGTIEDMRWQIKHQEKEIARLKKFIYDNNLIREFDEEERKRAAERERMNRDVYG*
DelMOWin2010_1001164633300000117MarineMSMVGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDEERKRALERARINK*
OpTDRAFT_1004550353300000928Freshwater And MarineMSMAGTIEDMRWQIKQQEKEIARLKSFIYDNNLIREFDEEERKRAAERERMNRDVYG*
BBAY92_1002822143300000947Macroalgal SurfaceMSMAGTIEDMRWEIKQKQKEIDTLRRFLTKNKLIREFDDEERKRA
GOS2247_105490323300001959MarineMSMVGTIEDMRWQIKQQQKEIETLRRFLTKNKLIREFDEEERKRALERYEANQI*
JGI26253J51717_103059253300003583MarineMSMAGTIEDMRWEIKQKQKEIDTLRRFLTKNKLIREFDDEERKRAXERYEANKI*
JGI26253J51717_104997043300003583MarineMSMAGTIEDMRWQIKQQEKEIATLKKFIYDNKLIREFDEEERQRAAERERI
JGI26246J51724_104673323300003592MarineMSMAGTIEDMRWEIKQKQKEIDTLRRFLTKNKLIREFDDEERKRALERYEANKI*
JGI26273J51734_1001927743300003620MarineMSMXGTIEDMRWQIKQQEKEIATLKKFIYDNKLIREFDEEERQRAAERERINRDVYG*
Ga0055584_10026576943300004097Pelagic MarineMSMVGTIEDMRWEIKLLKDENSRLRRFIKDNKLIREFDDSERKRAMERTRANSDSREY*
Ga0065861_100583743300004448MarineMSMAGTIEDMRWEIKQKQKEIDTLRRFLTKNKLIREFDEEERKRALERYEANQI*
Ga0065861_121140823300004448MarineMSMVGTIEDMRWEIKLLKDENSRLRRFIKDNKLIREFDDLERKRAMERTRANSDSREY*
Ga0078746_102567723300005821Marine SedimentMSMAGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDDERKRAMERYKANGISTD*
Ga0078893_10127748443300005837Marine Surface WaterMSMAGTIEDMRWEIKLLKEENSKLRRFIKDHKLIREFDEQERKRALERYEANKI*
Ga0075466_103451333300006029AqueousMSMAGTIEDMRWQIKQQEKEIARLKKFIYDNNLIREFDEEERKRAAERERMNRDVYG*
Ga0098048_100677543300006752MarineMSMAGTIEDMRWQIKQQEKEIARLKKFIYDNKLIREFDEEERKRAAERERINRDVYG*
Ga0098048_104762053300006752MarineMSMVGTIEDMRWQIKQQEKEIARLKKFIYDNNLIREFDEEERKRAAERERMNRDVYG*
Ga0098048_108585633300006752MarineMSMAGTIEDMRWQIKQQQKEIDTLRRFLTKNKLIREFDDEERKRALERYEANKI*
Ga0098048_108922943300006752MarineMSIAGTIEDMRWQIKQQEKEIARLKRFIYDNNLIREFDEEERKRAAERERMNRDVYG*
Ga0098054_101017343300006789MarineMSMAGTIEDMRWQIKQQEKEIARLKRFIYDNNLIREFDEEERKRAAERERMNRDVYG*
Ga0098054_103617813300006789MarineMRWQIKQQQKEIDTLRRFLTKNKLIREFDDEERKRALERYEANKI*
Ga0098055_139865113300006793MarineMSMAGTIEDMRWQIKQQEKEIARLKKFIYDNKLIREFD
Ga0070749_1008307363300006802AqueousMSMVGTIEDMRWEIKQQKKEIDKLRKFITKHKLIREFDEEERKRAEERYKANQI*
Ga0075476_1004426023300006867AqueousMRWEIKLLKDENSRLRRFIKDHKLIREFDDEERKRALERARINK*
Ga0075481_1007101123300006868AqueousMSMAGTIEDMRWQIKQQEKEIARLKKFIYDNNLIREFDEEERKRAAEREGMNRDVYG*
Ga0070750_1007463563300006916AqueousMSMVGTIEDMRWEIKQQKKEIDKLRKFITKHKLIREFDEEE
Ga0070748_110016313300006920AqueousMSMAGTIEDMRWQIQQQEKEIARLKRFIYDNNLIREFDEEERKRAAERERMNRDVYG*
Ga0075468_1000790943300007229AqueousMAGTIEDMRWQIKQQEKEIARLKKFIYDNNLIREFDEEERKRAAEREGMNRDVYG*
Ga0075463_1003313433300007236AqueousMVGTIEDMRWEIKLLKDENSRLRRFIKDKKLIREFDDSERKRAMERTRANSDSREY*
Ga0075463_1028884013300007236AqueousMVGTIEDMRWEIKQQKKEIDKLRKFITKHKLIREFDEEERKRAEERYKANQI*
Ga0070747_111045733300007276AqueousRWQIKQQEKEIARLKKFIYDNNLIREFDEEERKRAAERERMNRDVYG*
Ga0099849_136242213300007539AqueousMAGTIEDLRWQIKQQQKEIDTLRRFLTKNKLIREFDDEERKRALERYEANKI*
Ga0102822_106623833300007558EstuarineMVGTIEDMRWEIKQKQKEIDTLRRFLTKNKLIREFDDEERKRALERYEANKI*
Ga0114905_101448233300008219Deep OceanMVGTIEDMRWEIKQQQKEIEKLRKFIAKHKLIREFDEEERKRAQERMIANGTSTY*
Ga0114905_109697113300008219Deep OceanSTMSMAGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDSERKRAMERNKANGISTD*
Ga0102812_1031742843300009086EstuarineMAGTIEDMRWQIKQQEKEIARLKRFIYDNNLIREFDEEERKRAAERERMNRDVYG*
Ga0118687_1011943923300009124SedimentMVGTIEDMRWEIKLLKDENSRLRRFIKDNKLIREFDDLERKRAMERTKANSDSREY*
Ga0114902_117160613300009413Deep OceanHWILIRNITMSMVGTIEDMRWEIKQQQKEIEKLRKFIAKHKLIREFDEEERKRAQERMIANGTSTY*
Ga0115545_118782233300009433Pelagic MarineMAGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDEERKRALERARINK*
Ga0115545_129609023300009433Pelagic MarineMAGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDSERKRAMERYKANGISTD*
Ga0115567_1089554913300009508Pelagic MarineMVGTIEDMRWEIKLLKDEKSRLRRFIKDHKLIREFDDEERKRALERARINK*
Ga0098049_100575043300010149MarineMAGTIEDMRWQIKQQEKEIARLKKFIYDNKLIREFDEEERKRAAERERINRDVYG*
Ga0098056_104479453300010150MarineMAGTIEDMRWQIKQQQKEIDTLRRFLTKNKLIREFDDEERKRALERYEANKI*
Ga0118731_10712229323300010392MarineMVGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDEERKRALERARINK*
Ga0118733_10502003313300010430Marine SedimentMSMAGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDEERKRALERAR
Ga0151674_100122073300011252MarineMAGTIEDMRWEIKQKQKEIDTLRRFLTKNKLIREFDDEERKRALERYEANKI*
Ga0180120_1031152513300017697Freshwater To Marine Saline GradientTIEDMRWEIKQKQKEIDTLRRFLTKNKLIREFDEEERKRALERYEANKI
Ga0181390_100024313300017719SeawaterKQQEKEIATLKKFIYDNKLIREFDEEERQRAAERERINKDVYG
Ga0181390_105291943300017719SeawaterMSMAGTIEDMRWQTKQQEKEIATLKKFIYDNKLIREFDEEERQRAAERERINKD
Ga0187219_100025913300017751SeawaterYMSMAGTIEDMRWQIKQQEKEIATLKKFIYDNKLIREFDEEERQRAAERERINKDVYG
Ga0181406_1004481133300017767SeawaterMSMVGTIEDMRWEIKQQQKEIEKLRKFIAKHKLIREFDEEE
Ga0181406_121612223300017767SeawaterMSMVGTIEDMRWEIKQQKKEIDKLRKFITKHKLIREFDEEERKRAEERYRANRI
Ga0187217_120019723300017770SeawaterMSMAGTIEDMRWEIKQKQKEIDTLRRFLTKNKLIREVDDEERKRSLERARINK
Ga0181394_103129413300017776SeawaterMSMAGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDEERKRALERARIN
Ga0181395_119248543300017779SeawaterMSMAGTIEDMRWEIKQQQKEIEKLRKFIAKHKLIREFDEEERKRA
Ga0181423_124193913300017781SeawaterMSMAGTIEDMRWEIKLLKDENSRLRRLIKDHKLIREFDDSERKRAMERYKANGISTD
Ga0181380_103627643300017782SeawaterMSMAGTIEDMRWQIKQQEKEIATLKKFIYDNKLIREFDEEERQRAAERERINKDVYG
Ga0181552_1004798353300017824Salt MarshMSMVGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDEERKRALERARKNK
Ga0188867_100934823300018642Freshwater LakeMAGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDEERKRALERARINK
Ga0181562_10000337483300019459Salt MarshMSMVGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDEERKRALERARINK
Ga0194024_103822113300019765FreshwaterMSMVGTIEDMRWEIKLLKDENSRLRRFIKDNKLIREFDDSERKRAMERTRANSDSREY
Ga0194022_100560263300019937FreshwaterMSMVGTIEDMRWEIKQKQKEIDTLRRFLTKNKLIREFDEEERKRALERYEANKI
Ga0211504_103744153300020347MarineMSMAGTIEDMRWQIKQQEKEIARLKRFIYDNNLIREFDEEERKRAAERERMNRDVYG
Ga0211677_1030683733300020385MarineMRWQIKQQEKEIARLKRFIYDNNLIREFDEEERKRAAERERMNRDVYG
Ga0211518_1049023123300020440MarineMSMAGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDSERKRAMERYKANGISTD
Ga0206677_1011635523300021085SeawaterMSMAGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDEERKRALERARINK
Ga0206682_1037093333300021185SeawaterMSMAGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDEERKR
Ga0213867_113976443300021335SeawaterMSMVGTIEDMRWEIKLLKDENSRLRRFIKDKKLIREFDDSERKRAMERTRANSDSREY
Ga0213863_10001995333300021371SeawaterMSMVGTIEDMRWEIKQQKKEIDKLRKFITKHKLIREFDEEERKRAEERYKANQI
Ga0213863_1008058923300021371SeawaterMSMAGTIEDMRWQIKQQEKEIARLKKFIYDNNLIREFDEEERKRAAEREGMNRDVYG
Ga0213865_1003129713300021373SeawaterMSMVGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDEERKRVLERARINK
Ga0213865_1003519023300021373SeawaterMSMVGTIEDMRWEIKQQKKEIDKLRKFITKHKLIREFDDEERKRALERYEANKT
Ga0213865_1024717433300021373SeawaterMVGTIEDMRWEIKQQKKEIDKLRKFITKHKLIREFDEEERKRAEERYKA
Ga0213865_1027537123300021373SeawaterMSMVGTIEDMRWQIKQQEKEIARLKKFIYDNNLIREFDEEERKRAAERERMNRDVYG
Ga0213866_1057839813300021425SeawaterVGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDEERKRVLERARINK
Ga0222717_10002411193300021957Estuarine WaterMSMAGTIEDMRWQIKQQQKEIDTLRRFLTKNKLIREFDDEERKRALERYEANQI
Ga0222717_1015687033300021957Estuarine WaterMSMAGTIEDMRWQIKQQEKEIATLKKFIYDNKLIREFDEEERQRAAERERINRDVYG
Ga0222718_1006275853300021958Estuarine WaterMSMVGTIEDMRWEIKLLKDENSRLRRFIKDNKLIREFDDLERKRAMERTRANSDSREY
Ga0222716_1014843233300021959Estuarine WaterMSMVGTIEDMRWQIKQQEKEIATLKKFIYDNKLIREFDEEERQRAAERERINRDVYG
Ga0222715_1027733213300021960Estuarine WaterMSMAGTIEDMRWQIKQQEKEIARLKKFIYDNNLIREFDEEE
Ga0224906_1001507163300022074SeawaterMSMVGTIEDMRWEIKQQQKEIEKLRKFIAKHKLIREFDEEERKRAQERMIANGTSTY
Ga0224906_104301423300022074SeawaterMSMAGTIEDMRWQIKQQEKEIARLKKFIYDNNLIREFDEEERKRAAERERMNRDVYG
Ga0224906_120637013300022074SeawaterMSMVGTIEDMRWEIKQQKKEIDKLRKFITKHKLIREFDEEERKRAEERYKANRI
Ga0196887_101212243300022178AqueousMSMAGTIEDMRWQIQQQEKEIARLKRFIYDNNLIREFDEEERKRAAERERMNRDVYG
Ga0224501_1006385463300022223SedimentMSMVGTIEDMRWQIKQQEKEIATLKKFIYDNKLIREFDEEERQRA
Ga0224507_1046947113300022307SedimentMSMAGTIEDMRWQIKQQEKEIATLKKFIYDNKLIREFDEEERQRAAERERINR
Ga0224504_1010753613300022308SedimentMSMAGTIEDMRWQIKQQEKEIARLKRFIYDNNLIREFDEEERRRAAERERMN
(restricted) Ga0255040_1004799523300024059SeawaterMSMAGTIEDMRWEIKQKQKEIDTLRRFLTKNKLIREFDDEERKRALERYEANKI
Ga0244775_10027944103300024346EstuarineMSMVGTIEDMRWEIKQKQKEIDTLRRFLTKNKLIREFDDEERKRALERYEANKI
Ga0244775_1043742933300024346EstuarineAGTIEDMRWQIKQQEKEIARLKRFIYDNNLIREFDEEERKRAAERERMNRDVYG
Ga0244775_1072953943300024346EstuarineMSMAGTIEDMRWQIKQQQKEIDTLRRFLTKNKLVREFDDEERKRALERYE
Ga0208667_100088273300025070MarineMSMAGTIEDMRWQIKQQEKEIARLKKFIYDNKLIREFDEEERKRAAERERINRDVYG
Ga0208667_1003182133300025070MarineMSIAGTIEDMRWQIKQQEKEIARLKRFIYDNNLIREFDEEERKRAAERERMNRDVYG
Ga0208667_101593143300025070MarineMSMAGTIEDMRWQIKQQQKEIDTLRRFLTKNKLIREFDDEERKRALERYEANKI
Ga0209251_108992313300025668MarineMSMAGTIEDMRWQIKQQQKEIDTLKKFLTKNKLIREFNDEERRRALERYEANKI
Ga0208899_103043313300025759AqueousMSMVGTIEDMRWEIKQQKKEIDKLRKFITKHKLIREFDEEER
Ga0208547_104146333300025828AqueousMRWEIKLLKDENSRLRRFIKDHKLIREFDDEERKRALERARINK
Ga0228644_103815133300026453SeawaterMVGTIEDMRWQIKQQEKEIARLKKFIYDNNLIREFDEEERKRAAERERMNRDVYG
Ga0208674_105493723300027190EstuarineMSMVGTIEDMRWEIKQKQKEIDTLRRFLTKNKLIREFDDEERKRALERY
Ga0208304_1028880913300027751EstuarineMSMVGTIEDMRWEIKQKQKEIDTLRRFLTKNKLIREFD
Ga0183755_1005318133300029448MarineMSMAGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDSERKRAMERNKANGISTD
Ga0183755_104762933300029448MarineMSMVGTIEDMRWQIKQQEKEIARLKKFIYDNNLIREFDEEERKRKERETEWN
Ga0348335_007393_6124_62793300034374AqueousMVGTIEDMRWEIKLLKDENSRLRRFIKDHKLIREFDDEERKRALERARINK
Ga0348335_057101_611_7813300034374AqueousMVGTIEDMRWEIKLLKDENSRLRRFIKDKKLIREFDDSERKRAMERTRANSDSREY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.